BYKdb

Dataset for cluster cd of phylum actinobacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|I0UTA5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia aeria F0474] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|Q1AUN8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rubrobacter xylanophilus] (length=239 residues).
MVVRTSLRRRAREEQRKGDLSGRLITLHDPSDPASEAYRTLRTGLLYAVVDAPPRVISLTSPGPTEGKSTVCANLGVVLA
QANKRTLLIDGDLRRPSLHAVFDLRNINGLVNAITGERGLSEVLSEPLPNLRVCTSGPVPPNPAELLSSNRFAALVEEAR
QGFDYVLIDSPPVEPVADPLILATHADGVLLVLDAQRTRKGALRKALHDLRGVKANVLGTVMNNFDGKRGGYAYHGYTR
© 1998-2019