BYKdb

Dataset for cluster tad of phylum actinobacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|I0UTA4 [Bacteria] Adaptator of bacterial tyrosine kinase [Actinobacteria][Rothia aeria F0474] (length=926 residues).
MYGAAIAFGTTLVVSNGIGPAGAGEFFRLMALFAIATSTAVFGADTGLVRTISAQNALGRYSAIPRLIRYAVLPPLALSL
GITAVACIYSVAVPMPHEYAVALRMSALFVIVAAVMSVYFGALRGLNHVVTFTVMQNVLLPTLRFGAIALVVFASGHLLD
LVFAWTLPVAATALLTLWVVESYMPRSKDRPQSEAAATTPQESAHSFWTFSSARGVATIVETILEWIDVLTVTTVLGPAA
GGVYGAVNRCVRVGTMVEHTGRIVTGPSISAALATQNIDRARQIFLATTRVLTAISWPFYLTLAAFGPTLLGFFGKGFEE
GAGILWVICPAAMLSMSAGGVQSILLMSGKSRWQLLNKLSSLAVAIILNVALVPLWGLYGAVTAWASALLIDTFLASYQV
FRLVGIRTSLTEMAPALTLGALVPLGCSFVVLTVVGQGLLGLVLYVILLAPSYVALLYYFRTQLGIERFLASRKGGGKGA
GTRSALAHQLSIQGENTMSKLSATTDAPAVSLREQLHRVWRHKMIVIITIVVCTLIAVAFSFLAPPKYTAKSSVLVNPLV
TDPAAGGNANSLKVDISTESRAAGSREVADKAADNLRSEGVDTDSKLTDKLMNSTKVVPTSQTAVLDIEVSDSNAKRSAQ
YANAIAKAYLEVRQNNLKETITDSVKKLDAQIKQLEDEDKNNNGNANSAKISQMRERRNQIQLTSTVGGRVLTEAQPPKK
ATGLGHRKTALAGVGTGLLLGVLIAYVYDRMMRTVGYSDRLKDLGIPVQTVRPRSSDEDTLLLMRRIGSPDGNLRASNIS
GIVIVSDSPALADQLHRQLYRTIPSGKAYFTDYPALSKVLEHYSPEQVIESNEIPMVINLADEAPLSTLLRLSEACRVCL
VPVGELSSRAQVRELFSHLRTLENTVSIAIFMDTDPEKEKVDGATA
>gnl|bykdb|Q1AUN7 [Bacteria] Adaptator of bacterial tyrosine kinase [Actinobacteria][Rubrobacter xylanophilus] (length=253 residues).
MSTDTTTAREAAPAGRDAFFSAKEFLKVLRRRAWAVVFVASALAASAVGFGLLQTPVYEASITILVGQKSGEEGPRNLSG
DVEGLQQLAQTVAEAVATRPIAEAAAQKLGLSEEYAQKTLLGNLRVEQRPGTMFVEVRYRDPDPQRAQRVANAVGEVFSE
RVSEVSPGANAITATVWEEAVAPETPVSPDPLLNGLVALALGLLLGLGLAFLLEYLDDSWESPEEVERVSGVPTFGVIPG
FQVKTSEKKKGGG
© 1998-2019