BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Alignment] [Repertoires]

184 sequence(s)

>gnl|bykdb|A0A022KX11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium muris UCD-AY4] (length=334 residues).
MAGEFSTLLKSSGQKVVSTPIQPASAPAQPVSPNPTRNLALGLLAGLVLGLGLAFIRHALDTKVRGEEDIRAHSDAPMLA
GLPLESRGSKRGLISVEEDPHGRHAEAVRRLRTNLMFVDVTTGRHSFVITSAVPGEGKTTTAVNLALAMADSGRRTLLVD
ADLRNPSVAKTLGMEGSVGLTTLLLGDADLDDVIQTWGSAGMDVLPAGPIPPNPSELLGSAPMEALLTRLMQEYDFVLID
SPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVASKGSDYRYGYHRYEEEMTRRARK
AARTEPRAKQRARG
>gnl|bykdb|A0A023X491 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rubrobacter radiotolerans] (length=242 residues).
MARSKPLKKHKKTENLTDRLVSLSDPGGQAAEAYRTLRTSLLYSVVDEPPHVVAVTSPGQQEGKSTTCANLAVTLAQAEK
SVLLLDCDLRKPVVHSIFELRNTRGVVDALVGSENVEELWQTPLDNLSVLTSGPVPPNPAELLGSERFGALLGDLARRFE
YVLIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNARPARNGTYGGYTYSYGEAA
GS
>gnl|bykdb|A0A0A0IYK2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia flava TL1] (length=569 residues).
MTLQDYIKVFRHRWMVILVCALVAGAVTWFVTPASADTTKKVGSYAATATILVGSTDPENPNPNMGRIPLYMTTGEIPRR
AAAAVGYDGDPALLARGLTVTPDVVAAAITVSATASDGSRAAAVANAFATETVKFFRERSRPGAENVAVSILQAASPVPV
ANSDGGFVVPPGRGPRTAIATVLGLLAGLALALLLDRLDSRLRTRQEIHGALRMPIIAEIPRLRRSERHQGAIAVAEDPL
SNYSDGYRAARTALVHTTGQIMPGDYTPRRSAAGARPAAKGARLILVTSAHAAEGKTTSVANLAASFAETGQRVLVLDAD
LRSPDAHNVFDVPQGAGISDFLSDPSDDASLGSVVRPTSVPGVRIITAGTSLAHPASLASRLGSLLEEVRGMADVVLIDT
APLLEASDVFDILPMVDTLLLVVRSGRLTELAGNRVAELVGRFQVPVSGVILLGAPEKRADAYGYGYGENRQSKRKAKRA
RKRAQSRSARSAAEQETTFVDSRTPGASPVHSAESRDTSRNPEDAPDDLQLDVTPGGEVPTATDEAHAATRGEVGEERRR
SRRRSSSSA
>gnl|bykdb|A0A0A0JGH0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia sinensis KCTC 19936] (length=531 residues).
MTLQDYIRIIRQRWIVIVICAAVAGLVTWFLTPANASSVKDAPSYTATATVLVSAATADEQVSVDRVVLYAKTGAIPTAA
AKALEFEGDPAILASQVTITSDPSGAALTIAASDRDGAKAAETANAFAKQTVAFFAKPRPGVGRAVVTILQEATPIPDEI
GGGFVVPPSRPLRAALAALVGLLLGFALALVLQRVDSRLRTRDEVHAGLRLPIIAEVPRLKRSQKGERTITVAVDPLSPY
SDAYRAARTALMHTVSRQAPGEYMGRRAARPEPRPVVEGARLILVTSGNAAEGKTTTVANLAASFAETGQRVLVLDADLR
SPNTHTLFDVPQGAGISDYISDNEDTPLEALIRPTNVPAVRIITAGTRLTHPASLASRMGHLLAEVRELADVVIIDSAPL
LAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGARGRRADGYGHSYGYGDTARPQRDSPSPK
MELDPRQQPSAPSVAVPQHASAPEVDRWSLPPRVDDPQDAAPSRRSRHSSH
>gnl|bykdb|A0A0A0JTY0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia subterranea KCTC 19937] (length=526 residues).
MTLQDYFKVFRHRWIIIVICALVAGAITWFITPASSDTTKKVGSYTATATMLVTAKASSAATAVAPNLDRVALYLKTGEV
PKRAAKKVGYEGDPAVLASGLTVVTDPAAQAITVAATASDGKQAAAVANAFANETINYIKEKPRAGVENARLEVLQTATP
IPTAGSDGGFVIPPGRGPRTAIATLLGVLVGLGLALLLDRLDSRLRTRSEIHNALQMPIIAEVPRLKRAQRSRASIAVAT
DPLSIYSDGYRAARTALVHTTGQVMPGDYTPRRAASEVPEKQAATGARLIVVTSAHAAEGKTTSVANLAASFAETGQRVL
VLDADLRSPDVHNVFDVPQGAGISDYLSDVSGDASLASLMRPTSVPGVRIMSAGSSLAHPAALASRMSHLLDEARGMADV
VLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAPTKRADAYGYGYGDDRMSKR
KAKRARKGARSRQSGPVGPPTGHMGDFFDDAEQPESRRSRRTSSSA
>gnl|bykdb|A0A0A0JXF2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia aerolata DSM 18566] (length=547 residues).
MTLQDYIKVFRHRWIVIVLCAVIAAGVTWLVTPASADTTKKVGSYTATATILVGSTDPERTGNMGRIPLYMTTGEIPRRA
AAVVGYEGDPARLAAGLTVTPDNAAEALTVSATASDGEEAAAVANAFATETVKFFKETSPPGAENTTLTILQPATPIPST
ANDGGFVVPPGRGPRTAIATLLGLLVGMGLALLLDRLDSRLRSRSEIGDALSMPIIAEVPRLKRSQRNRNSIAVVEDPLN
LYSDAYRAARTALSHTAGQVMPSDYTPRRSTVEPRRSASSARLVLITSAHAAEGKTTSVANLAASFAETGQKVLVVDADL
RSPDVHNVFDVPQGAGISDYLSDPGGTSLETVVRPTSVPGVRIITAGTVLTHPASLASRMGGLLEEAREMADVVLIDTAP
LLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAKARRGDAYGYGYGETRKAKKKVKRERK
LAEKRGPVAPATPSTSSRPTTGPAEETRSRDAVGTADPTTTVDPVLGVDDDDVEPDSRRTRRRASSL
>gnl|bykdb|A0A0F0KYJ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=231 residues).
MRELRTNLVYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMIGTVFGLPKGAGISDVLAGC
ATIAEVAQRFGNGQLLVVAAGKVPPNPSEVLGSARMRELLKSIAREAIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGK
TTYEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYGYQYHGDYYRNDGQELPTGTVRGDNANIYAKSK
>gnl|bykdb|A0A0F0LP73 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=555 residues).
MTVLDFLVLIRRGWFFLALGLLFGALGGFVTAQLTPPVYTAQATGFIAGTGGAVIAGTNIAIDRAGAYMPLVDTAQVREE
IAKDAKVPLSKLNGSLSAQVVPGSTMVRVTANAPDPQSALRLANGALHALANVVARIEDAAGAGATPPPGSTVVPTEGIV
IVPLDQAVAPRTPSAPDKRAMIIAGALIGLGVGLLLVLLRRALDVRVRAHTDVAAIVGAGVLGRVPKFDPDGRSKKDAIA
RAVAHEAHRQIRTGLRFASVDQEVRVVMVTSANLGEGKSSTTRTLARVLAESGQRTLVIDGDLRRPTVAEGFDLDGTVGL
SEVLSGQMPIGPAIRQTSDPNLFVLPAGGIPPNPSEMLGSTAFQRLLGELRRDFFIVIDAPPVLPVTDASVMSAFVDGVV
FVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVAMRNSANGYGYYRKNSHYYAQTSRNDDAAGDDEVAALISEAELSP
AAFDGEPPAPEESGAEDEGASRERRASRSRTVSDDAASSRATHARPRIAQTGQRSTPVRARRAKDANDLDPDATA
>gnl|bykdb|A0A0G3V3F3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium IMCC26256] (length=475 residues).
MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNRAERVYEATALLAVTPSDTGLGINADQATFLAKSYALYAETPRVTAA
AAKSSGLDITANDAASLISASAVGDLGFLEVYAKGPSVSEAEQLSSAATVALIDAVRAQQTASLAQDIAPIQAQRVILQK
QLSNLPAFDPQAASIQANIDALNKVEAERRAQPANRVNVAASAHASSTPISPHPTRSAVVAFLLTCILVGELIVASRAIG
DRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFISINLAQSASA
LDDKVVLIDADLRRPTIHEQLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|A0A0G3V3M7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium IMCC26256] (length=635 residues).
MRPADYLRIVRRRWWVLLVTVVIAMTFALLTRPSSAATAKASRPGVSFRATTTLISSGSANTSVNGRDYDRLALLMITGE
VPKRVAEAIDEVRWPQIQNANANKCTETGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVGD
AELAAKVANLFAAKLVGYVDELGQKQYDEQIFGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRREAVLRKLANAD
SDLSNLQEIGPQTSGLTTLEAATKGRATIIVSRAQGSTSESQRLLFGAAIGFIVGLGILLLLEILSARIRDVPGTEGAAR
MPVIAEIPVMNLDRSLRFQVTTAVDPTSLMAEAYRSFRTSLVAMWQRHPTNNRPVLAGASEPEATPLRVLLVTSPGPAEG
KSISVVNIAAAFAETGISVLLIDGDFRRPQMYKYFSGATTPNLTDIPHQGTAADVLAVAQETGIPNIRFIASAPTRTDPG
TAIEMVKVAARLGRDIADLVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAE
HGARAGYYGYYGYYGYGYGYAHPGEVPKMSRLFPWRKPTNGAGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF
>gnl|bykdb|A0A0J6YE86 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium chlorophenolicum] (length=408 residues).
MSADELQARITATAKPDTVLIDVAVLDESAVRARDIANTLSDEFVGRVRELETPENSTRADSRVVVEQRASIPSSPVVPK
RARNIAVGLVLGLVLGVGFALIRDLLDNTVKDRTTLEQIANVGLVGTVPLDKERRRHAAIAFENDNSVIAEAFRKLRTNL
QFLSVDNPPRVIVITSSMPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPTLSKYLDLMSKVGFSTVLSGAVSIDDSLQ
KTRFPGLSVLTSGAVPPNPSELLGSQSARKVLAELRSRFDYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLA
HAVGSLESVGAPLLGAVFTMVPTRGTGSYSYNYGYYGEDEGRRGGNSSTRGGSAESSKTTSANASESRDRSAGDLPARPV
TQRRYKTT
>gnl|bykdb|A0A0K2RXS2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYSKDGDK
KSSKKSSTKK
>gnl|bykdb|A0A0K8Q3D9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Hiyo6] (length=233 residues).
MVTSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLTDVFNLVPGAGVTDVLSGTADLDDVLQPWGALPNLSVLG
SGRIPPNPSELLGSRAMKNMLQALAQNATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGR
VLGAVLNYVPTKGTDAYAYHGTYTSAVAPSVLGEDADLLQRDSDASGSWVGENYEVDHAMIEEYVPPRRRVKS
>gnl|bykdb|A0A0Q5AWK6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. Leaf294] (length=493 residues).
MTVVDFIAFIRRNWKALVVAVLVGVTAMAAFSFVTPKVYESSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA
VYERIQSDPEANPGGEALNGRLTASVAPGSTLIQVTAEASTPENAAALANGALAALAAVIADIETQSTADRTPQITVVPL
ENAEPASTPTSPNWLRNLLLGAAGGLVLGFVVAFLRRALDIRVRTVDQLTELFGVGVLGRIPKAGRRAGRKGETVDRITA
EAYRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKMLGIDGAVGLSEVLS
HQIPVEDAIRPTGTEGLFALPSGHIPPNPSEMLGSAAMRTLVERLSKDYFVIIDAPPILPVTDASIVATVVDGVVFVVAS
NRTRRPEVTAARRILAQVRGRVLGTVLNMVTAQDGDTGYYYYDRKNSYYTQPQQAATENAAVGRSARRSPRTQALEPVES
RAERPTASRRTLR
>gnl|bykdb|A0A0Q5JKD6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf151] (length=544 residues).
MVRVVRAYWKAIVALIVVGGLAGLGWSSLQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVAET
ARGELGLSDSPESLVQRVRVSNPIETVNVRVDATGPTPESARDLAEAWIRGMTEEVDQLETGGGGQSAVRLVAGDSARLP
TAPSSPNVRLDVTLGALAGGVAGLIFAFVRRAFDRRVRSAHDITDAVDASVVGVLPVDKELAGGRAVFSFDDIKDGRGSF
AHKEAMRELRTNLQYVDVDRPARVLVVTSPLPGDGKSTIAANLAVSIAATGQSVVLIDADMRRPVVGGMFGFSDDVGLSD
VLAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQSLARKLADDMVVIIDSPPTLAVADAAVIASWADGAVL
VVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMPLRGADSGYYGSQYGGYYGYGVPSSSPNGRWRLGLRRRGKKAEVVD
AEQEATPRRRSGGLPPENVSGLRTLSQRRMSATAEGEATSEIAVASTAEPDTVDTMSRRRARRG
>gnl|bykdb|A0A0Q5L115 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf164] (length=586 residues).
MDRPDTEPRPRTLDLQDYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQTRVYESSASGVVQVAAGGDANLAFAADQLAKSQ
AQSYVELGGSLAVAESAAAALGGAASPASLLGRVTTSLPEDTAIITVTSRGSTPADAAALTDAWLAAMGEQIAAMQEEST
DTGGSATSFVALSSASVPTSPASPNVEVALLLGGLSGLMLAGVYLLVRNTLDRRIRSAAEVESRFGVGVIGTIPQNDALA
EHGGLVAALPNATADDRHVNFAMSEALRELRTNLAYVKVDAQPRVIVMTSPQPGDGKSTLAANLAESLAVSSDQRVVVID
CDLRRPTLSKVLGVSEGAGLTDVLSGRAQLHQVMQQTEAASNLWVVGAGRIPPNPSELLGSQTFQDLVSTLAEHATVILD
APPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPTKGRDAREYGYFGGSYYYYEGDV
GTGGAVGAGAGSGTAPASREAVTAPAPVVAPTPPAAPTPAPVPAPAGAAAAAAAAAAPGGEPAPARVPASPASPAAPTSP
AVPASPVEAPGGALTRREIRERERTR
>gnl|bykdb|A0A0Q5M6Z7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. Leaf336] (length=495 residues).
MRDFVQLLRRYWVGELAIVMLTVGLVAALTAVQPRVYESTASGLTQAATGESLSMAFAGESLAKSRAESYVRVANSDAVA
DRARKILGTDRSIGDLLGHIQASLPADTAVIEITARASTPDGAAKLANAWIAGLTKQVRALEAPEGAIAEPAISFVALAS
ARPPYFPSSPNVQTALVLAILAGIALAVVYGLLRQHFDRRIRSVEQIERLLGAPVIGTIPASPALEDRRRVTDSDSGDDA
VELFTISESLRELRTNLSYIDVDQPPKVIVVTSSIPGEGKSTLTANLADAIASANSNVVVIDCDLRRPMQSTLFSLRSGV
GLTDVLSGRVDLNDALQAPSDSPHLRVLGAGRVPPNPSELLGSRTMRELVSALADVAIVILDAPPLLSVTDAAIMGTIAD
GVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIPPRGIDSHDYGYYRSNYYTSNADESGEAQPVASIEAGGDTSV
DGQANEQRSRRASRS
>gnl|bykdb|A0A0Q5Q5L3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf179] (length=540 residues).
MRILRAYWKAIVVMTVLGGLAGLGWSATQARVYSADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVADTA
RQQLGLSDSPEALVERIRVSNPVDTVNVRVDATGATPESARDLAEAWIRAMTTQVDELESGGSGQGAVRLVAGDSARLPT
SPSSPNVRLDVMIGALLGLVAGVVFALVRRTFDRRLRSASDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFA
HKEAMRELRTNLQYVDVDRPARIMVVTSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDV
LAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVADAAVIASWADGTVLV
VTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQYGGYYGYGIGRTEKSTWWRRVLRKSSTEPGAAEE
HGKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPRRRRTTP
>gnl|bykdb|A0A0Q6DVM4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf436] (length=540 residues).
MRILRAYWKAIVVMTVLGGLAGLGWSATQARVYSADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVADTA
RQQLGLSDSPEALVERIRVSNPVDTVNVRVDATGATPESARDLAEAWIRAMTTQVDELESGGSGQGAVRLVAGDSARLPT
SPSSPNVRLDVMIGALLGLVAGVVFALVRRTFDRRLRSASDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFA
HKEAMRELRTNLQYVDVDRPARIMVVTSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDV
LAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVADAAVIASWADGTVLV
VTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQYGGYYGYGIGRTEKSTWWRRVLRKSSTEPGAAEE
HGKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPRRRRTTP
>gnl|bykdb|A0A0Q6VV12 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root122] (length=485 residues).
MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVLYSATSSGLVVVGNATTAGEEQGNAALAEEKAGLYAFLVSSMP
VAEKVVDDLGLDVPPSEIAGRFSATVNADVNALTITAIGSTPEQARDLANGVVDAVVEYAQEVDTGESNPRRDPLTRVVP
VQPAELPQAPFTPDYAKAAMKGAAGGLALAYAFLIARRLIDRRIRSVKHVEDATGAAVLGIIPKEDALGRTHRGVRGDLG
RAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQ
ALAGDVDVRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYSGYGGYGGYRAEEATREAYSTAGKGRRRKLVRS
SSDKA
>gnl|bykdb|A0A0Q7KBQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root472D3] (length=472 residues).
MRSRWVFSVSTFVVGAVATILLVLSMSPVYGSSAKLFITSPVGQQVTDPTAAYFASQRLASYADLAREPSLLQDVINRLN
LTGVTREELAGQVTAQIIATTQTLQVDVTADSAELAQQIAEAEAEGIVSLVARLEKPTSGNGSPAFVARIVGPPSISQTP
VAPNVPLNIAVGLLLSLFVAIAGAVLRDLLDRTVKTRQEAEELSGGAVLATLPFDRQLKKQALTSEGHGALAEAFRVLRT
NLQFANLDAKVESILVSSAVPNEGKTLVATNLAMSMAQSGRSVLLIDADMRNPNVADLLGLENSVGLMTVLIGRTSLDEA
TQVHDSGISFLGTGPKPPNPAEVLDTQAMRDLLHGLRSEYDVVVIDAPPMLPVADASILMREVDGALMLVRHGSTTREQL
RLAVARIETVGGKLFGTILNRTPRRAGDVYGYGYGYGYGQEQHEPIGEQARRMVGALGRGESRSSSGRRVSR
>gnl|bykdb|A0A0Q7QDF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root495] (length=452 residues).
MTSRSGWTAVARRWPLVVLLGALGLGAAALVLSGQTTRYDGSAEVLIQPTSPATSLSGRAVESYAHVLGGTALEQRAVKA
LGLEDAGDAEVRGEVVGNSSVVRVVVRTTDPERAAQLAGQVAEELVSWIASYQDRAAERAGEDAPDLPTLSPIVIQEGTA
SSQPVEPDARRTYVLFGLAGLLLGLLLAALRNLATATVTSSDALTEQVKAPVIGAVAQDRHVADHPLISTLSNQHPRAEA
MRIIRTNLQFLDVDRVSNVYVVTSSVAGEGKTTTASNLAISLAQSGQNVVLVDGDLRRPRLHEVFGAEQNVGLTSVLVGK
VPLDSAVQGTDVPGLDVLTSGTRPPNPSEIIQTAAMETVLIELGRRYDIVLVDAPPLLPVADAALLSVISDGAILVVRHG
RTGHDQVRAASERITTVGGRLLGTIISMSPKKETARYGYGYGYDDGKGRRRR
>gnl|bykdb|A0A0Q9L0H3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia sp. Soil729] (length=519 residues).
MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYTATATLLVGSNDPETGSTNLGRIALYMTSGEVPKR
AAARVDFTGDPALLASGLTVTPDTVAQALTVSATASDGKQAAAVANAFATETVKFIEERKRPGAETTTLSLLQPATPIPS
AATDGGFVIPPGRGPRTAIATLLGLLVGLGLALLLDRLDSRLRTRGEIASALRMPIIAEIPRLKRSQRNSASIAVASDPL
SNYSDGYRAARTALVHTSGQIMPGDYTPRRPGGEESRSRQGGRLVLITSAHAAEGKTTSVANLAASFAETGQTVLVLDAD
LRSPDIHTAFDVPQGAGISDYLSDPSDGAALDAVVRPTSVPNVRIITAGTSLAHPAALASRMGQMLEQARDLADVILIDS
APLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQTMRADAYGYGYGENRQSKKKARRG
RKRQQLRAAEPVADELHPPTTGDERPRESRHDRRTSSSL
>gnl|bykdb|A0A0Q9LZR0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Phycicoccus sp. Soil748] (length=477 residues).
MELTDYLRVARTYWRGLVAFMLLGVAVAGGLSLVTPKVYQADASGFVSAGASSNPGEASVGDSLAKSRATSYVDLAKSRA
TAQDVINTLGLGAQPAGLIGSITVTQPVDTVLLKISARAATPRGAQQLADAWVAALARQVQAVENPTGKAAQALRVVPIE
SAALPASPVSPNTRRNLALGFVLGLMLGLGYALLRSQLDRRVREPEVVERDFGVTVAGAIPETSALVRKKGGLVPLVVAG
TSKEKDPVHSAESFLKLRTNLQFMDIDNPPRIIVITSPLPGDGKSTVAMNLAAALSMSDRRVVLIDGDLRRPVVAESFGL
IEGLGLTDVLIGSVEFEEVVQQVGGLPNLSVLAAGRVPPNPSEMLGSKAMRRLLEGLGETYTVIVDAPPLLPVTDAAVLT
ASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVSPKSSSAGYYSGNYGPLQETPQRAVRSEAGTAATR
>gnl|bykdb|A0A0Q9QB08 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Soil774] (length=502 residues).
MTFGDFVRLSRAYVWVLIGCTVLGAALMVAKTTQDPVLYSATANGLVKVGEAGSAAEEQGNASLAEDKANLYAFLVPTTP
VAEQVVKELGLDMPPSAIASRFSATVNSDVNAITISAVGTTPEEARDLANAVVDAVVVVAQQYETGEENPRGPSLTRIIP
VTPAELPGAPFTPDYRAAAIKGALGGLALAYAFLIARRLIDRRVRSAKHVEDATGAAVLGVIPKEDALGRVNRGVRGDLG
RAAEAFRVLRTNLRFVDVDNEPRRIVVTSALAGEGKSTVSSNVARLVAQAGTPVLLIDADLRRPMIATTFEIDGAVGLTQ
ALAGDVDVRDVIVESGVANLSLLPAGRIPPNPSELLGSLRMKQFIDDLSADHLVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGAASIAYGGGYGTYGGYGGYEADDTSREADATAGGGRRRKHPKK
AAKNAAKKDAEAEAQTEADAGV
>gnl|bykdb|A0A0Q9TBP0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Soil805] (length=565 residues).
MALLVLLAAVAVSCAYSLAATPLYIATADVLIEPSGADISASSGTKIDADEVATQVQVVTSLPVSRLVQERFSLASPPDL
SELVSVQAVGTSRILRVTAQDSSPDRAARTANIVATSYLQFREQDSVGRYEQARDRLAQEQADIESRLSEVNALLEKNPG
GQALQGERRTLIASSAQVAAQIDALTDSLTTAAAGGELLHSAEPADNPVSPQIVLNLILGALVGLVLGVGAALLRDRLDD
VVHDEEAVRQALDAVVLARVPQWSERSHRDRLVTLVDPHSPASEEYQRLGVNVRFMVATGAQESAPIVLLTSGQESEGKT
VTSCNLAVSAARLGLNVVLIDADFRRASVAPRFGLGDPPGLSDLLVSEEDPSSYLIDIGVDNLTLLPAGTLPPNPAALLA
SGQMHLVLEELAAKADMIVVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVGDS
ARATYSYTSRERAVTGTDAAPDSAPTRAGKDQAGDPVPSAGTPPPSGDTHHGSAPTGHRDTPPVAPAGHGDSRKTAVAEP
GDDVA
>gnl|bykdb|A0A0W8I9Y2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria polaris] (length=366 residues).
MGLLYAFARFKMDRRIKSVEEIRDGFGVAVLGVIPTDDRLADHREIVETGFSAGRGHHEFSEALRELRTNLSFVSVDSPP
KMIVVTSALPGEGKSSITANLAVAIASTGRNVVVVDGDLRRPVITDLFGLVPGVGVTDVLTGQVQVDEVLQTYDKFPNLQ
VLGAGRTAPNPTELLSSKAMHAMLETLAEDALVLVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQV
HGNVLGVVLNRVPTTGADAGYYGYYGKSYYANSDDQPAPKTGAQPVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPT
VPSAEDAAPAPRAERSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH
>gnl|bykdb|A0A101KZQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. EpRS66] (length=410 residues).
MAKSRSVALDVQENLGIDTSINQLLSSISIANPVDTATLKVSAESNTPESAQQLAEAWVKAIENQVSEVENSSATKSSSA
SIVTFRSFDAAELPTSPSSPNFKIAIAVGLLVGLFMAFAYAMLRHAFDRRISSIESVESSTGHSVIGTIPQTDTLDREQR
LITSIGGNDRNEEHAGEYAVAESIRELRTNLQFMNIDNPPRTIVITSALPGEGKSTVAANLAITIAASDQKVVLIDGDLR
RPTIAKTFGLLEGVGLTDVLIGNADIDDVMQPWGESGNLVVLGAGKIPPNPSELLGSNTFQNLIQSLAQEAIVLIDAPPL
LPVTDAAILTARTDGALVVSRVRKTTYDELESALNNLQRVNAHALGLILNGVPLKGAQASNYGYAYKAYYRQDTKGRRSA
VANPVANDEA
>gnl|bykdb|A0A151BT98 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius sp. NY16-3462-2] (length=457 residues).
MTIRDFLRIMRQRWRWLLGTLLVVLAVAAVSTLMQPKTYEASARFYLAGSNGQGTPVQRDDLATYAQVVSAPAVQKVIRQ
QAKLGPSVPVTVSATLSDTANIMTATASSGSAQEAAAIANATGPALAAVAPQFSQLLSGAGSVTSTAVQPAEVPASPASP
DLKKALELALAVGLLLGVAMALLRHFMDNRVRTVEDLETLVQRPVLSIVPRVGGGHRVVDTSDHPSGAMVEAMRRLRTNV
KFVNVTNDVPAVVVTSARPGDGKTTVAANLALAMARDGYRTVLVDGDLRKPGVGSAIGIDGSVGLTNVLVHEVGLKDVLV
EPEPSLPLFVLPAGPVPPNASELLGSSAMQGLFQELVAEFDFVVFDSPPMLPVVDALELEKLTGNLILVARGGQVSRREL
QITLKALETVDANLSGTVLNYADHFSDDYGYGSKYGYGEQEMAASGRTRSRRSDKRG
>gnl|bykdb|A0A1C2B334 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardia farcinica] (length=262 residues).
MGVVDSPVIGLVPGDSALDGEGFVDFGAGGSVIAESYRRIRTNLAFAAVDPASRRILVTSASVAEGKTTTAINVAASLAE
YGHRVVLVDADLRRPTVAKRLSLNNSIGLTDFLIGQGDLPDLLQQGGLDRLDVLATGQLPPNPAELLGSSRARELFDTLA
ASYDYVIVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDASDRAGAYHNTYYGDT
DTPRMASQRSRSHDIAQVGLRR
>gnl|bykdb|A0A1C6T1J1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora nigra] (length=486 residues).
MDLYRQLRLVRRHWWIVLVTLMVALGTTALVTIRSEPRYVASVTFFVTTPSEGVAAAYQGGLFLQQRIKSYADLLVSDRL
AQSVVAEGQVGLTAEQIQGRVSTSTETGTVLLRASVTDTDQTRALKLTELLSAKFVDLVQKVETPPSGEPGPIKIEIVSG
PRVSASPVSPQPLRNFTIGGLLGLVAGVALAVLRGMADVRLRDAAGLQRVTGSPLLGEIPLDTAARTAPLIVGEAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLGLRESADIVIIDTAPLLAVTDGVVVAVQSDGALLVS
QQGRTSRTQVAAAARALHAVSVRLLGCVLNMAKVPKADAYQYEAYRVVAGLGTPSVPADRATSGRHAEHAAAGVSDRTQE
LTRLPR
>gnl|bykdb|A0A1E2SNF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia xyli subsp. xyli] (length=250 residues).
MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLREVLQDPDVSLHTHIRVLTAGR
TPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTG
VVLNRVPRRGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPA
NRGRRAARHG
>gnl|bykdb|A0A1E4BP96 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. SCN 70-18] (length=429 residues).
MYTASASGYVSGASLAAETGSPLVGDQLARSKVTSYLDIGSWRAVAEHAIEDLGLSASPESLVGNVTVSNPLDTVVIHVA
ATAATPESARDLAEAWIRGMTAAIDDIEGTGVAGSAPVTLIPGDSARLPTAPSSPNTTLNLALGGLVGLALGIAYAVMRS
VLDSRIREPQDVERNTGASVVGVLPLDHDLDNRREVLSFTGASGNVVRGALTEAIRELRTNLQFMDVDDPPRSIVVTSPL
PGDGKSTTAANLAMSLAAAGQRVVLIDGDLRQPVVASLFDLPEGAGLTDILAGRATTGDVVQPVQGSQNLYILASGRVPP
NPSEVLGSRRMRDLVTSLTEHALVIVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVL
NKATRRGRPDYGYAYGSGAADTRPAFVPR
>gnl|bykdb|A0A1E8S156 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC065B04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1E8S5S2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069C10] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1E8TRD6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC065C12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTSNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYSKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9DXX2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069C03] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVNAKASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDNAV
VSPTGGNTVRVIPLNNASVNPPLVAPNYKQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPISDD
LNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9G8X4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC062H08] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9IAW2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC075F09] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9M791 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069D01] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSED
LNEENIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTD
ASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9ZBC9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC071B01] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9ZDP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC078H08] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F0DAA9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC061C12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRSSLTATAGDNAALITVNAKASSPKNAQVLANSALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVKGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0KX60 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC066H02] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENAA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLALARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0PHK9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC076D04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRSSLTATAGDNAALITVNAKASSPKNAQVLANSALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVKGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0R6B5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC066G07] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F0THV9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC036D11] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A1F0VZG6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC071C12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRSSLTATAGDNAALITVNAKASSPKNAQVLANSALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVKGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0XT88 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC072B04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTSNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYSKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F0Z7N5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC068E02] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1D897 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC066G02] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1EVP5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC073B08] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTSNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYSKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1FV74 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069C04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPDLSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSED
LNEENIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTD
ASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1IHY9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HMSC067E09] (length=482 residues).
MSLSKAMSMLQRHWMILVAAPLIGVLLAGLWVLTQNPRYASTANALVVVGNSESLGVALTADNLAKSKAQQYALLGESRA
VSDKAVEELPFDLSSGEALRNVEVASTSGSAQIVVRAEDSSPERAQQLASAWLGALEAQATEVEAGGIAGQSIISLETLS
DASLPSAPSSPNLPLALSIGGALGLLAGLGVAVVRHVLDNKIRSAAALESRFGLTILGTVPESTRSARNRRRRDGGDVIN
LAGRVDGETSPKQHQDSFRLTESFKELRTNLQFLRPDEAVSIVTVTSAHPGEGKSTVAANLAVPVAESGQRVVLVDGDLR
RPVVAENFGLISTVGLTDVVLGRVELADALQTVGNRPSLQVLASGPIPPNPSEILASDRFNDLINALAEDALVIIDAPPL
LPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPASGTAASAYQYYGATYYTASQQQDVAG
RS
>gnl|bykdb|A0A1F1J417 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC067H10] (length=502 residues).
MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A1F1QKB0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC08A08] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSNLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNNTATPAPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVRASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A1F1X071 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. HMSC06H03] (length=536 residues).
MTIEDFLRLLLRNLLLLVAGLVLGAATGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMEFQYSKAQSYLPL
FNTRAVGQRIVDELGLEASPDEVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEATAAEARELETGGNENAAVGV
QLTNYQNAVVPGAPVSPDREKFLLAGAAFGLLVALGLAWLRDRNDSRLRTADDVTDVVGLPTLGALPDAKELARGKDGVL
PEPTSFPSREALRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYGALGGYDESAVVPDAE
EVDVEQAGGPAEPGPASAPAEPGPVVEPDGHEPEGDSAAAARTSPRGRRAASTWGR
>gnl|bykdb|A0A1G6GTN3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium enclense] (length=546 residues).
MQRVVRILRAYWKAIVALIATGALAGLGWSSLQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSV
AETARQDLGLSDPAESLVQRIRVSNPVDTVNVRVEATGPTPESARDLAEAWIRGMTVEVDQLETGAGGRSAVRLVAGDSA
RLPTAPSSPNVRLDVTLGALAGGVAGIIFALVRRAFDRRVRSTHDITDAVDASVVGVLPVDKELASGRAVFSFDDIKDGR
GSFAHKEAMRELRTNLQYVDVDRPARIVVVTSPLSGDGKSTTAANLAVSIAATGQSVVLIDADLRRPVLGGMFGFSDDVG
LSDVLAGRAQIEQVARQVDQNGRLFVVAAGRTPPNPSEMVGSQRMQALARKLADDMVVIVDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLTRATENIAKTRGHLLGVVLNRMPVRGVDSGYYGAQYGGYYGYGAERSSTKAWWRFRRRGQTTPVA
AAEDREAGSRTQPADPPPENVSGLRTLAPVTTPAVPGGEVTDEITVPATSGETAAGTLPRRRTRRG
>gnl|bykdb|A0A1H4I042 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. 283mftsu] (length=407 residues).
MDTYQGNLLSQERVRSYTILLTGEALAQRTIDALHLDMSARALRQEVSARSKMGTVLIDVDVLDPSPVRARDIANTLSDQ
FVKMVRELETPGDGSLPDTRVVVEQPAAIASSPAVPNLMRNLALGLFAGILFGVACALGREMIDNTVKKHEDLESITGVA
VVGDIPMDKARRGTPAISFGTENSQIAESFRKLRTNLSFLSVDNPPRVIVVTSSIPNEGKSTTAVNIALALVEVENNVLL
VDGDMRRSIAHKHLNVDGAVGLSTVLSGAVSLSDALQETQFSGLTVLAAGATPPNPSELLASHAAKNLLEELRGKFDYVI
VDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTPPRSRSAYGGAYYYYGDNRGSN
SRHSRKT
>gnl|bykdb|A0A1H4LCS9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides exalbidus] (length=483 residues).
MTFGDFVRLSRAYVWLLIGCTILGALLMVAKTTQDPVLYAANASGFVKVGNATTAGEEQNNAQLAEDKANLYAFLVSKLP
VAQLVVDDLGLDVPPEAIAGNFSASVDTTVNALTVTATASTPQDAQDLANAVIKAVVVYAAQVDNGGTTPKGDSLATIVP
LEEAQLPGAPFTPNYQKAAMYGAAGGLGLCYAFLVGRRLIDRRIRSAKHVEEATGASVLGIIPKEDALGRGHRGVRGDLG
RAAESFRQLRTNLRFVDVDNEPRRIVVTSALAGEGKSTVSSNIGRLVAQAGTPVLLIDADLRRPQIASTFEIDGAVGLTQ
ALAGDVDIRDVIVDSGLTNLSVLPAGRIPPNPSELLGSLRMKQFIEDLSHDYFVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGKTQIEQSQHCRRILDQVGGRLLGVVLNKAPIKGAAAIAYGGGYGGYGGYGGYKSEYASREAYSTAGKGRRKLLKVG
KKD
>gnl|bykdb|A0A1H6WL79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. yr096] (length=573 residues).
MERTTQLLQDDKPQGMSGNDLLSVVRSHWLGILVITVLMTGGSLGWYALQPKVYAAESSGIVVAAGAENLGLSLAGDSLA
KSKAKGYQSVGESILVAESVIRTLGLKESAPDITRSISVSVPLDSVEIRITARSSDAQTAQNVADAWVAALASQVYELDK
GNASPGTEPVTKIVPLAKATLPSAPVSPLLTATIGIGLAGGLLVGLGYALARNHFDRRIRAASEIERLFGLAVVGTLPLD
KRLSEKSSVLESTSVVHRVPGGHAMAEALRELRTNLNFIDVDNPPRILLITSSLPSEGKSTVTSNLAATIAAAGRDVIVV
DADLRRPTVHQVFDVLPDVGVTDILSGRASIDDVLQEWGPNPRLRILTAGRIPPNPSELLGSRAMEHLLKDLAQRAIVLI
DAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALSNLTRVQGRVLGVILNCVATKGQGDLNYGYYGAYVSADESR
DTIPPRSGMNPTSQPGHAGVSVDGNGFEAHSPWQGPAKAAEITSQAMLSGLGHAIAGPSNSLTNSSDTPSFLAPESQWRS
PSDGRGRRSAPPS
>gnl|bykdb|A0A1H6YPK1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Lysinimicrobium mangrovi] (length=560 residues).
MEFRDYLDVLRSRWLSIAVCTLVVGAVAYLWSDMQPRVYSTSAEALVTPAGSLDEVGDAATVESRMAVYTRLATSDQVAA
VVAESIGGDADALRSRISVSGSTETAIMLFTGTGSAPESAQELVNAWMDATFLVVSDVERTSRGISNPERTVINVMVLQQ
ARLPSVPASPAIKQNTAVGLMLGLALGVAYAFVRATLDRRLRSRNDVEIQFGVPVVGTVPWDGAIAKKGPLGAVPGFAFT
EAMRQLRTNLQFMNVDHPPRVLVVTSPVPGDGKSTMAVMLAAAIAESGRDVVLVDADLRRPTLAKALGVSPEAGLTSVLA
SQASIEEVTQQVGDSGRFSVVTAGVIPPNPSELVGSDTMRSLLYSFPEDTMVIVDSPPLVPVSDAAVLAARTDGALVVAR
AGATSADMLEEALRILDRVQGRALGVILDGVAPVGPRVKHYGYGNTSPGLSSLGGAPAQHDEDDSWEHDEALRKVFPEDV
LHRADDVPVLAERDDELVFGQAPEGAEKGPGGHESIDETHSEERPPGEISFGHSVDAVEVAVSGRSAVRDTMHLRRLFRT
>gnl|bykdb|A0A1H7N9P7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Blastococcus sp. DSM 46786] (length=481 residues).
MSLSVFLGLIRRRSSWLVAGVVLAVAVAGVGSLTATRLYTAEARLFFTLEYGDSAGDLAQGSNYLQSQVASFALLAETPT
VLGPAGEAPDVAAGSRSLAAQVSASVVPETVVVQISATDPSPARAAAIANAVAAELELAVEGLSPAGEDGSPAVRATTVA
PAGVPGAPVSPRTSLNLAVGVLAGLLLGCGLALARDRLDTRVRDAAVVAQLTGLPVVGSIPTRPSGSTAHPAVDADPHGV
VAEAVRQFRTNLQFLGMQDEERAGARIVAVTSSRSGEGKSTVAVELAAALAETGTRVLLVDADLRRPTIADRLGLEAAAG
LTTALLGRASVADLVQEWGTAGLHVLPSGPVPPNPSGLLGSPVMRRLLERLRDDYDHVVLDTAPVLPVSDAAVLSRSVDG
LVVLADVTRVRRAQLSQSLHSLAQVQATVLGVVLNQVRREAEVYGYAADVVAGTDRPVPTAPAPLPAARSAEAADRPASR
R
>gnl|bykdb|A0A1I0W453 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides alpinus] (length=518 residues).
MVGGGAPPRLAGMTFGDFVRLSRAYVWVLIGCTILGAALMLAKTTRDPVLYSATSSGLVRVGNAATAGEEQGNAQLAEDK
ANLYAFLVSKTPVAAQVVEDLDLDVPPEAIAGRFSASVDADVNALTVTAIGTTPEEARDLANAVVDAVVVVAQEIETGEE
NPKEPALTRIIPLEEAQLPGAPFTPNYESAAMKGALGGLGLAYAFLIGRRLIDRRIRTTKHVEEATGASVLGIIPKEDSL
GRSHRGVRGDLGKAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSSNIARLVAQAGTPVLLIDADLRRPMIAT
TFEVDGAVGLTQALAGDVEIRDVIIDSGMPNLSLLPAGRIPPNPSELLGSLRMKQFIDDLAHDYLVILDAPPLLPVTDAG
LLSAFCDGALLVQAAGKTQIEQSQSCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYGGYGGYGGYRAEYTSREAYST
AGKGRRRKEAKAKAAKVDKVEKVDTAEKPSASEKAGTS
>gnl|bykdb|A0A1I6GVG4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cl127] (length=274 residues).
KPVVGTIPEEKSFTADNRLLPFDGGTSRSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLA
VTLASSGQPVVLIDGDLRRPMVDTVFGLPKGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMREL
LKSIAREAIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYG
YQYHGDYYRSDEQELPSGTVRGDSPRRRGESEAA
>gnl|bykdb|A0A1I6IST1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cl127] (length=283 residues).
KPVVGTIPEEKSFTADNRLLPFDGGTSRSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLA
VTLASSGQPVVLIDGDLRRPMVDTVFGLPKGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMREL
LKSIAREAIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYG
YQYHGDYYRSDEQELPSGTVRGDSLAPTRPRMPRRASKTRVGS
>gnl|bykdb|A0A1L2ZMQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Neomicrococcus aestuarii] (length=555 residues).
MPIDEDQRQGEGLRILMAVVRRFWPVLLIATLVGALCGFGWAALQPKMYQSTSSGLIVTPKSSTVGEAIAGNSLAQDRAG
SYAVMASSQRTAERAVEKLEKQGVADVPDAGSLISSITAAVLEGSTELRVTASASDPVFAQQLANVWIDALAEEAHDIES
TGVDGVDKDFQPAVELMPMTEGTLPTSPYAPNVNQAVLIGAVVGLVLGLIWAAIKHLLDRRVRSVEAIQKVGMSAVGTLP
SDPRLSRGRQVLPVVYSAETRTDRSYHAYSEALRELRTNLAYMDVDNPPRVIVVTSSVPGEGKSSLSANLAVTIAHTGQK
VIVVDGDLRRPVVSEMFSLPGDAGLTDVLAGQAELDDVLQDFEPVPNLQVLAAGRIPPNPSELLASKTMGKLLEDLSERA
FVIIDAPPLLPVTDGAVLAKASDGALIVVKAGKPTIDELAKATENLDRVGANKLGVILNQVPTRGAEASRYGYYGKYYSK
KETKAKAAADLQEPSVTDNPPTEQIQTPASVASRSRHNEGTRGTSSQSMTVTKPAPDNFDEIVFRGTRAKRSDES
>gnl|bykdb|A0A1L2ZMV4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Neomicrococcus aestuarii] (length=499 residues).
MEYTAENQPQALNHQVRRLAHVVLNNWKGAIAIFLLAVLASVGLFLISPKTYAATNTVMVVAGGGNNLGSYLSAETLANT
KAETYLALGNAPEVSQLVSKHFAEEGQAVSWKGVTFTKDPSNSQIRVTATAENPEHARASADAFASALAEEAERVERVMA
TGGTDSTSSVPVVQIIPISSALLPSAPSAPVLRTNLMYGAIAGLILAALFVFIKHLFDVRIRSTEQVETTTGHPVLGTVP
QDKRLDHHRQVITVGEPGDKQGWATSEALRELRTNLTFSRVDNPPRIIVVTSALAGEGKSSIAANLAVTIAQSGSKVILI
DADLRRSVQTDIFQLQSGAGLTDLLSGAVDLDDVLQEWSGDPRLQVLGAGRVPPNPSELLGSRAMKRLLTDLAQESVVIV
DSPPLLPVTDASVLSTSADGVLVVARAGSTSIEALKKATDRLDRVNGHVLGVVLNQVPRKGSSAGQYGYYSDSYYYTSTD
GQRTRRQSGKRRAASSSSK
>gnl|bykdb|A0A1M3LEY6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcales bacterium 73-13] (length=337 residues).
MPQEPISPNTRLYLSLGLLIGLIVGLAVAILIEVLDTRIRGEANVRQITDAPILGGIAFDKLAPKRPLIVQSEPNSPRAE
AFRSLRTNLQFLDVEGGPRSFVVTSSVPSEGKSTTSANLAIVMAQSGARVLLIDGDLRSPSVADLFGIEGGVGLTDVLIG
RARLSDVTQAWGLRNLSLLPAGAMPPNPSELLGSQAMVNLLRHVEKEYDVVLIDGPPLLPVTDSALLSKQVRGALLIVAA
GRTHRGQVHGSVEALQNVGAHVAGVVLTMLPTRGPDAYGYGRYGYGAYGYGYGYGRTAQAGFSQIISPAESPGRRQSSAV
PPSGPARTTAQARQESV
>gnl|bykdb|A0A1M6K628 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus bendigoensis DSM 12906] (length=521 residues).
MAIARRKPRTGRDILDLVQLWALARRNWLTLLLATILGVAVGAGISYLQPTLYSATSVGYVVVGNSSTENAGARNPAAEK
AATYLPLAESRSVAETVAQELGVQSGEVSLDAKNDGVIFEITAQAPTAEGARLMADAGIRATSVAANELETMTVTGEPTD
QLVVKIAPVEPALTPSRPTSPNWARNLALGLALGLLCGFGAVVLRRSLDRRVRQADEVEELTSATALGVVPTAVELASGV
SLVNDSGTAAEALRQLRTNLRFVSVDTPVRSIVVTSPSQGEGKSTIAMQLAALLAESGEPTVLIDADLRRPRVAQLFGID
GAVGLTQVVAGSLTVADALVSTSQPNLSVLPAGRIPPNPSEIVGSKRMADLIAHLSETHLVIIDAAPLLPVADAGLVSAV
SDGVLLVVQHGKTLREQIALATRNLDNVDAALLGFVMNQVPKKDLGAAAFGYGYSGASPRYYYAEDDGRRRPAAEVSGAR
QGRGRSQSTPRPRRVAADDQRVEVVDASADAVVMEPASTQL
>gnl|bykdb|A0A1M7V0F8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus obscurus] (length=472 residues).
MTLSAFLGVLRRRSSWLLVSVLVGLTVAGAGSAAATRLYTAEASLFFALEYGDSAGDLAQGSNYLQSQVSSFALLAGTPT
VLGPAGERAGVSADARSLAGRVTATVVPETVVVRIAATDPSPARAAAIADAVADQLERTVEQLSPAGEDGSRAVRATTVA
SADVPTAPVSPRTSLNLAVGVLAGLLAGCAAALVRDLLDNRVRDAGVVAELTGVPVVGAIPARSPRSAPGAVVETDSHSV
AAEAFRHLRTNLQFVGVQDEDQGGARVLAVTSSRPGEGKSTVAVNLAAALAETGARVLLVDADLRRPAIADRLGLEAAAG
LTTVLLGRATVADLVQDWGTEGLHVLASGPVPPNPSELLGSPAMRRLLERLRDEYDHVVLDTAPVLPVADAAILSRSVDG
LLVLANATRVRRPQLTETLRSLAQVGGTVLGVVLNQVRRDEDVYGYAAEAQPPARVGELPAVPVPAGRIGQL
>gnl|bykdb|A0A1M8I0C2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=234 residues).
MAFKKEKKAKVSDFKRKLIVKNDPKSPVSEQYRTIRTNIQFSTVDNEIRTLMVTSSGPGEGKSTTVANLATVFAQQGNKV
LLVDADMRKPTVHYTFSITNTFGLTTVLTKQSNLDGAVTQIDTSNLYVLPCGPIPPNPSELLSSRAMDEFLEAALNVYDL
VIFDTPPVLVVTDAQLLANKCDGTVLVVSSGFTEKENAIKAKEQLTTSKAKLLGVILNNKKQDQSQYYYYYGGK
>gnl|bykdb|A0A1N1YAY7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=233 residues).
MAKLELSEKRQALVKKAEEYYNALRTNIQLSGDKLKVIAVSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFMSTEKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSEKFEVMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKTQLEQTGVPFLGVILNKFNIHLEKYGTYGTYGGYGNYGAYGKK
>gnl|bykdb|A0A1N5CK61 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=473 residues).
MTVLDFVRMVRVNAKYLLIGMLVGALLGFGYSLLQPKVYASSATGYVTVGESTGIGDVISGSSAAKDKASSYLALVSSGP
VADEIVKQNPNIGMSAEEIKGHLTASLEGDSALMKVQATASSPEAAQTLANTSLSATAKVVNDLEGSTTVRVVPLDDATL
PGAPSSPNTKLNVLAGALAGLVLVFAAIFLRKAIDVKVRTRDDVAKATKTGVLGTLPETEQLSEKNLLTNQDDHTSQEAI
RQLRTNLRFVNVDNPPKSVLVTSSEPGEGKSTVSTSLARSLAESGQPTILIDADLRRPTIGKKFNIDAKIGLTQVLAGQV
ELAEAVRQYEDSQLFLLPAGRIPPNPSELLGSDKMRQLVKELSSEFMVIVDVPPLLPVTDASLLSSAVDGVILVVTVGKT
RKEHLEEAANMLNKVGAALIGVVINRTPLKGLGNSYYGFGYAGSYGGYSSYYGEDASKNSKKKRGSKRAKRNK
>gnl|bykdb|A0A1N6CE53 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=228 residues).
MVKKKITLSPLYVHEKPKSTISEKFRGIRSNIMFSNAENEIGSLLVTSEKTASGKSTISANIAVTYAQAGYKTLIIDGDM
RKPTQHYIFDLPNNSGLSNLIINKATYSDSIKESNVDNLAILTAGPTPPNPSELITSSKFETIFNELLDHYDFIVIDTPP
VNTVTDAQVYAQTVKNCVLVIDAEKNNKIEVKKAKDLLNKSDGKLLGAVLNKMPVDKNSSYYYYYGED
>gnl|bykdb|A0A1N7DLV3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. RURRCA19A] (length=549 residues).
MQRVARILRAYWKAIVALTLAGGLAGLGWSALQPRVYTADASGYVASVSSDGSTSSALAGGTLALSRVKSFIDMGYWKSV
AETARDELGLTDSPESLVQRIRVSNPVDTVNVRVDATGPTPEAARDLAQAWLQGMTVQVDQLESTGGGHGAVKLVAGDSA
RLPTAPSSPNEKLAIAVGALAGAVAGVLFALVRRAFDRRVRSAHDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRDGR
GSFAHKEAMRELRTNLQYVDVDRPPRVMVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVLGATFGFSDDVG
LSDVLAGRARIEQVAHQVDENGRLFVVAAGRTPPNPSEMVGSQRMQQLARTLADDMVVIIDSPPTLAVADAAVIANWADG
AVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPLRGADSNYYGSQYGGYYGYGAPSSGVDRPRWWRRPWRRATVE
KKDAGEQAPGPRRRSAELPPSNVRGLRTLAPGRKGSPVPGDSGGEGVVPVAAPAADVPDDRTSRRRQRG
>gnl|bykdb|A0A1N7E3F1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbispora rosea] (length=466 residues).
MELLRYARLMRRYWPLLLLSVLAGVGTAHVVTVNTAPRYLASITMLVSADAGDGGLSTALQAGALSQQRVQSYAALLTSR
QVVGRIAGGEDVADVQARITANAIPETTLLRATVADSVPTRAAARANALGAAFARLIDQIERPTPKSPPTIRVTVVDDAE
VPEDPVAPQPLTNMALGVLIALFAAVTGLVLRDRLDTTIKTAETLRQVAKSSVLGLIGYERDARRHPLVLRDQGRSVRAE
AFRSLRTNLQFIGVDRQPKSLVVTSCLPGEGKSSTSVNLAITMAQAGWRVVLVDADLRRPSVPRYLGIEGGTGLTDVLIE
RARLHEVIQTWGQPGLSVLPSGRIPPNPSELLGSRVMRSVLAQLTEEYDMVIVDAPPLLPVTDAAALGAICDGALLVVRH
GKTRNEQVLRAGELLSSINARLVGTVLNFVPAKHGSYYGYGYGYEADPVEQETSSRTPQPQTPMPV
>gnl|bykdb|A0A1Q2CI19 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus flavus] (length=497 residues).
MSLKDFLSILRHRWLVIVLCVLIAAGVVFAITPAERDVSPRIGSYTATSTLLVGSVGAPDAGAGYASLGRVALFITTGEV
PRNAAAALGYEGDPALLAKQITVETQGESASVTITTTASDGERAANVVNTFANETIAFFETSPPGAETTRLSVLQEATPI
PNESTANFVIPPDRWFRTLLAAVLGLLFGIALALVLERLDSRLRTREEIAEALDMPIVGVVPKITAAQRRNKEILTVTQP
LSPYADGYRSVRAALAHGQAEAAPARGHQSLVVLVSSAHVAEGKSTSTANLAASFAETGKQVLVIDADLRSPDVHEKLDV
PQGAGVSDLLVDGQGSLNSVIRPTNIPGVRVVTAGTRLAHPTALASRMGPLVASARKRADVVIIDSAPLLEAAEVFDILP
HVDDVVLVARSGRLSAASAQRTKEMLARFNIPVVGAVIVGAPLRKGDIGYGSGYGYGYGETKGKAKGKRGGARAVADEKP
EASLVEPAEDVQAQRSK
>gnl|bykdb|A0A1Q2CJ92 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus flavus] (length=486 residues).
MWGLLRRGWLVIVASLAVGLALAFALSLTQPVLYSATSAGYVVAGNSATVGDAFAGSTLAAEKAGTYLPLVQSRSVANRI
AEELALPSTGPVVGNLEGSVDGVIFRIRATADSPELAASLADAAIRATSVEANALETLTITGESSGQTVVRIVPVELAQT
PTTPVSPNYVRNLALGAALGLLLGLGIVVGRQSFDRRIRRAHEAEEVAETSSLGIVPAAAELAGESALVTGSSAAAEAIR
QIRTNLRFVSVDNPAKSIVITSSNEGEGKSTLAANIAAMFADAGEPTVLIDADLRRPVQAERLGLDGAVGLSQVLAGTIK
LSDAMQATDHKHLQVLPAGRIPPNPAEMVGSSRMRSLIEHLSKAHMVIIDAPPLLPVTDATLLSASADGAVVVVQSGTTR
REQLEVAAHKLRQVDGNLLGVVLNKVAKKDLGEATFGYGYGSYTSKYYRTDEAQKPHRRERARRVTKLVETDDQAAELAE
PRRPVA
>gnl|bykdb|A0A1Q2CRV2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus aquimaris] (length=415 residues).
MQAGSNYAANQVQSFAKVAKSGFVLTPVIEDLQLSVTPEQLARRVAVTIPAQTATMDLAVTADSPEEAARIAHAITERLI
VAVDELSPPGADGQKPVVATVIRQPLVPTAPTSPKPLQNLAIGGLVGLLLGAGQALLRDVLNTVVRSRRDIEQVSDQAIL
GAIPLDESGDVLVLNSDPHGLRAEAYRSMRTNLQFLALDKGGRSIVVTSSVPGEGKTSTAINLAATLAAAGEKVLLIDAD
LRRPRVAAQLQLEGAVGLTTVLIGDARLGDVVQPYGRTPLDVLTAGRVPPNPAELLGHTRMRALLEDASKLYDTVIIDSP
PLLPVTDAAVLAGETAGVLVVVGSGIVRRPELTASLEVLERVEARVLGLVFNRVKRSEGEAYGYRHSYYSDHPRAAPKKG
DRKSKKRRARAEVAA
>gnl|bykdb|A0A1Q7CZ24 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium 13_2_20CM_2_66_6] (length=236 residues).
MGEHLVSLLNPASFEAEQYRVLRHLVETLRKGANLQVVAVTSPGVGDGKTTTAINLAGSLAQAADARVLLVDMDLRRPAV
AGQLGLSGGKRGLAEALLADSGLSLEDTVETLAHFNLSVLPAGRATVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFV
PVPDCRVITKSVDGFLVVVTVHRTPWGVLTEALDLIDPAKVVGLVVNGDDTRRSSYYDVYAGSSRGARGRGAWSRA
>gnl|bykdb|A0A1Q7WJN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium 13_1_20CM_3_68_10] (length=245 residues).
MPHVERRNGSGEEGAAGVIEALRGVRLNVAYAHGTGPLLVSITSPGRSDGKSFVASNLALAFASVGYRTLLIDGDVRRGG
LHRILTVSRKPGLTDVLAGDVTAEAALQRTPYSGLSFIGCGSRRHRGPELLSSAAMPRLVASLRPHYEAIIVDTPPLVAG
VDAFVLGTVTGALVLVLRAGMSDRDVATAKLDVLDRLPVRLLGAVVNDVRSGGDYRQYSYYLAGYEVADEDELREPAQSL
LRDPQ
>gnl|bykdb|A0A1R3WWR6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. RU1D] (length=539 residues).
MQRVVRILRAYWKAIVALTIAGGLVGLAWSAVQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSV
AETARTELGITDSPEALVQRVHVSNPIDTVNVRVDATGPTPESARDLAEAWIRGMTTEVDQLQSGGNGESAVRLIAGDSA
RLPTSPSSPNVRLDIAIGALVGAMAGTVFALVRRAFDRRIRSAADITDTIAASVVGILPVDKELASGRAVFSFDDIRDGR
GSFAHKEAMRELRTNLQYVDVDRPARVMVITSPLPGDGKSTTAANLAVSIAATGQAVVLIDADLRRPVLGGVFGFSDDVG
LSDVLAGRAQIEQVAHQVDENGRLFVVAAGRTPPNPSEMVGSQRMQALTRKLAEELVVIIDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLSRATENISKTRGHLLGVVLNRAPLRGVDSTYYGGRYGGYYGYGAPRGTTRSWWRFGRRPRTADSE
NTTDTGPRRQSADPPPENVRGLRTLSHGRTSASNQDDSSGENVASVTTAPSPVGRRRQR
>gnl|bykdb|A0A1R4JTI6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus lylae] (length=460 residues).
MVTAGVNENLGIALTADNLAKSKATQYQELATSRAVAEGAVKQAGLDISPEAASGAVTATVPPDTAEVRLSVVQDSPDAA
RALADSWVSSLAEEVSNIENQTLPGVEQSEESSAQSIVKVLPLVQATQPQTPHTPNVRMALALGALVGLVVGLGVAALRS
LNDRRIRGVKVLEETFGLTVLGTIPAMAGLGRRAQRNRTQSKDSNAEVESRSALLELTGHTGRDDFHVVEAFKELRTNLQ
FLRPDNPPRIIVVTSAAPAEGKSTVAANAAITLAQSDVPTVLVDADLRRPTVAGSFHVEGSVGLTNAVVGNAQVDDVLQP
VSEVENLTVLASGPVPPNPSEILGSDRLEAILRSLAQDHMVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGRTTRDELAK
SLGNLEKVNGDVLGTVLNRVPTRGKEAGYYGYYGKSYYSSSATPDQDFDVTSRNAGSTRE
>gnl|bykdb|A0A1S1CAD0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC061D12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSITAAAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGDSTA
ASPTGGNTVRVIPLNNASVNPPLVAPNYEQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1S1D5T1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC064F07] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPSNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAATGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGGTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1S1DFA8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC065C03] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1U2GAT5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=360 residues).
MSRDAAASALSVHNVPDTVLLTVAASTPDPETSAKLANGVAAELTDYVSSLESMSDGGPPVAKITVVSNARPEADPVVPR
THRNVALGFGLGLLVGAVAAYLRYRFDNRVRSVADLVNVVGDNVLSVVRFQPDLSNGPVAFLDGGAPVAEDYRKLRTNLG
FVGGDRAVRGIVVSSAAAGDGKSTTAINIASAFAESGSRVLLVDGDLRKPVISERFSLSSEVGFSNVLRGDGNFAEFVQP
SGIDGLWILSAGPLPPNPAELLALESTGRIVNELMDCYDYVIFDSAPILPVTDPVVLSRWVGGIVLVVRADESRTPMLSR
AISEVHSGDGVLLGTVLNGVTLSDGYYGESLYYGKSADGV
>gnl|bykdb|A0A1U3NFN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. massiliense] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAGAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A1U3QN81 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. massiliense] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A1U6THY0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=235 residues).
MAASKRAKKGGLALNRRKLITKYDPRSPISEQYRNIRTNILYSSIDEEIRSILVTSSGPGEGKSTTAANLAIVFAQQGKT
VLLVDADLRKPTVHYTFNLNNTTGLTSVLTNQLGLMEAVQENDEKNLYVLPSGPIPPNPSELLGSRAMNHFLERALEEFD
IVLFDTPPVLAVTDAQVLANLCHGSILVVSSGRTDKEAVVKTKEQLSASSGKVLGVVLNNKKADKKGDYYYYGTN
>gnl|bykdb|A0A1V2NSB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. CSI-V] (length=549 residues).
MQRVARILRAYWKAIVALTLAGGLAGFGWSALQPRVYTADASGYVASVSSDGSTGSALAGGTLALARVKSFIDMGYWKSV
AETARDELGLTDSPESLVQRVHVSNPVDTVNVRVDATGPTPEAARDLAQAWLHGMTVQVDQLESTGGAHSAVKLVAGDSA
RLPTSPSSPNEKLAIAVGALGGAVVGVLFALVRRTFDRRVRSTQDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRDGR
GSFAHKEAMRELRTNLQYVDVDRPPRVMVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVLGATFGFSDDVG
LSDVLAGRARIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQQLARTLADDMVVIIDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPLRGADSNYYGSQYGGYYGYGAPGSGAERTRWWRRPWRRQVGD
AGDAGASAPGPRRRSAELPPSNVSGLRTLSARRNPVAASGDFTGEGAVAVAPPAAVVADERTPRRRRRG
>gnl|bykdb|A0A1V8PLV6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium catenulatum] (length=201 residues).
MIVISSVEPSEGKTTVSVNVAAALAENGAKVLLIDADLRHPSVADHIGLEGGAGLTHVLSDQAAVKDAVQRYWKPNLHIL
PAGPKPLNASMLLNSKTMSKLLDTALHTYDYVIVDTAPMVVANDAAVFGAKSNGIVLVSGRDMTMKRDLKEIAVQLDNLN
VPVMGFVFNFAKERKVSANGNYYYYYDEGGKKSRKKSKHKS
>gnl|bykdb|A0A1X6X0E0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium faecium] (length=221 residues).
MKRKLKQNLITFYNSKSPVSEQIKAVRTSLNFATIDQDAQVILITSPTPSSGKSVVSSNLAVSYAQQDKKVLIIDGDLRK
ATQHYQFKADPYRGLSSLLIGKLSIADAIQETFVPNLSVLTSGPMPPNPAELLSTNKLDTLMDEFKKSFDIIIIDTPPVI
NLTDAVVISRVADGIILVVRANHTQKNEVSRSVEILKTTNKKLFGTILNDAKHEVSDYYYY
>gnl|bykdb|A0A1X6Y1L5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium faecium] (length=228 residues).
MRKTKIKDKKRLNIILNRENAKSIPYEQMKNIRSSIQFASTKELKSLIVTSPESGTGKSFVATNLALTYAEQGKKVLLVD
TDLRRPTIHKMFGKENILGITSVLTGQETIDDCVQDKIFNSLTILTSGFLPPNPAELLESEEMKAIIKQLTTDYDIVIFD
APPVLPVVDSALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIKSAGSRIIGTILNDKSSKDSGYEAEYY
>gnl|bykdb|A0A1Y4CKD6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Olsenella sp. An285] (length=514 residues).
MNDRRYGLDLSPVRDEEQGLDMAELASNYLRIARRMWWLFLACVAIGVGCLYVASYVSYTPLYRSEATFTITSGDGSSLY
SSVSSASQLSKTFPYVLDSSYFRGVLEDALGTDSLDGTIEAQTIDNSNMVTMWVDSASPENARAILEKALEVYPEVSRFV
LGNIAFNLIDEISTPATPVNEPSQSRIWGFGVMGGICTAALVVGLIALFNNTIKTAEDLESVSSMVCLGALPEVRAKARK
RSAASRYVSALDKRVSHGFRESARAMGARVRDALSERGAKVVLVTSSIAGEGKSTVAINLAEQLAQDGSRVLLVDMDLRS
QGDGALLGCGASHGPAEVLEDSGLGVDDCIVLLEESGIGFWGGAGPVQNPVEVLSDERLPSLFDGLRGQWDYIVLDASPC
GMFQDAAMLANWVDEVLFVVRFDKVGRHNVQDALSMLDGERASVLGYVLNGCPQTAGSYGYGYGRYGYGKYGYGSYGDGY
GGLADEVDEGVKPVVEPEIVEEEVVPPRGKHFRV
>gnl|bykdb|A0A1Y4CTD2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Olsenella sp. An285] (length=450 residues).
MVLDGVTVREAARQVAQNWWVVLALALATFLGMTGVGKLTYVPEYTSAATLVIRVKGADAYSSLAQASQMTAVYSEVFQS
SALRNEISASVGEPVEGSVSCSQVSGTNLLTLSVTSPTPRQAYLFIQSALQNYERVSGYVFSNATLQLVQEPSVPESPSN
TSPLIAYRYLGAAIAALGAVALIALIYLLRNTVKTAEQASDLLDGRVLGTVPFERKRVVRGGDERSVPALVLSSPLVSMG
FAEANRRTATRLEAHLRSGGFKTVLVASVEENEGKSTVAANLAAALAERGRRVLLIDGDFRKPAQRRIFDEQNLERPSFS
DYVLEDGVAGVGPVLNGRSGVYELFQYKALRDPMAVFSGERLADVMAELSERFDYIFVDCSPVAAAADAELWMRQVDTVV
LVVRQDMTDVRVINDTVDVAWKSAGDFSGFVLNAFQGEWSLTHGRGYSAY
>gnl|bykdb|A0A222TG79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia rubripertincta] (length=414 residues).
MYVTSGDDSNVQAAYQGSLASQQRIASYAQLASSDAVISNAVSESRKSISSEDVRKKLSTSWDPDTVLLNVTVEDSDRSV
AVVLANSVAASLQDYVESLETPAGGGSPMAKLTTVTPAVEPSVPVSPGIEKNTLIGVAVGLLFGLLAVMFASRLTNRIQT
PADVVEVTESPVLAVVPRFPSAADSPVSFGAGSSPASEAYRRLRTNLSFIGVDSPHRRFAVTSALEGEGKTTTAVNLAVC
LSEVGYKVVVVDADLRRPMVAVRLGVNPDIGFTDFLSGRAALEDVLQSTSFSGVDALAGGQIPPNPAELLTSQKASEGIN
SLSSLYDYVIVDTPPVLPVTDAVIASRLVDGVIVVVRSGASRRPDLESMLSHLGRANAAVVGVVLGDAQSRAGYYANSYA
LEYGQVGVRDSAER
>gnl|bykdb|A0A231VTW0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. Olga] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A255G8R8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium NML 030167] (length=382 residues).
MTTTVPQKTVIVEVTVTDPDAASAARIANAIGDQVAETVRELSPKRDGQDTVKATTISPALPPPSPSSPKVAQNLALGLL
LGLALGFAAALVRERLDTRVRNEADVAAVTTASQVGSIPYVAGTPEHPLELGAHTDQRFEAYRRLRTNVQFVAAPQGRTA
LVVTSSVPGEGKSVTVANLALAMADAGNRTLLIDADMRRPTVADNFGLVGTAGLSTILAGQATLSDLVQPFSGHPDLYVL
TSGVVPPNPTELLDSAQMRALLDEALAEYDVVLIDSPPLLPVSDGLVLGKLVGGALLVTGIERVKKPQLAESLAALGTVD
VKVQGVVLNMVRRKERGDAYGYYAYGSEPGRQRSSSAATGRRAAPSGQRPDDLVLTPRQARE
>gnl|bykdb|A0A259S8H9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 13-71-7] (length=590 residues).
MLDLFTILRRGWLYLAAGLLLGALAGFGYAQTLAPVYTSQATGFIAATGTAVIAGSDEAVARAGAYMPLINTSQVRDEIA
KEAGVSAAELHGSLSARVVPGSTLVEVTADAADPKSALKLANGALHALAKVVAHIEQVAQSAAPVDPSLPPEPKSATNAA
PGGIAIVPMDEAVAPTRPSAPNKPLIAGIGGGAGLVLGLIALLLRRAMDVRVRAHTDVAALVGAGVLGRVPRMRKSGQGR
NAALARAVAHEAYRQIRTGLRFASVDQEVRVVMVTSANLGEGKSETTRALARVLAESGQRTLVIDGDLRRPTIAKGFEID
EAIGLSEVLSGQVPIGSAIRRTEEANLFVLPAGGIPPNPSEMLGSAAFQQLLTRLRQDFFIVVDAPPVLAVTDASVLSSV
VDGLVFVVAMGRTRRVEIVEARTQLEQVRARVLGVVLNLVSLRGGDNGYGYYRKNSRYYMKSHRAATAEDGDDAVDAFAA
MANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGPADIITDGDAADAGEEASPAIVRPHGSNGRAAAARARRSVPPVE
VAEPVGERVDGEDEAHDAAKPRYARRNARP
>gnl|bykdb|A0A261FE22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium tissieri] (length=440 residues).
MAKNSDGAMTTGASNGGSSPLASYAQLVQSDAVLEPVVNNLGLHTSVAGLRGNVSASASDGSAFVSMTVTYSDPNDTVTI
LNEVVKQLNKQITSDGSSGIQLSFIQKPYVPSSPSSPNVKGNMMMGAFAALIIAAAGAVIREMSDNSIHTKAEIQSIVPA
PILAAVPKSPTLAGRTPAVIVKPRGHAAEEFRRLITNLSFVKNDRGNRGNVLVVTSAMLGEGKTTVSVNIAATFVEKGES
VLLIDADVRHPSVAKALGISNGVGLMQMLTNQVDAQTAVQQYWKPEFQVLPVEDNQGTAAVMLSSAVMENMIDQAAKHYD
HVIIDTAPMQVSNDASLFAREGATLLLVVAQTVGRKKVLRDVAHEFKVSRVKISGVAFNRVAHERSRKGNYYYYEESETK
AKKSSKRSSRKASASAPATQARPQVQAQAPRSARTAVSGK
>gnl|bykdb|A0A261FQA1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium lemurum] (length=466 residues).
MSIADILQMIKKHWIVGLAVLVVSLAVTVCVVQTTVPEYSASVTAVTNAQSAAADGSTSDSRMGVVSRVATSSAVLEPVI
DELDLDTSVDAMASSVSASVDASGLMTVTATSSDSQQAADIANAVYDSLVQQIEDDSFASNETGLFNGLQFSVIERAVAP
SSPVSPNKPRLIFMGTLAGLVLALVVIVVIDVSDKRVRDTADIQRILYSPVISSVPKSDTFRGTAPAVISDPSSKAAEDI
RRLALNLDFIVPDKTDMSNVIVVASSDASEGKTTIAVNLAAAIAERGRTVLLIDTDLRKPSMAGVLGINGKVGLAHVLAR
QAKLDEAIQQYWKPTFHVMPAGEQQANPSILINSKAMNMLLHAAAKQYDNVIVDSTPMSVANDSAVFAKEGGTLLMVVGQ
GVAQKKTLKASAEEFELVGVKPAGAVVDMVKEQRGKGDYYYSDKAAKHSSQGTSEKSHEPTEKAEQ
>gnl|bykdb|A0A285VUW0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Ornithinimicrobium pekingense] (length=480 residues).
MSVRDLFLAIARRWRGAVAILLLVVAATAFATSRQPQVFESRTTVYFAATDEAGESSGNLYQMPAGERSTLARIARSPLM
LDPVRETLGLDASVPLSVEAVPGGDDTALFDFVVRSDSPDHASAVAEALPQQLATTARSYAPTLAQSGASVAAQFVDQPT
QSSEPVSPNPTRNLAIATLAGLMLGLAYALGMQALDTRLRSTADVEALTGRPVLSTVPVLPTAGRTSSMYIENDPFGPQA
EAIRKLRTNLVFVDVASDAGHSFVVTSSLSAEGKTTTVVNLGMAMAESGRRVLVLDADLRHPSVASELGLEGAVGLTSVL
AGDARAEDVIQRWRDTEMYVLAGGEIPPNPSELLGSRAMERLFKQFLRDFDFVLVDSPPILPVTDALVMSRLTGGLLMVV
SAASTRRRHLQEALRTLEAAEAEVSGFVLTKTPAERSGSYNYQYYGRETPVTAGETRGSRRQSGGARRLARRKGARAARR
>gnl|bykdb|A0A291DEI8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSED
LNEENIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTD
ASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A2A8D6P2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A2I1VJQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A2I1Z490 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPSNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAATGLALVYLAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTEDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQVDESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVIDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A2N3R006 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum subsp. pseudolongum] (length=372 residues).
MAQLKEQVSVTNPTNTAFVNISVTDGDPAQAADIANAIAKSLSSVVETTLYASGSHSSVKLSVVQPAAVPSSPSSPKWKL
NILVGIVGGLILGVFAALLKDVLSKRIQDDDEISEYIDAPIIGRIPEEELLNSAKPVIVSEPGSPVAEGFRRVRTNLSFM
APMEDTNCQLIVVTSTGASEGKTTTSVNIAAALAENGAKVLLIDADLRHPSVANKLDIDGSAGLTHVLSGQASVKDVVQR
YWKPNLHVMPAGPKPPNASALLNSPIMVELLNNAIAQYDYVLIDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLRE
ISEELATLDLSANGVIFNCARESKKSLEYSNYYYYYSDSNKKRSKKGRFSLK
>gnl|bykdb|A0A2N3YJR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera duodecadis] (length=474 residues).
MTLLDFVRLSRTHLLSLVLLTLLGGAAAFGLTTRLPQVYQADASGYVRVTAAGSSTGEGIAANALSGSKADSYLPLVTSR
AVAQRAIEATGVKASPASVASRVTASVAPDSVILKVTATAPSPEEARVLADAVIKATAEEANRIETAGSGRGAASVTIVP
IESALPGTKIAPDPRRNTLVGLVGGLFLAYALIFVRRQLDTRVRSAEDVEKETGASVLGVVPVTPELRAARGRGRLDALG
ASAESFRQIRTNLRFVGVDDPPRSIVVTSANAGEGKSTVSATLARVLGQSGQSVVIVDADLRRPTLAKVFDRENTIGLSH
VLTDQVSLVDALQATDQPNVRLITSGRTPPNPSELLGSARMHDLVRELSVDNIVILDAPPLLPVTDAGVLSASCDGALFV
FAVGKTHREQARLAARMMGQVGGRVLGVVLNLAPKGRAGAVMYGYGYGGYATYASDTKSRRDYEKASRGRHGTD
>gnl|bykdb|A0A2N4T4Q5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria flava] (length=336 residues).
MDRRIRSVEEVRETFGTPVLGIIPEDDRLADHREIIETGTSGGRGHHAFSEALRELRTNLSFVSVDAPPRVVVVTSSMPG
EGKSSITANLAVAIASTGRDVVVVDGDLRRPVMTELFGLVPGVGITDVLVGEAEVDDVLQVYDKFPNLQVLGAGRTPPNP
TELLASQAMRTMLAELAEDAFVLVDAPPLLPVTDAALLTASADGALVVATAQGTTVDELGKALGNIEHVRGRVLGVVLNH
VPTTGADAGFYGYYGKSYYASDDSGGDAPEAPLRPAKEVPDAGTAAPASRAPDTGSTAALETESPADAAVSDLPADESER
FDLAAWQRPGKGTHRA
>gnl|bykdb|A0A2N6V1R5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces graevenitzii] (length=639 residues).
MTRVNLGFLILCVLLGLAGGFGYASAQPWTYTATSQAMVVVPGTDAFSQNSISGQKASVYAVLAGSQNVANRVAKTLKTS
NMEGTLSGSADAVPGLFTLTATASTPERARDIANAGIKAVSDEANAITTLNAPTVQPTTKTTTNPDGTQVTTTTQSVDGT
TNVTTTDNSYRETRVTQTLQAVAPSAPSSPDFYKLSGMGALAGLVIGYLVVFMRRLMDNRVRHNSDVEELLGSSVLAVVP
KSTELNAKGRQNVDGLGQAAEALRHLRTNLRFVDVDNPPRAIVMTSANPGEGKSTMSAVLAQMLASSGQRTVLIDTDLRK
PVVHKIFGLDGSVGLTQILAGDMQLSDVAQKIEGQPNLRVVPAGRIPPNPSELLGSQRMKALMDYLKDDAMVIMDAPPLL
PVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASRRNLGSVYYGYGYGGYGQNYYYYEEDEK
RKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRV
STVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
>gnl|bykdb|A0A2R7MGI0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. HMWF026] (length=514 residues).
MQRVVRILRAYWKTIGALLALGALAGLGWSALQPRVYTADASGYVATVSSDGSTGSALAGDQLALSKVKSFVDMGYWRSV
AEAARQTLGVNDSPESLVQRVRVSNPVDTVNVRVDATGPTPESARDLAEAWIRGMTTQVDDLETGGTGQGAVRLIAGDSA
RLPTSPSSPNIKIDVAVGGIAGGVLGVVFALVRRTFDRRVRTVQDITDTVDASVVGVLPVDKELANGRAVFSFTDIRDGR
GSFAHKEAIRELRTNLQYVDVDRPPRVIVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVMGGVFGFSDDVG
LSDVLAARAQIEQVAHQVDEEGRLFVVAAGRTPPNPTEMVGSQRLQSLARKLAEEMVVIVDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLTRAIENISKTRGRLLGIVLNRVPLRGPDSSYYGARYGGHYGYGESHATGAEGIKRSTRRGARGVA
AKSGPAETGPRRRSNAAPDDARALHAGEVFRDLG
>gnl|bykdb|A0A2R7RCA1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. HMWF013] (length=243 residues).
RTNLSFLDVDQPPRIIVVTSSVQAEGKSTVTANLAVTLAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELA
DVLQPWGALPNLSVLGSGRIPPNPSELLGSQAMKNMLNALAENAIVLIDAPPLLPVTDAAVLSRAADGAIVVIRTGRTTQ
EQLAQSLGNLDKVKGRILGAVLNYVPTKGTDAYSYYGTYTSAPTSAPGPVAEAEPDLTGPFWEGPGESVQVPESVSAGRR
ARG
>gnl|bykdb|A0A2R7Z032 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides currus] (length=477 residues).
MTFAEFVRLTRAYWWFLVLLTALGAGVMIAKTSREPELYSAGASGIVKVGFSSSAGEEMSNQSLASDKAALYVALANTTP
VAERVVEKLGLDVDPGAIAGRFSASVDTDINLLTVQAIGTTPEEARDLASIVVQAIADEAEEIENTGRPAGNKAETLVQV
VPLEQAQLPGAPFTPNYRNGAIKGAGGGLVLAYVILIARRLIDRRIRSVKDVETATGSAVIGIIPKVDALNRTHRGVRGD
LGQAAEAFRQLRTNLRFLDVDNPPRRIVITSALASEGKSTVSSNLARLVAQAGEKVVLIDADLRRPMLATTFDIDGEVGL
TQVLAGDLRAGEAMVSSGIDNLWLLPAGRIPPNPSELLGSLRMSQLIDELARTHLVLLDAPPLLPVTDAGLLSAFCDGAL
LVQATGQTYIEQSEHCRRILDQVGSRLLGIVLNKAPLKGVGAIAYGDGYGYGGYGAQAEYASREAYSTAGKGKRRSK
>gnl|bykdb|A0A2R9UAT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 71-36] (length=448 residues).
MLANNLALSKVVSYVDIGSWRSVAEYAIEKLRLDSSPEALVRRVDVTNATGTVTIKVQASAPTPETARDLAEAWIQGMAT
EIDGLESDGGKVQAAVRLVPADTARLPTAPSSPNVRLALAIGGVAGLVVGLMIALLRFTLDRRIRSAELVERETGVAVVG
TVPVEKSFTAANRLIPVGGQRDERLFAVSEALRELRTNIQFMDVDHPPRVVVVTSPLPGDGKSTMSANLALAMAASGQQV
VLIDGDLRRPMIAAIFGLVEGAGVTDILAGRAEVDDVAQTFGHLDTLRIVAAGRTPPNPSEVLGSERMKDLLRELSREAM
VIVDAPPLLPVTDAAVLTHSADGAIVVVGAGRTTIDVLKKAMNNLERAGGRALGVVLNRVPRSGGGYYDYRYTGDYYQAD
QTPYDEAVHNPPNNVDGITRPVVETQPAATGDPQDQLAPLRRTRRRAG
>gnl|bykdb|A0A2S0LQ32 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces sp. oral taxon 897] (length=604 residues).
MKVNAVFIICCVVVGGLLGFGYAKTQPKLYQSSAQATIVIAGTDAWSANSVAQQKAGVFAKLAGSAAVAQSVSQSLGLQD
LGGSLTGAAEPSSPIVTITAVSSDPSRARDLANAAIPALGSYIASLEAIGSGQSPSPADAQPPAAGSDQPSTPSPADEQP
AAPEPATPEPRQEEPRGGNQDEGANPGTGERRSTPGRGNGTGEEKEDAAADAQARVVPAVAGTGASLVPAVAGAPQAAVG
QAGVGQAGQAAPAAPATAAPTDETYNSQTRLVALEPAQLPGAPFSPDTTKLAGMGGAGGLALGLAVAFLRRALDNKIRHN
SDIEDILQSSVLAVVPRSTDLSAKGRRNVDGLGQAAEAIRLLRTNLRFVDVDNPPRAIVMTSANPGEGKSTISAVLAQML
AASGQRTILVDTDLRKPVVHRIFDIDGSVGLTQVLAGDVPVSDVAQFVKGHPHLRVIPAGRIPPNPSELLGSQRMKALLD
RLSQEAVVLLDAPPLLPVTDAALLSALADGAILTFEVGGTYKEQARLTGKILGQVDARLLGVVLNRASRRSMGSVYYGYG
YGSYGHHYYYGERPRGWRRLLPGGRRHTRHQEPAETQEHVPAAS
>gnl|bykdb|A0A2S5ULV5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. AY1H1] (length=532 residues).
MTVLDFLRLTGKSWKILAIGVIVGLLAAFGYTQIQPKVYEADSAGFVIAGSSGEFSSIDGSEQAITKANSYLPLITSQPV
YAKIAENPNSGLAAGETLTGRLSATVAPNSNLIQVSASASTPSSAVALANGALQAMADVITEIETQVGGGTSGVTVVPLQ
NAVEPTSPVSPNLRNNLIIGGAIGLVLAYAFALLRRSLDVKVRDSKDLATASGAGTLGRIPKSPQLMGKNRGTNDADAIA
AESFRRLRTNLRFASVDEEIRSIVVTSANAGEGKSTVATSLAQVLAQSNTPTILIDADLRRPTVATVLGIDGKIGLSEVL
SGQVSLEDALVGSKIPGLYVLPSGRIPPNPSEMLGSEAMKSIVSLLSKDYIVVIDAPPLLPVTDAAVLSTRVDGVVLVAS
AGRTRREDVMAARDMLKQVHSRMLGTVLNMVPPRDSADGYEYRRNRSYYVTADKKGMPKFKAVKGHTDPSEHFGAQPDVA
APQRESLSPSRPAQPAAEQAAPSQPQAGPVPSSAPTAVATEQPQSRRSRRGA
>gnl|bykdb|A0A2S5UYV0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. AY1F1] (length=533 residues).
MTVLDFLRLTGRSWRTLLIGVAIGLLAAFGYTQVQPHVFTANSSGFVMAGPAAEGGYIGGSEAAIAKAQSYIPLITSQPV
YAKIAENPALGLAEGQALTGRLSASVAPGSNLIQVQASADSPSSAVALANGALQALADVITDLESQAGGGVSSVTVLPLQ
DAVEPTSPESPNLRNNLLIGAGLGLVLAYVFVFLRKALDVKVRNSKDLASAAGVGSLGRIPKSPQLMGKNRASNDADAIA
AESFRRLRTNLRFASVDEEIRSMVITSSNAGEGKSTIATSLAQVLAQSNTPTILIDADLRRPTVASVLGIDGSVGLSEVL
SGQVSLEDALTATKTPGLYALPSGRIPPNPSEMLGSEAMRSIIRLLSQDYIVVIDAPPLLPVTDAAILSTRVDGVVLVAT
AGRTRREDVGAARDMLSQVHGRLLGTVLNMVPPRDTADGYEYRRNRSYYVTADKKGMPVFKSSKGHVDLLEPQPEKNASA
AISLAPRPNSQSSEQPPQAVVAQQQAPASETPSDLSSTPEVQGAPTRRSRRGA
>gnl|bykdb|A0A2S5WZJ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. RFBG4] (length=408 residues).
MADVITDVETQVGGGVSNVTVIPLEDAVPPTTPVTPNLQTNLLLGAGIGIVLAYVFVFLRKALDVKVRTSKDLATATRSG
SLGRIPKSPQLMGKNRGANDADAIAAESFRRLRTNLRFASVDEEIRSMVITSSNAGEGKSTIATSLAQVLAQSNTPTILI
DADLRRPTVATVLGIDGKIGLSEVLSGQVSLEDALVASKIPGLYVLPSGRIPPNPSEMLGSAAMKSIISLLSTDYIVVID
APPLLPVTDAAVLSTRVDGVVLVATAGRTRREDASAARDMIDQVNGRLLGTVLNMVPPRDTADGYEYRRNRSYYVTADRK
GMPVMKSIKRGHEQPEAFAVQTDASAAQTPQPTFAAVAPAAAPARESLAPTRPSASSAPRATPAASQPTPPPQTPGSELP
SRRSRRGA
>gnl|bykdb|A0A2S5X9U6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. RFBA6] (length=526 residues).
MTVLDFLRLTGKSWKILAVGAIVGLLAAFGYTQIQPKEYEANSAGFVVASGNAELGYINGSEAAIAKANSYIPLITSQPV
YAKIAENPDSGLAEGETLNGRLSATVAPNSNLINVQATASTPSSAVALANGALQAMADVITEIETQVGGGASGVTVVELQ
NAVEPTSPVSPNLRNNLIIGGAIGLLLAYAFALLRRSLDVKVRDSKDLAAASGAGTLGRIPKSPQLMGKNRGTNDADAIA
AESFRRLRTNLRFASVDEEIRSIVVTSANAGEGKSTVSTSLAQVLAQSNTPTILIDADLRRPTVATVLGIDGKIGLSEVL
SGQVSLEDALVGSKIPGLYVLPSGRIPPNPSEMLGSEAMKSIVSLLSKDYIVVIDAPPLLPVTDAAVLSTRVDGVVLVAS
AGRTRREDVSAARDMLKQVHSRMLGTVLNMVPPRDTADGYEYRRNRSYYVTADKKGMPKFKAVKGHADPSEQFRAQNDAV
PAQRESLAPSQPAQVRSAPVVPAQLETQSAEPVSEQPQSRRSRRGA
>gnl|bykdb|A0A2S5XDQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1C5] (length=489 residues).
MTVVDLIAFIRRNWRTLVGAVLVGALAMAAFSFLTPKVYESSSAGFVIAASDGSSADAISGSQTAVTRANAYLPLISSSA
VSERIEADPEANPGGEALSGRLTARVAPGSTLIEVTAAAGTAQNAAALANGALAALAAVITDIETQSTADRTPQITVVPL
ENAEPPAAPTSPDWVRNILLGALGGLVLGFGLAFLRRALDIRVRTVDDLTELFGVGVLGRIPKAGRPGRTGGRRGTDALT
AEAFRSLRTGLRFSSVDEETRSVVITSANQAEGKSTIAAGLARVTAESGQRTLLVDADLRRPSVARMLDIDGAIGLSEVL
SHQIPVDDAIRPTGTAGLYALPAGHIPPNPSEMLGSEAMRALVARLSKDYFVIIDAPPVLPVTDASIVATVVDGVVFVVA
SNQTHRPEVVAARRIVQQVRARVLGTVLNMVTARDGDTGYYYYDRKNAYYAEPQPATGRKRAAAAPRRSELAPVESRALP
PQTSRRAAR
>gnl|bykdb|A0A2S5XNN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1F3] (length=489 residues).
MTVVDLIAFIRRNWRTLVVAVLVGALAMAAFSFLTPKVYESSSAGFVIAASDGSSADAISGSQTAVTRANAYLPLISSSA
VSERIEADPEANPGGEALSGRLTARVAPGSTLIEVTAEAGTAQNAAALANGALAALAAVITDIETQSTADRTPQITVVPL
ENAEPPAAPTSPDWVRNILLGALGGLVLGFGLAFLRRALDIRVRTVDDLTELFGVGVLGRIPKAGRPGRTGGRRGTDALT
AEAFRSLRTGLRFSSVDEETRSVVITSANQAEGKSTIAAGLARVTAESGQRTLLVDADLRRPSVARMLDIDGAIGLSEVL
SHQIPVDDAIRPTGTAGLYALPAGHIPPNPSEMLGSEAMRALVARLSKDYFVIIDAPPVLPVTDASIVATVVDGVVFVVA
SNQTRRPEVVAARRIVQQVRARVLGTVLNMVTARDGDTGYYYYDRKNAYYAEPQPATGRKRAAAAPRRSELAPVESRALP
PQTSRRAAR
>gnl|bykdb|A0A2S8MDM2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. ITM-2016-00317] (length=237 residues).
LDKERRKQPAISFETDNAATAEAFRKLRTNLQFLAIDSPPRVLVVTSSVPSEGKSTTAINLALALAEADHKVLLVDGDMR
RPSLHQYLDLLQPVGFSTVLSGRALLGEALQKTRFPGLTVLTSGSIPPNPSELLGSQSARRLLSELRSQYDYVVVDSTPL
LAVTDAAIMAAGADGVLVIARHGSTKKDQLTHAVSSLHSVGAPVLGAVFTMMPTRGSSSYGYSYSYYGTETPRHAPP
>gnl|bykdb|A0A2S8WHZ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. MYb227] (length=511 residues).
MQVVRAYWRGIIGIFLICILLAFLWTLTQPRIYAATSSGLVIAGDSENIGNALAGDNLAKSKAVGYKSIAGTRTIADLVR
KELKLDESSDVLLGKVEVTVPTNTAEIRVTASSQGAEEARNLADAWVVALAAQVEELESVSVGGSDRATAVKLQPLGQAV
LPSSPVSPNTKLSLALGGVIGLALGLGYALTRNHLDRRIRSVEAIERLGVSVVGTIPEDQRLTEGRSVVETGSIVHDDRA
AHAFSESLRELRTNLNYIDVDNPPRIIVVSSSVPGEGKSSVTANLAVAIASTGRNVVLIDADLRRPVQTELFDMMDGAGL
TDVLSHSADLEDVLQPYGHLPNLQVLCSGRIPPNPSELLGSKAMKSLLSELALDAVVLVDAPPLLPVTDAAILSTSADGI
LVVVRAGSTTGDELGKAIENLKKVDANILGAILNQVPTKGAGAAQYGYYGKYYYSNTEQDPKADAKPSRRLQDPVPVDQP
VISSNRFGEIPGLGAHAGSSEPEFRRLRRRR
>gnl|bykdb|A0A2T0S3C8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudosporangium ferrugineum] (length=493 residues).
MDVRDYLRVLRKRWWMLLAGIGVACGLAGILTSQMTPQYATSVTFFVTTPNNGVTDAYQGGLFSQQRVKSYATLLTGDRL
AKVVAAKTPGLELTPAEVRERITAEALPETVLLQATVTDGSAERSRLIAGVLAREFTTMVEALETPRDRTASPIKVEVVA
GPTGGDTPVSPKPLRNLALAALLGLLAGGVAAVLRETLDTTVKTADALHELAGAPVLAGVPFDADARSGPLRLTGSGHSP
RSEALRQLRTNLQFVDVDRPVKTLVITSAMPGEGKSSTACTLAGLFAEAGQRVLLIDADLRRPRIADYLGLEGAVGLTTV
LAGRASIADVVQPWSEGMWALPSGSLPPNPSELLGSQHMADLLEQFREQYDMVIVDCPPLLPVTDGAVVAARADGALLLA
RSHKTTSSQIQTAARALQSVDARLLGCVFNMVSAKGPEGYYYEQYGMTSQHRRGAWRDRMRAPATTELRDLMACGEPESA
PERRLDEPIGSGR
>gnl|bykdb|A0A2T0UZ65 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera remsis] (length=486 residues).
MTFLDFVRLSRANLLRIVLLVLIGAGLAFAYAQTLPKVYAADASGYVVTGGGQNTGDVFAGSTLAGSKAESYLPLINSRA
VGKRAGEIIGSDAPPEVLAARVAGSVAPGSVILKINATGPTPTDARDLADATMEAVAAEANRLELGGGEVKPGTQALVRI
IPIETALLPGAPIGPNVTKYVLAGAVAGAALAYAWIFIRRLSDTRIRTSKDVEDLTGSSSLGVIPLSNELRKARGGRSSG
LGLAGESFRQIRTNLRFVSPDAPPQSIVVTSASPSEGKSTVSSTLASIIAEDGRPVVIIDADLRRPNIANILEVSSTVGL
SEVLSGQMDYTDAMQATRHQDVFVIAGGQVPPNPSELLGSARMRQLLQELTRDHFVILDAPPLLPVTDAALLSGAADGTI
LVFAVGKTHKDQVEACAKMIQQVGGRILGIVLNMAPKRGMGSVMYGDGYSTYYSHGSYEYYKSGPKKGRRRAAKKAKDRV
GAGRRG
>gnl|bykdb|A0A2T7WQY4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium testaceum] (length=516 residues).
MDMQRVVRILRAYWMTIGALFALGALVGLGWSALQPRVYTADASGYVATVSSDGSTGSALAGDQLALSKVKSFVDMGYWR
SVAEAARESLGVEDSPESLVQRVRVSNPVETVNVRVDATGSTPESARDLAEAWIRGMTTQVDELETGGSGQGAVRLIAGD
SARLPTSPSSPNVKVDVAVGAIAGGVLGVVFALVRRTFDRRVRTVEDITAAVGASVVGVLPIDKELANGRAVFSFTDTHD
GRGSFAHKEAVRELRTNLQYVDVDHPPRVIVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVMGGVFGFSDD
VGLSDVLASRAQIEQVAHQVDDHGRLFVVAAGRTPPNPTEMVGSQRMQALARKLAEDMVVIVDSPPTLAVADAAVIGSWA
DGVVLVVTAGRTTDDMLTRAVDNLSKTRGRLLGIVLNRAPLRGPDSSYYGARYGGAYGYSEPDADTRKGAKRTRGRDRRP
SSVMGAPGATGPRRRSGTASDDARVGASGEVRRSRG
>gnl|bykdb|A0A2V2CXY5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Collinsella tanakaei] (length=248 residues).
MASEGRAGMKELVIRNMPKLPFDVTEALNQFRINLGFCGDEVKTIMVTSSLPNEGKSFLVMQLWRMMAEVGTPTLLIDCD
YRNSEMRTKYGIGSTEKIIGGAHYLAGKADMADVIYQTNIPNGYMIPTTSAIANPTILLEGTRFSHMIESCAKTFSYVLV
DTPPLGSVADALNVAPHCDGTVLVVRSGATPRKLVDNSVQLLKRTETPLLGIVLNRADMNSKSNMYYHRYYRSSYYYNSY
GSRSQKQK
>gnl|bykdb|A0A2W1Z497 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_040] (length=561 residues).
MAPDARPDERTSRTLADYVRMFRTYWFGAVLIVLACVAAAGAWTLTQPRVYTSGASGFVRVAGNGDANLDYAADQLSKSQ
AETYVELGGSLAVAKRVVRATGTSASPQELLGRVQTRLPEGTAIIDVTASGATPRESADLADAWIAGMGRQIAAIQSSGE
ALASATTKLVPLASATVPTSPSSPDVRAAVTLGVLVGLLLASVYVLVRQALDRRIRSAAAIEAAFGVPVLGTIPLNPALT
DHRQLVDALPNRTPEERRVNFATSEALRELRTNLSYVHVDERPKVLVVTSPLPGDGKSTIAANLARSLAVTSTGRVVLID
CDLRRPVLSAVFGVARGAGLTDVLSGRADLADVMQQTDDVGNLWIVGSGRVPPNPSELLGSRMFRDILASLGEHATVVLD
APPILAVTDAVVLAAGADGLVVTVSAQGTTIDQLGRALQLVARGGGTVLGAVLNRVPTRGQDARDYGYYGGAYYAGDDDG
SEPAPGTDGGAEHGTDGDAEARAARGARPSGGSRLTPSLPDRDASVPRSPVVSPYDPSLELPSRRSRRRAAAVGGTDDTR
P
>gnl|bykdb|A0A2W2A4B0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_047] (length=470 residues).
MTPLTRALVLRWYFAVGGALLGFVVAIALSSTVTPQFRATSKIWISISGDAESSALDLAQGTNAAQQRIHSYLDLVPQPI
VLQPVIDELHLDVKASELARSVSATSPTGSVVMQIAVTSPDRQRVAEITDSIVRSFSSVVQDRLDANASGVGVTVTQTSP
AARPTTPVAPRTRANAALGGAAGAGLGVLAAFLRWALDTKVRGRDEVQELWDLPVLGDIGFDPEASKQPLVLRDARASAR
AEAFRSLRTNVQFLASRPEGARTLAITSSRPSEGKTTTAANLAVALAESGLRTVVIDADLRRPNLANVFGIEGSAGLSDI
LVGRVELADVLQPWGRAGLSVIPSGTVPPNPSELVGSPAFTALIEDVAALFDVVIVDTPPLGSVTDAALVSRAVQNMLLV
VASGRVRRAEVSSSIESLATVGASVQGVVVTMARSRGARDAYAVYGADVPPETQRSHRSAVPGSTSEVTP
>gnl|bykdb|A0A2W2CFC8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Jishengella endophytica] (length=483 residues).
MDPLRQLRLVRRHWWIVLVTLMVSLGVTALVTVRAQPRYLATVTYFVTTPSQGVSDAYQGGLFLQQRVKSYEQLLTSDRL
ARSVVADNQLGLTAEQVRGRISTSTETGTVLLRASVVDTDQTRALRVTEAVSAKFVELVKQVETRPDGSAGPIKIEVISG
PGVTPSPVSPQPVRNVLIGTLIGLLAGVGLAILRGIADLRVRDGASLRRVTDSPLLGEIPLDNDARTAPLIIGVAAASAR
AEAIRKLRTNLRFVDADEPARVIAITSALQGEGKTTLSCNLAITLAEAGWRVLLVDADLRRSKVGDYLGIDSAVGLTDVL
VGDVPVGDVVQRWGDKSLLVLPAGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLIS
QHGRTARTQVAAAARALNAVSVRLLGCVLNMAKLAKAEAYQYEAYQVLSSSLPVDRATAGRHAEQTAADEPVDNAEELTR
LSR
>gnl|bykdb|A0A2W6DK08 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudonocardiales bacterium] (length=575 residues).
MGIKDYLTALQRRWPVVVVAGLLGLLIGYLVAPGAANQLSGKGSYVATATVLQAPDVKEAVASTTLLVTAEPVAERVSKM
LNTHHAPQDLLLKVTAVADKPSNAINITASDVDPQNAVALANAFAAGTVDEFRARHAAAAAARFRSLEGQLTEVDNQLKQ
VTGFTGAVSTPVNPVLQARAAALSARYAAIYGLLQETANQANNPTGLDTLSPAAGATFNAGAFSLSSTTARTVVGLVLGV
VLGCALALALEHFDTRPRDRAAAGRAYRLPVLAEIPQARHSERRNFAVITASEPESSAAEAYRSLRSSIMFTENRMNHFD
REDMVLDRSAVDTTQPPQVILVASACAAEGKTATVVNLAACFAEVGKRVLVLDCDFRGPDAHQYLGVSPGTGLSNLLRST
TTVDLSLHVRQSDIPRVDVVTAGTQLERPSTLPARMGNLVMQARELADIVLIDSAPMLLANDATDLMPYVDTVLVVSYAS
RTTSEEARRASELLARTRAPAIGVALVGVKGRSYRNLMSYSNGSRGSDRDARFAAVISANDRAHSDRHWRRAEMSELIWH
PSTPAPNGFLPERRP
>gnl|bykdb|A0A2W6VLC6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=236 residues).
PTTFVITSSVPGEGKTSSGINIARALADVGTHTLLVDADLRRPKTDVYLGIEGGLGLTDVLIGRARVEDVVIDMAPRGFS
VLPAGRIPPNPSELLSSPRMKQLIAQLSLAYDVVIIDAPPLLPVSDAAVLAKQTRGALVLVGAGRVTRNQLQESLEGLRA
VGATVAGVVLSMAPTRGPDAYGYGYGSYGTYSASVPDTGWSVSHAAAEASAGVAGAARTESTAGREGTPHREAPFS
>gnl|bykdb|A0A2Y8ZRF8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius hedensis] (length=455 residues).
MTIRDFLRIMRQRWRWLLGTLLIVLIAAAVSTMLQPKTYEASARFYLAGSNGQGTPVQRDDLATYAQVVSAPAVQEVIRK
QAKVGPTAAVNVNATLSDTANIMTGTASSGSAQEAAAIANATGPALAAVAPQFSQLLSGAGSVTSTAVQPATVPSSPASP
DIKRTLELAFAVGLLLGVAMALLRHFMDNRVRTVEDLEALVQRPVLSIVPRVGSGQRVVDTSDSPSGAMVEAMRRLRTNV
KFVNVTNDVPAVVVTSARPGDGKTTVAANLALAMSRDGHRTLLVDGDLRKPGVASAVGIDGSVGLTNVLVHELALKDVLV
EPEPSLPLFVLPAGPVPPNASELLGSAAMRNLFQELVAEFDFVVFDSPPMLPVVDALELEKLAGNLILVARGGQVSRREL
QVTLKALETVDANLSGTVLNYADSFSDDYGYGHKYGYGEQPPAARGQSRRTGKRG
>gnl|bykdb|A0A345NSU7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Ornithinimicrobium sp. AMA3305] (length=367 residues).
MLQMSGSAVSAETVVPAAVPGRPVEPDPERNLALGALAGLLLGVAFALARQALDQRVRGTADVEAISDRPVLSTIPMRKA
DDAHSIYLELDPFGPQAEAVRQLRTNMMFVDVTTGKHSFVISSTLPGEGKTTTAVNLALAMSDAGTKVLLIDADLRHPSV
GTTLGLEGGVGLTTVLLGDADVHDVVQPWGGNNLHVLTAGEVPPNPSELLGSSKMHELFERLSEQYDFILVDTPPVLPVT
DAMVIEKLTGGMLMVVASGETRKRHVSEAMRVLETTGTHVAGFVLTKAPAQPSAYYSYYGGEHASTRPDGPRKRKRRQGK
RDKRMSKSRPHAEAAASARAERAVDGGEALEFRSRARQRLDRRNGSG
>gnl|bykdb|A0A346XTB0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Euzebya sp. DY32-46] (length=559 residues).
MEEQLRRGPSLLESLWRYRVVVAGVTLFMGLLGYVVGLQEDVRYVAQGTLFLADPNLGDELQGIVSARISAEEYVPRQAA
RIQSRAVLQEAADLIDNRISVGELGSNFDIESSAETLEIVLVAEDETAEGAAELVNAVAEAYRTQKRAQEVQRAEDAVAE
LRAQQVRLEEERSGLQSSLEADSSNVALPFLIQSLDARILDISGRIDATLLAVRLRGDGVEDFQDAIPPDFPSRPRPRLT
ALSFAFLGGVASAMWAYWYAFKSQRVTSRTDPEIVLGVPPLGEIPLYRMTSEDQLTGLLRVDPSAAEAYEFVLSSIEFAL
ADLDGKSLLITSTLPGDGKTTTTLQLAIAASRDRRRVVLVDADIRARGLTRVLGADDRVGLSDLAAMDMEPNEVLRRYKF
SEQSQIPVVTAGQRRGDPAALLRTHAFRKGMERIVDSAELLIVDSSPLLAVADATIVAGSVDGIVIVVSHGTPFSELQKV
KERLKFVSTPLLGYVFNRSDSSTAGAYGYGYGVAEDDDGQRRLLPGSRRRNGGNEGTRGSHRDADRDADRDADPDGEGA
>gnl|bykdb|A0A346Y185 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Euzebya sp. DY32-46] (length=621 residues).
MEAVCLFCWQLWQGSQLERTSRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVEAL
VGVLRSSIGRILLVGVAAGLLGFGLSALQSLRYTAEADLLLADPRNTGLFGETGVNFLDPSRYVRNQAEFAQSNAVAERA
SVLLGGRLDSDQVREQSRIRPASDLDQLSISATDGTASGAAQIANAIGEAYQAVVREEAERSTQASLSELQTQRAALEDA
IAAAEARLAASPTDASARAERDAAVSQLIMIDSRADQIAVDSTLFGSGVELFERADVPESPSAPTPVRNAVLACFLGALA
AAALAWWRADETATADGRNDPSRMLKAPLLGTVPSFEEIGLTGSVPTVEAPKSPAGEAYQFLVGALAFALAETGGQSVVL
TSASPVDGKTVTCLNLAVASAQDGRDVVLVDADTRVRGLTRRLGAKDTGGLPALADPRNNLSEIIVPLTADEGQYVPFIP
AKSLGDDTAAFFRTPGFRQAITRLREVADLIIVDSPPLLLASDASAIATNVDGIVVVVSRGTSMKLLEEMRERLDRIGTP
VLGYIYTKAKLDGAGYGDYAYRYGYSYAYGYGETPDDRRPQKEVKPRRRPGGRHREKATTK
>gnl|bykdb|A0A348NU28 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=352 residues).
MARSIEVTIPLNTVILEIKSSSGDPESAAEIANGVADSLTAVVREISPSSANGSSRISANLVDEAVVPNVQALPNKPRDA
LLGAVVGLLLGVLAALLWTLLDTRVPNETVLSQVVPAPVLGSISRVRGNGERGLYVAREPLGHTSEEFRRIRAALSYSGV
AEKVQRLMVTSVSPGEGKSMFASNLGLTLAGLRNNVLIIDADLRRPRVADYFGLEGSVGLTTVLLGDVSIEDARMTRPGS
TLDVLPSGSIPPNPAEMLTSDAMKRLLEEATARYDYVIIDSPPVMSVADANLLAPFVDGVIVVVDAGKTRRNQLIQAAAS
LESAGGRIVGLVLNKVRRKRKESAYYTANTDA
>gnl|bykdb|A0A349B7N2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidimicrobiaceae bacterium] (length=582 residues).
MVLGLTLGWVTTPSSAGPDEPDYYRATHTLVAETGTSAPPNLAQLSLLLRVGDVPERVAAEFGVEPDVLVSQVQVRQNPQ
VATLDITSVGTDPDRAVRIADGFAGALLATLTETTQQERAEAQTRLSARLDELEARLADLDAQIEDGAGDLVQAQRDALV
REYGIVYEDFQVLSREPEATVGLRTLQPAVAVPISGDAFVAALQETLGATDPSEPTAIEDGDPDEEDPLLEAFDAGPSEP
PSPARRGMLGGGLGLVLSVGAVVLFDRFDDRLRTKEDAEEAFGLPVVAEIPLLRRRQRRNSEVVSAERPRSRIAEAYRGL
RTSVQYMGVVTSRVGESPSDLRRQQTKRRDRSDGTVVLVTSPGPAEGKSTTVVNLAAAYAESGSRVLIVDGDFRRPAVHE
FLPEADVGRGNGLAPVDAPDVSGLIGRSHIPGVSAITHLDERLESVQPADLLSWIRSTVQQARPTSDVVLIDTAPFLTVN
DARDLLDVADQVVVVARSGKTSRQSADRMSELLARLSAKVVGVVLVGSGDTPATKRYYYSKDPTSEPLPPPTDGQEQRGI
ESDELDALDAEGELPEVHPADR
>gnl|bykdb|A0A351ETF8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidimicrobiaceae bacterium] (length=569 residues).
MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLRAHLAIVRKYWWFTVLVVVCAVAVAFLLTQRQERIYST
SAQVLLRSSENSFLFPFPATGPLALNREGEIETLYVTSPAFTEAALLKSPPEVKVAAAGTGSTLTFNARGAVPEDLAAAA
NVWAQTYVTARYAETLAQNVESIEFLQALIAEIAEDRDAIRVEVDFYDDLLAETTDPDEYSRYLSQMVSIETLLQPQLAP
LEAQISEYQRQITEFESVARFLDSPDVSAQVSQLAEVPTIPVSPNVTRNLVVAAAFGMALGIALTYLREVINDKIEGARS
VEQATGLAILGTIPGYQLNSDQVVEVIERPKSLAAERYEAVLTAIEFASIGEPVSSVLFTSAVPGDGKTTTAVNVAALAS
KYMNVLLVDGDMRRPRVHRMLGVSNSVGLSDVLAGEATRRDARQVFERDGIRFDVITSGSKVQDPALLLRGDRWTSLADE
LFLYDLVIIDAPPVLAVTDAVLIGRAVNGQILLTRLGATKRSDLAEAAKLLATNGSRSLGVVVNRDQESPDKYSYYGQYA
EQTAETADA
>gnl|bykdb|A0A357ZCV8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Coriobacteriia bacterium] (length=243 residues).
MARHRKVGREQESPGSRSEVQNAAKTLYANIRFLSPDKPIKSIAITSSVPNEGKSTIALSLAQAIATSGQTVLVVDTDMR
RRSLAHYMRLKPSVGSYAVLTGLAKLSDAVVSTPIPNLFFLDTEPNIPSPTDVLSSKSFAKLVEVLESNFEYVIFDTPPV
GTFVDAAIIGTLVDGVIFVVRPKHTKRKEMAFAYDQLGKADVHILGACANYRESVASESYYAYYSADGKRVKDRPAADAA
SQL
>gnl|bykdb|A0A357ZDL3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Coriobacteriia bacterium] (length=286 residues).
MSKKNNKSFSNNHEIQNAIKTLYANIRFLSPDNPVKTIAITSSVPNEGKSTIALNLAQAIAGSGKTVLLVDTDLRRRSLA
MYLNLRAPSGLYAVLAKQVALNDAVMTTQAGNLFFLDAEAGIPNPVDILSSNRFKALVKTLREGFDYVVFDSPPLGPFVD
AAIVGALVDGVVMVVRPRHTKRKDLLFAYDQLKKSESRILGACASYNDRASADSYYAYYTVTGHRVRDKYNEDGAYEFLG
GEQESVKVEGLSAAVALDTAAPDPAADYVSLAGKGGKKKSKKSRRA
>gnl|bykdb|A0A359IQX7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium] (length=496 residues).
MLRVGTLETGRPMTLLDFVRMTRHNAWLLLASVVLGLVAAAGYSLTQPTLYGSVSTGIVVAGNSNSIGDATAGMVLAEQK
AAAYTILTGTRQVSQDVADGLRSKYGKDVPFSLSPGVTGGSVLFTVTAIAPTPSEAKDAADLGLTATADAAARLESLTTT
GTPGQSVVKLQPYISAAESPNPVSPNWKANLPIGAIAGLVIGYGIAFIRRSIDGRVRTQAEVEELTGAGVIGVIPKVAEL
EQQRVEEGQVSLGEASEAFRHLRTNLRYVNVDSPPKCIVVTSANASEGKSTVAANLARVLAESGQITLLVDADLRRPSQH
RTFDLDGSVGLTQVLAGDVSIDDAIQNSELANLKVLSAGRIPPNPSELVGSQRMHNLLIALSENRTVIVDAPPLLPVTDG
GLLTAAADGAILVMATGRTYKEQLRVCARILKQVNGRLLGSVMNLAPLRGIGAVVYGYGYGTYTYSSKYYRYARDTAQQR
GRRAGKPKADRPARAK
>gnl|bykdb|A0A372P1T1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbispora triticiradicis] (length=468 residues).
MELLYYARLMRRYWPLLLLSVLAGVGTAHVVTVNTPPKYLASITMLVSADARDGGLSTALQAGALSQQRVQSYATLLTSR
QVVGRIARGEDVTDLQARITADAIPDTTLLRATVADSVPVRAAARANTLGATFAALIDRIERPTPKSPPTIRVTVIDEAE
VPREPVAPQPLTNMALGALIALFAAVSGLVLRDRLDTTVKTAETLQKVARSSILGVIGYERDAKRHPLILRDQGRSSRSE
AFRSLRTNLQFIGVDRQPKSLVVTSCLPGEGKSSTSANLAITMAQAGWRVVLVDADLRRPSVPRYLGIEGGTGLTDVLIE
RARLHDVIQTWGQQGLSVLPSGRIPPNPSELLGSRGMRTVLAQLTEEYDMVIIDAPPLLPVTDAAALGAICDGALLVVRH
GKTRREQVLRAAELLSSINARLVGTVLNFVPAKHGSYYGYGYGYGYGYDAAAQEATPETPQPQAPIPV
>gnl|bykdb|A0A3E2DN22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium avidum] (length=523 residues).
MTIVDVVRILRRNLALLVICTLAGGLLGAVYQLTRSETFTAKATGMVVAGDSTSVGEAMSGNAIAQQRAATYTKLVETRT
MAQKTSEILKKHGMPEAANGQVSASVPGDTAFIDIKATGGTAKNAQALANAGLEALISEALRMETYGQIAASDHKSDAQL
AKMTSVHVLGYESAGLPSGDRGKSVALYVVAGLAAGFLIGAVVAVVRKQFDVKVRDQATIEELTGSGILSVIPDDKKLAE
QREKSIVHISGVTGEAFRHLRTNLRFANVDNPPRAVVVTSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
FGAEAGVGLSQVLAGDVTLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLTELRKRGYFVVIDAPPLLAITDAG
LLGAIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLTRVPRKKMGDVLYGYGAANYGYGSYYGDYGKRGYSSYG
SEEQESRESIAVVQEAQPAEGLVRVPKKDRADTDTEITPRRAK
>gnl|bykdb|A0A3L7ADK2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycetocola tolaasinivorans] (length=528 residues).
MDAETNPDIVNDNDRSLRDFVRMIRTYWMGALLIIALSIASGAVWTLFQPQVFEAKATGIVQAPRGNDPSNAYSSEALSK
SQAASYATVATSLAVAERVEKAGVVKQSAGVLLGRITALQPQDTVLIEITAKGPTGDSARTLADAWITAMSEQIEAIQGN
DGVIGAQNTKFVSVSKAATPNSPVSPNVIIALVLATITGTLLAIAYAVIRQHLDRRIRSADVLEQRYGTSVLGTIPMNPF
LRKGSQLLSQLTETSTESRHASFAMAESLRELRTNLSYVDVDNPPQVFVVTSPNPGEGKSTLSANLAETLAVNSGKNVVV
IDCDLRRPTLSKIFNAVEGAGLTDVLSGRAELQQVIQPCGDSEKLWILGAGRIPPNPSELLGSRAMKELLAALGEQSIVI
LDAPPILPVTDAVVLANSADGVVLVASARNTTYEQFGRAQQLIKRGGAHLLGTVLNRVPTSGQDAHQYGYYGGTYYANEE
TPATTATAQPSDESTVVEGDSATPIAAATPLAAPEEATSRRTVRRSGH
>gnl|bykdb|A0A3L8NYD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola sp. 4Q3S-7] (length=533 residues).
MEAARVTVVDFVRLTRVNWRVIFATFSLGLVAALLYTLHQPVVYTATSKGYVAVDSGDSVSDVYSATSLAQQKLSVYVGL
VSSTAVAQDVIDSLKLDETPSDIASRFSAVGDADNPQLTIYATASSPSQARDLANAVIGAMSTEAAKLESAARPSGAPVS
TLVKLVATQQAGAPSAPSSPDYRINLLAGGIAGIVAGYLLALVRRQLDSRIRTVDDMESLVGTSVLTILPESDELDRVGD
DGLVGSQTGPAAEALRQLRTNLRFVDVDKPPQSIVITSANAGEGKSVVTANLARVLAAAGQKTILLDGDLRRPMVSTIFE
LDPVVGLTQVLAGDIDLRATIQDPGLPNLDVIAAGRIPPNPSELLGSQRMQSVIEELVAADYMVLIDAPPLLPVTDAGLL
SGIVDGSILVLAVGKTYKEQARLAAKVLQQVGGHVLGSVLNRAPLGGIGGVVYGYGHATHSQDYYSAYDRTGGDRSNGNT
LRARFLYRRMRRREEREQAQREQTLRERTAARENEHGQPPVELTSIAGKRRSS
>gnl|bykdb|A0A3N1NLD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB93] (length=540 residues).
MTVVDFIAFIRRNWKILVVAVLVGVSAMAAFSAVSPKVYDSSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA
VYERIESDPEANPGGEPLNGRLTAAVAPGSTLIEVTASASTPENAAALANGALAALADVIADIETQSTADRTPQITVVPL
ENAEPAAAPTSPNWLRNLLLGAAGGLVLGFVLAILRRALDIRVRTVDDLTQLFGVGVLGRIPKMGKGRVGRRGDARAVDG
ITAEAFRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKLLGIDGAVGLSE
VLSHQIPVEDAIRPTATEGLFALPAGHIPPNPSEMLGSSAMRALIERLAEDYFVIIDAPPILPVTDASIVATVVDGVVFV
VASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVSAQDGDAGYSYYYDRKNPYYAEPDGGRSRGRSAGRRAAAEEPARSLP
AVRPAEPARAVEPERTRAAEPERTRVAEPERAVEPARSLEHVVRAAPKAEVPSSFRRPAR
>gnl|bykdb|A0A3N2FVI8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB127] (length=564 residues).
MTVVDFIAFIRRNWKIIVVAVLVGVSAMAAFSAVTPKVYDSSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA
VYERIESDPEANPGGEPLNGRLTAAVAPGSTLIEVTASAATPENAAALANGALAALADVIADIETQSTADRTPQITVVPL
ENAEPAAAPTSPNWLRNLLLGAAGGLVLGFVLAILRRALDIRVRTVDDLTQLFGVGVLGRIPKMGKGRGGRRGDARAVDG
ITAEAFRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVMADSGQRTLLIDADLRRPTVAKLLGIDGAVGLSE
VLSHQIPVEDAIRPTATEGLFALPAGHIPPNPSEMLGSSAMRALIERLAEDYFVIIDAPPILPVTDASIVATVVDGVVFV
VASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVSAQDGDAGYSYYYDRKNPYYAEPDGGRSRGRSTGRRAAAEEPARSLP
AVRPAEPARAVEPERTRAAEPERAAEPERAAEPERAAEPERAAEPERTRVTEPERAAEPARSLEHVVRAAPKAEVPSSFR
RPAR
>gnl|bykdb|A0A3N3ZPU0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria sp. M5W7-7] (length=504 residues).
MPQQDTSDEQYLDAPVHIAHRLRAVARAAGWYWKVALALIVLSVAAGAAIALLMPKVYSSTNTVMVVTGNSNTLGDYMTA
DSVSLSKADSYMQLGGSPEVAQIAAESLDGTPVHDVAFSVVPGTSQIKVEGRSDSPEGSAKVADAYAGALTQEVQRIESI
ATEGNNYEPPSPSPSEDGGEEASPESSEDGTGLVQVVPVSSASVPESPVSPDLRLNLLVGVGVGLLLAALYVLARSLFDR
KVRSSEAVANATGLAILGTIPLDKRLTAKRGVIPTAPPRKDREAWATSEAFRQLRTNLTFANVDDPPRTVVVTSSVAGEG
KSSVAANLAVTLGALGQPTVLVDADLRRPVQTELFGLTEGAGLTDVLAGAAELEDVLQDWEPGSNVHLLGAGRTPPNPSE
LLGSKTMRNLLARMGQDYMVVIDSPPLLPVTDPSVLAKGADGVVIVTQANKTNLDDLTKAVARLHTVGATILGAVLNQVP
RKGSGANEYGYYSDAYYYSSSSRH
>gnl|bykdb|A0A3Q9IY80 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium lemovicicum] (length=536 residues).
MELRTYLRILRAHWLGLIVLVVVGVVSAFGWTLLQPKVYSADASGIVAPVRTELSGNDAGSALVAENLAKAKVGSYLDLG
SWRAVAEHAIAELGLTSSPESLVNRVQVSNPTDTVNIRVVASASSPEGARDLAQAWIRAMATEVENLETSGGVSLATVQL
VPGDTARLPSSPSSPNVRIALALGALAGLVLGIAYAVLRYTLDRRIRSADAVEKETGLSVVGTIPDEKSFTADNRLLPVD
GISSGSHADLFGVSEAMRELRTNLQFMDVDNPPRIIVVTSPLPGDGKSTTSANLAITLAANGSKVVLIDGDLRRPMVATI
FRLVDGVGVTDVLAGRATVEDVAQRVGRKGNLLVLGAGKLPPNPSEVLGSERMKNLLRTLAKDYTVIVDAPPLIPVTDAA
VLSHSADGAIIITSVGKTTFEALTKALQNLERAGSRALGVVLNRVPRKGRGGYHDYRYAGDYYRSKGGEDGFDIDLTEDT
AGTMVSAGAPGAASTPSPSSATRPASGVTGSPAATGTATPTVVATDSTRRSRRSKR
>gnl|bykdb|A0A3Q9ULZ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium jensenii] (length=557 residues).
MTVIDFVRLLRRNLLLLVICGVVGMGAAAAYVFTRPVQYVAQSTAMVVAGDSSSVGGAMSGNTIAQQRASAYSTLIGTEA
VDNRVQKTLGSKGLSKAADGTLAAKVVSGTSFIKITATGSSALNAQSLANAALVGLQAEALRMETYTQAQANPGYTQAQL
EKLTAIHVLSYEPAGLPATPKQDNLLLYLALGLVAGLVVGSVIAVIRRMFDVKIRSQNDVEELTGRGVLAIIPEDRQLSK
QRKTGDLGLSGITAEAFRQLRTNLRFINVDHPPKAVVITSANPGEGKSTVGSYLARAVARSGQATVLVDADMRRPMQHTA
FGIDSRVGLSQVLAGDVSLSDALTPTDVPGLRVLVAGRIPPNPSELLGSVRMHNLISRLTKAGYFVVLDAPPLLAVTDAG
LLATSTDGVIMVHVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAPRKAMGDVLYGYGAGSFGYSSYNSYYTDKNGKKKR
RKKKMSLEEDYFGAVEPAPLGSHPTQDQPSSEGEQEDATSGGSQPSRAVRTNGSDTDQIPAGLRPVGPQPKPARRAR
>gnl|bykdb|A0A3R8RWC7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium paraconglomeratum] (length=575 residues).
MTIEDFLRLLLRNLLLLVAGLVLGAAAGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMAFQYQKAQSYLPL
FNTRAVGQRIVDELGLEASPDAVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEATAAEARELETGGNENAAVGV
QLTNYQNAVVPGAPVSPDREKFLLAGAAFGLLVALGLAWLRDRNDSRLRTADDVTDVVGLPTLGALPDAKELARGKDGVL
PEPASFPSREALRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTAYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYGALGGYDESAVVPDSE
EVDVEQAGGPAEPGPVSAPAAAVAAPDAPRPADTEAPRRAAQASPRPEAQPVAHPARAADESAPVEHDENEPEGDSAPAA
RTSPRGRRAASTWGR
>gnl|bykdb|A0A3S0V9U6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria sp. HSID16901] (length=470 residues).
MTLLDFIRLTRANIILLVVGILVGALVGYGTTLIQPKTYAATSSGYVTLGKSEDPTTGSAGEILSGDAAAQSKAKAYLPL
ITSAPVAQKIASSSKTSLDAAAIPSHLEPSVEDGSTLIRVRATASSPEDAVALANASLKATADTVNEIDGSRSVRVIPLD
DAQKPGSPVGPNVKKYVLFGAAAGLIIVYLVVFIRRFMDVRVRTTKDMEESTGLGVLGVLPKTNALDQNSFLEDAADHQS
AESLRQLRTNLRFVSVDQPPRSIIVTSPNPGEGKSTVTSSLAHAFAKAGQPTVLIDADLRRPTIAKIFGIDSGVGLSQVL
SGQVGIEEAIQRFHESELYVVPAGRIPPNPSELLGSAKMRKLIEELAREYLVLIDAPPLLPVTDGSLLSTSVDGAILVTK
VGSTRRDQAEGAKAMIDKVQGNVLGAVMNMAPAKGIGSQYYGFGYGGYRSEYKSYYGRSGQGSESAGTKK
>gnl|bykdb|A0A3S9JFL2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium acidipropionici] (length=544 residues).
MTVIDLVRLLRRNLALLLVCGLVGIAAAAAYVFTRPVQYVAESTAMVVAGDSSSVGGAMSGNTIAQQRASAYSTLVGTAA
VDNRVRATLNKQGLSKATDGTLSAKVVTGTSFIRITATGSSAQNAQALANAALVGVQAEALRMETYSQAQANPGYSQAQL
EKLTAIHVLSYEPAGLPATPKTANLPLYLALGLLAGLVLGGVISVIKRMFDVKIRSQKDVEDLTGHGVMAVIPEDRQLTK
QRKSGDLELAGIAGEAFRQLRTNLRFINVDHPPKAVVVTSANPGEGKSTVCSYLARSVARSGQATVLVDADMRRPMQHTA
FSIDSHVGLSQVLAGDVSLEDALNPTDVPGMRVLVAGRIPPNPSELLGSVRMHNLIARLTKAGYFVILDAPPLLAVTDAG
LLATSTDGVIMVNVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAPKKAMGDVLYGYGAGSFGYSSYNAYYTDENGKKKR
RKKRMSLEEDYFGRVELAPVNSRPTEDEPTPSRVTSSSASRSQENRPADLTPVGPRPRPARRAR
>gnl|bykdb|A0A412JBM5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Olsenella sp. AF21-51] (length=274 residues).
MMGMAMSHELKRESGHMRPACDRKLLTYDSPFAIREAYVRLRTNLMFCVNGDGDPCTTFLVTSGSPSEGKSLTAANTAIS
FAMLGKKTLLVDADVRKPSQQRLWAGRNTSTGLCKYLVGLGELGLASIEGIPLDIAFCGVIPPNPSELLSSTRMKRFLEA
SRKAYDYVIVDTAPINTVADAQILSPLVDGVILVALSQKSTRGELNAAIDSVSRAGGNLCGVVINGMDMKATKYSYRYKY
EDKYGGAKDYGYGYGYGYGNSGHRRQARGRSGQS
>gnl|bykdb|A0A419GS64 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gaiellales bacterium] (length=228 residues).
MAMKTKSRGSKYLYTKDFPASVLAESYRTLRANILLTNVDSEIGSVVVTSPDRGEGKSTICANLAIVMAQAEKRVLLIDC
DLRLPTQHELFQITLDHGLTRMISTYDEGDDPFAFGDQVMDGLTVIGSGPPPPNPSEIISSRRFRKFIKNASAAYDTVII
DTPPVGIVSDAAIISTMVDGTILVLDLKGGHRNMSVRAKKTLEKVNANILGLVMNNLKIDKDARPYQY
>gnl|bykdb|A0A420ZS11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinophytocola xinjiangensis] (length=236 residues).
MARKNKTNQPDMSEKQRSLITEFDQRSPVSEQFKTLRTNIQFSSIDRKLKTIMVTSSNPGEGKSTTVANLAVVMAQQHNR
VLLVDTDLRKPTVHFTFQVPNHVGLSNVVTGQSTLDEAALETSIPRLDVLPSGPVPPNPSELLASKAFERFVKSVSDAYD
YVIFDAPPVNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVANLKKVEAHLLGTVLNDRAVEKSNYYYYYTEGN
>gnl|bykdb|A0A433ECD0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HSID18069] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A433EDP2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HSID18067] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNAENGNTAGANASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A439DNZ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium elephantis DSM 44368] (length=423 residues).
MISYTELLMGETLAQRTIDKLDLEMSAGELQNKVKASSKLDTVLINVSVLDESPVRARDIADALSEEFVVMVRELETPPD
GTRPDARVIVEQRASIPKSPVIPKTARNIALGLALGLALGIGLAILRDLLDNTVKDRQNLEEITGVGVVGSIPLDKERKR
SPAKSLDNDNSAFAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPGEGKSTTAINLALVLAEAEHNVVLVDGDLRRPRLDKY
LGLVGSVGLSTVLAGRASLEDVLQETAFPGVTVVTSGAVPPNPSELLGSLAAKKILDELRTGFDYVVVDSSPLLAVTDAA
ILAAASDGVLIVARYGETKREQLAHAVGNLRSVGAPILGAVFTITPTRGGASDNYSYYGYSYGDGTSNSAVATTPRMKVM
RRLRRYRPAYQSPGTDPASENEN
>gnl|bykdb|A0A444BL03 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Phycicoccus sp. CMS6Z-2] (length=473 residues).
MTLLDFVRLTRTHLLFLVVLTLAGGAAAYGLTLRMPSVYLADASGYVRIDGAGASTGESIAANSLGGSKADSYLPLVTSR
AVAQRAITATGIDASPEDVARRVTGTVAENSVIMQVTATGPTPDESRRLADAVIKATAQEANRIETTGSNAKNIVTIVPI
ESALPGRRIAPDPPRNVLIGIGLGLLVAYLLVFVRRQLDTRLRSAQDVEAATGASVLGVVPVTSELRVQGGRGRLDHLGI
ASESFRQIRTNLRFVGVDDPPRSIVVTSANAHEGKSTVSSTLARVLGEAGQRVVIVDADLRRPTLAKVFEAPGSIGLSHV
LTDQVDLEDAFQPTDQENVRLITSGRTPPNPSELLGSARMHELVRELTVDNIVILDAPPLLPVTDAGVLSASCDGSLLVF
AVGRTHKEQAELAARMMGQVGGRVLGVVLNMAPKRRAGGVMYGYGYGGYASYASDTKTRKDYAKAASRGKHAE
>gnl|bykdb|A0A448PRK6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=510 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAASSNGGN
NATPNAENGNAAGASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRTRD
DAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLARSM
AESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLVRE
LSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGFGY
ANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A448USF4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVRASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A3TMH6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter sp. HTCC2649] (length=516 residues).
MTLNDYLKAFRRRWLVIALCAVVAGAVMWTVTPAHPEVTRSTGSYTATATLLVERTEDVNSQLGRIALFLTTGDIPRGAA
KRLGYPGDPALLAAGLTVKPEFIATALTVSATASDGARAAAVANAFADEAVSFFDTPRPGTGTVGITVLQSASPIPNADG
GGFVVPPSRPVRAALSAVLGLLLGLALALVLDRLDSRLRTREEIAAALALPIVAEVPRLGRTKRRDKTIGVAEQPLSPYA
DAYRGARTAIVHTASQRLSVGSAPRHLLDGPATQLEGARVVLVTSAHPAEGKTTTVANLAVSFAESGQRVLVLDADLRSP
DTHTLFDVPQGAGISDYLSRHNESSLEALIRPTSIDGVRIMTAGTRLSHPASLASLMGGLIAELRDLADVVLIDTAPLLA
ASDVFDVLPVVDTVVVVVRHGRITDVAGRRVAELLGRFHVPVTGVVIVGAPTRGAGRYGYGYGSGYGQGYDAERSKGIRR
VLPGRRGTTDGSSTPPHPAESEPGAESRRDRRTTSA
>gnl|bykdb|A3TMK0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter sp. HTCC2649] (length=518 residues).
MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYTATATILVGSKDPEATGSNLGRIALYLTTGEVPKR
AAAVVKFEGDPALLARGLTVTPDTVSQALMVSATASDGKQAAAVANAFANQTVLFIEQARRPGAENATLSVLQPATPIPS
ATTDGGFVVPPGRGPRTAMATLLGLLVGLGAALVMDRLDSRLRTRADIHSALRMPIIAEVPRLKRSQRNRATLGVLEDPL
SLYADGYRAARTALTHTAGQVMPGDYSPRRSAIEPRRPANTARLVLITSAHASEGKTTSVANLAASFAETGQQVLVLDAD
LRSPDAHNAFDVPQGAGISDYLTDPGEGSLSAVVRPTSVPGVRIITAGTSLAHPASLASRMGHLLEEARDMADVVLIDTA
PLLEASDVFDILPMVDTLLLVVRHGRLTEVAGNRVAELVGRFQVPVSGVIIVGAKAKLGDTYGYGYGDARKTKKKVKRGR
RLADQRRPAAPVVTESEPDDFLDDASRESRRTRRASSA
>gnl|bykdb|C6R548 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa ATCC 25296] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLVGAVAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|D2NP38 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|D8USQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa M567] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|E3B8H1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Dermacoccus sp. Ellin185] (length=558 residues).
MTILDLVRIIRTNLKLLLLSMLLGIVVAAGYTLTRPVEYQATSTAQIMAGASNDASAAMVNQQLANQRSGAYAQLASGSG
VADRVVALSKGALSPGDFVLAGAGSEGTSNLSLTASSSSAAKAQQAANLAPAALSQEIKHIETLNGAKSTVYDAYPLSRA
GLPASQTSPKWPVNLLIGAFLGLVAGTVLVVLRKQLDSRIRHTSDLEKVTGVGTLGVIPKAKNLQTKSRGGLGALGSTSE
AFRMLRTNLRYVSAEQPPRSLVITSAVQSEGKSTVASNLARVLAAAGQHVVLVDTDLRRPVIHETFDVDNAVGLTEVLTG
QASLRQAIQPGDHKNLSIITSGRIPPNPSELLGSRRMSAVIDALEEEYFVVLDAPPLLPVTDAGLLSVAASGAAVVYHHG
TTHKEQIALCTKILDQVGAHYFGSILNMTPPRSMGSTVYGYGAGNYATAGYGYGYGYGYGHTDESDEASALTPAHELADI
TLHAPESTPAAGPQVDRGNAGVPLDTTRHDPMRGESSQAPSASANVERAPRQATPATSDSDGAPPSRRARRFRANDDA
>gnl|bykdb|E3H5W1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLSYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|E6S8H2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Intrasporangium calvum] (length=519 residues).
MTLSEYLKVFRQRWLIIAITTLVAGAVMWVTSPAVADTSQKASSYTATATLLVTSTETDSESPMGRIALYLTTGEIPQRA
AAELGYTGDPAVLASGLTVTPDFSAGALTVAVTDAEGKRAASIANTFADETVTYFKKNRPGVGRANVSILQRATPIPNVT
GGGFVIPPDRTTRTALAAGLGLLLGLGLALVLDRVDSRLRTRSEIAAALRLPIIAEVPKMSRSLRRRRSIGVADEPLSPY
ADGYRGARTALVHTSSLLVQGDDRRPTSPPEPVSAASASLILVTSAHPREGKTTSVANLAASFAETGQRILVLDGDLRSP
DTHNIFDVPQGAGISDYLTGPDDTPLGSLIRPTNVPGVRIITAGTRLEHPASLASRMGGLLTEARGLADVVLVDSAPLLA
ASDVFDVLPLVDTVLLVVRSGRLTEVAGHRVSELLGRFQVPVAGVVVVGAQSKRSAGYGYGYGYGYGYGDKKKGKARKRL
PSSAVQGPPELSEERVPESRSARREASRKRSSRRTSSSA
>gnl|bykdb|G5ET14 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa M508] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSITAAAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGDSTA
ASPTGGNTVRVIPLNNASVNPPLVAPNYEQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQVGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|G9PHS6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces graevenitzii C83] (length=639 residues).
MTRVNLGFLILCVLLGLAGGFGYASAQPWTYTATSQAMVVVPGTDAFSQNSISGQKASVYAVLAGSQNVANRVAKTLKTS
NMEGTLSGSADAVPGLFTLTATASTPERARDIANAGIKAVSDEANAITTLNAPTVQPTTKTTTNPDGTQVTTTTQSVDGT
TNVTTTDNSYRETRVTQTLQAVAPSAPSSPDFYKLSGMGALAGLVIGYLVVFMRRLMDNRVRHNSDVEELLGSSVLAVVP
KSTELNAKGRQNVDGLGQAAEALRHLRTNLRFVDVDNPPRAIVMTSANPGEGKSTMSAVLAQMLASSGQRTVLIDTDLRK
PVVHKIFGLDGSVGLTQILAGDMQLSDVAQKIEGQPNLRVVPAGRIPPNPSELLGSQRMKALMDYLKDDAMVIMDAPPLL
PVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASRRNLGSVYYGYGYGGYGQNYYYYEEDEK
RKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRV
STVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
>gnl|bykdb|K6WHS4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia namibiensis NBRC 108229] (length=411 residues).
SASYQNSLASAQRVASYAELVDSDVIVSRALESTGVGLKQDEAKDSLSVSTSPDTVLLVVTAENANPDLAARLASGVSQA
LIEYVEVLEVPSAGGDPLAKLTVVSPATVDDAPVSPRYGRTVLIALTLGICMGIGIVVLVERADTRIRSEDSVLEVTELP
ILGDLPDDPAVDRNVVNFGVGGSPAAEAFRHLRTNLSFMDVDSPARMIAVTSPSPGDGKTTVALNLAASLAEAGHSVLLV
DADLRNPSVAGRVNLTGSVGLTTILSTGATLTDCIQHSSVAGLDVLPSGPIAPNPAELLGSRKASDVFGSLRDSFEYVVV
DTPPCLPVTDAQVVSRLVDGVLVVVRIDKSAKHELSDTTRQMDTAGVHAMGVVINGTPVRQSPYRFRYYGVNVENNADDM
SVDKVGTSSAS
>gnl|bykdb|N0E4U7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera elongata Lp2] (length=531 residues).
MTLRDYLTIARRRWPIIVACALVAAAVTWFLTPAQTDEAEVAPSYTATATLLVGSGGPPELVSIDRLALFIKTGEIPSRA
AKVLSFDGDPALLASQITVTPDPAAAALTIAASAPDGERAAATANAFADETVAFFEKGAPGTGGAAVSVLQVATPIPDQI
GGGFVVPPSRPLRTAMAAFIGLLLGFALALVIQRVDSRLRTRDEVHAALRLPIIAEVPRLSQAQKRKASIMVAADPLDPY
SDAYRAARTALMHTVSRKMTGDYTGRRAATAERGGTATGARLILVTSANAAEGKTTTVANLAASFAETGQRVLVLDADLR
SPDTHSLFDVPQGAGISDFITDPGDVPLEALVRPTSVPGVRIITAGTRLTHPASLASRMGHLLEEVRGMADVVIIDSAPL
LAASDVFDVLPIVDTVLLVVRSGRLTDVAAHRVAELLGRFQVPISGVVLVGARGRRADGYGYGYGHGDTKKRKGARSARV
EADRSLRPTRADASTQFAGSEDGARPFSPQADGAPDDAALSRRARRTSSSA
>gnl|bykdb|Q6ADE8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia xyli subsp. xyli] (length=250 residues).
MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLREVLQDPDVSLHTHIRVLTAGR
TPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTG
VVLNRVPRRGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPA
NRGRRAARHG
>gnl|bykdb|R4LD52 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinoplanes sp. N902-109] (length=468 residues).
MLAALVLGALVTVQTAPRYATSVTFFVTTPNTGVTDAYQGGLFSQQRVKSYASLLVSDRLAQLVAAEPGVGLDARHIRER
VAAQAVPETVLLQATVTDTDRDRSARIATVLAGQFKQLVESLETPPGKQVSSVKVEVVAGPELADAPVSPRPVRNLVLAA
LLGLLTGAAGAVLREVLDTTVKTVEGLQALAAAPVLAAVPFDDDAKEGPRALLGTGHSARAEALRQLRTNLQYVDVDRPV
KTLVVTSAVPGEGKSSTACGIAMLFAQAGQRVLIVDADLRRPRIAEYLGLEGAAGLTTVLAGKAAVDDVLQRYGDHLWVL
PSGFLPPNPSELLGSQHMALLMDELRTAFDTIIVDCPPLLPVTDAAVVAARADGALLLARSHKTTTAQVSNAVTALQSVD
ARLLGCVLNMVAAKGPDAYHYYDEYSTRGRGSRRAGPVAPVRVAVGRLPELMGAGRPGKERSKVGSAS
>gnl|bykdb|R7Y679 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia terrae C-6] (length=265 residues).
MFGRSRLGTRIRDEGDLDDAIGVHSLGVVASDGAFADRSLIDFRAGGSSTAEQFRKIRTNLTFANVDNSVRKILISSPSQ
SEGKTTTSLNLAASLAELGKSVVLVDADLRRPAVASRLQAVSPDIGLTDYLRGSAPVGDVLQRSGVGGFDVLAAGALPPN
PAELLGSRRTGQLLDELCELYDYVLVDSPPVLPVTDAVVVSQWVDGGIIVVRAGGTTRQELVASLAQLHASRVSILGVVL
NGVNLKARDNRYGYYAQASREGVTA
>gnl|bykdb|S3X7T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium sp. HGH0353] (length=426 residues).
MVLGGAVGEDGIAGGVLGIGRLHGYFHPIRDGLAHPSNTLDPTQPLATAHSYRLFRDPATTIARNIANSVISESSKQVKS
LEGKNSPVQVVMMTPADLSQAKKAPSPAKYIIAGLLAGIILGYAIALIRHLADRRIHTTDDITDRIEKPIFATIPTSSTI
ETLSTDLTDDFKAAEAIRKLRTNLRYALIDSTSKVILVTSSVMGEGKSSVAGNLAKVMALAGDDVILIDADLRRPKVQKN
FDLDDGLGLPEVLIGAAPLDQALRTTPTTDLSVLPCTDTPPNPSELLGSEHMSELLSFLAQDHVVIVDAPPVLPVTDSVI
LSQLADTVIVVAQVGHTTVDQVESAVSSIENAGGMVSGIVLNRADSSKLSHLRYGESAYGYGYTKYDSDYSSSPATASQP
TPQKQETSGSKSIPRRATSKHHNAHV
>gnl|bykdb|U1PLM7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces graevenitzii F0530] (length=638 residues).
MTRVNLGFLILCVLLGLAGGFGYASAQPWTYTATSQAMVVVPGTDAFSQNSISGQKASVYAVLAGSQNVANRVAKTLKTS
NMEGTLSGSADAVPGLFTLTATASTPERARDIANAGIKAVSDEANAITTLNAPTVQPTTKTTTNPDGTQVTTTTQSVDGT
TNVTTTDNSYRETRVTQTLQAVAPSAPSSPDFYKLSGMGALAGLVIGYLVVFMRRLMDNRVRHNSDVEELLGSSVLAVVP
KSTELNAKGRQNVDGLGQAAEALRHLRTNLRFVDVDNPPRAIVMTSANPGEGKSTMSAVLAQMLASSGQRTVLIDTDLRK
PVVHKIFGLDGSVGLTQILAGDMQLSDVAQKIEGQPNLRVVPAGRIPPNPSELLGSQRMKALMDYLKDDAMVIMDAPPLL
PVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASRRNLGSVYYGYGYGGYGQNYYYYEEDEK
RKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVS
TVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
>gnl|bykdb|U7V3Z1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia aeria F0184] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|W6JTW4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera australiensis Ben110] (length=529 residues).
MPLREYLRILLHRAPLIAGATVVAGLLSWFLVPAGTQNAPRSYTATAQMTVDGGEERVTVGLPRIAFFITTGDIPQAAAD
KLKYADGPFALARRIVVAPDPAASTISISATDPHATTAESIAQTFAEAAKAYFAKASPSGGTRLTIVQDAVAVPDANPGS
ILPPGRPTRTALAALIGLLFGMALAVFVDRIDSRLRSRTEIQAALGLPIIAEVPKLPRAKRSDAYHMVLDQPLSPFADAY
RAARAATTHSVETSRAAAPRGPRENDPEPQAVAVLVTSAQPSEGKTTSVANLAASFAESGRRVLVLDADLRSPDAHNLFD
VPQGAGISDYLVDSALEHLQQLVRPTNMPGVSIIVAGTQLDHPTSLASRMGPLLEEARGLADVVLVDTAPLLAASDVFDI
LPLVDTVLVVVRSGRITHAAGSRLAELLGRFKVPVSGVLLIGSKASRSRSYGYGYGYGSPRSTSKKPRSGGHGPRSAHGT
SASRRDRLGRAEAPSTIRGGGEARHDAAGPRPAVVEASPDDSVSDRSGG
© 1998-2019