BYKdb

Dataset for cluster cd of phylum all

[Download (right click)] [Alignment] [Repertoires]

517 sequence(s)

>gnl|bykdb|I0UTA5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia aeria F0474] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|Q1AUN8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rubrobacter xylanophilus] (length=239 residues).
MVVRTSLRRRAREEQRKGDLSGRLITLHDPSDPASEAYRTLRTGLLYAVVDAPPRVISLTSPGPTEGKSTVCANLGVVLA
QANKRTLLIDGDLRRPSLHAVFDLRNINGLVNAITGERGLSEVLSEPLPNLRVCTSGPVPPNPAELLSSNRFAALVEEAR
QGFDYVLIDSPPVEPVADPLILATHADGVLLVLDAQRTRKGALRKALHDLRGVKANVLGTVMNNFDGKRGGYAYHGYTR
>gnl|bykdb|B7B947 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=406 residues).
SSSKNPVVQDLNNSLIAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLN
KREENELTQRMTESNARIIDPAAGSNAPVAPKAMMILLASVVLGCAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEI
PMRDKKDKNEVVVHENGRDSVSEAFRIVRTNMDFMRVKEKNMQVVMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLD
IRKGTLSSHVQVSDMGVTNYLSGRIDNVDEIIQKGELYDKLDIIHAGPVPPNPAELLLSDRLEALIAELRERYDYIILDN
VPAGVVADAVIVNRVADLTIYVVRAGRMDRRALPEVEKLYREGKLRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGY
GQRKKK
>gnl|bykdb|B7BDT8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=535 residues).
NQIAVSTSAFISDRLGVIEQELGNVDENISSYKSEHLLPDVQAAASMYMEQSSATNAQILALNTQLSMARYIRNYLTNST
SKNQLLPANSGIESPGIEQQIANYNTAQLRRNDLVANSSERNPLVIDMDQSLENMRHAIITSIDNHITTLNTQIRSLQQS
ERQTTARIAANPTQGKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTRVITPPSGSMIPTAPVKKNIALVAFAL
GLLIPVVIIFIRENMNSKVRGRKDLESLSVPFVGEIPLVGSGKKKKKTANTAKEIVIHQGKRDIVNEAFRVLRTNLEFIL
DAKEDKDKASVTLITSFNPGSGKTFLTMNTAATFAMKGKRVLVVDGDLRHGSASAYVGSPKKGLSDYLGKRENNCEDLIV
EKENYPGLFVLPVGTIPPNPTELLAEPRLAELIEKMRCRFDYILIDCPPVDIVADTQIIEKLADRTVFIVRAGLLERDML
PKLQSDYEAKRFKNMALVLNGTIGGSSRYGYRYGYRYGYKYGYAYGYGSKSYYNN
>gnl|bykdb|C2MBF8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas uenonis 60-3] (length=244 residues).
MIDQASRTFVVGRHRRSLVSEAFTVIRSNISFLAPDNGAPVKRILVTSAIPGSGKTFTSSNLALSLAQSGKRVLLIDCDI
RKNTLSKAIGMHCRGQLGLSSYLSDARITPEQIMSPSLQTESLIFLPSGPIPPNPTELLMSPRFEELLQYADEAFDYIVM
DTIPVLNLADTRVISHLTDITIMVVRENHLPRRLLHELEALYRDKRLKGLCVVLNDAGIGASAYGYGYGSYGYGSYGSYG
SEKE
>gnl|bykdb|A5V0I3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Roseiflexus sp.] (length=224 residues).
MNHTNGYADSPLIALRDPRSPAAEAYRTLRTNIQFSSLDKPLQTLLATSTAPDEGKSTTLANLAVTIAQAEQRVILVDCD
LRRPSLHTLFGLSNDIGLTNMILAHNDAPPPLQETGVPGLSLLASGPLPPRPADILGSRRMEAIIQRLRGMADMVLFDTP
PVIAVTDAAVLATRVDGVLLVLEAGRTRRDRARRAREILEKVKANIIGVVLNSARFDGEYGYYA
>gnl|bykdb|A7NQ71 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Roseiflexus castenholzii] (length=233 residues).
MNTTNDARAMNQTNGYAESPLIALRDPRSPAAEAYRTLRTNIQFSSLDKPLHTLLATSTAPDEGKSTTLANLAVTIAQAE
QRVILVDCDLRRPSLHTLFGLTNDVGLTTMILAQDDAPPPLQDTGVPGLSLLASGPLPPRPADILGSRRMETVIQRLRTM
ADIVLFDTPPVIAVTDAAVLATRVDGVLLVIEAGRTRRDRARRAREILEKVKANIIGVVLNGARFDGEYGYYA
>gnl|bykdb|A0NKF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oenococcus oeni ATCC BAA-1163] (length=595 residues).
MFSKKNPQKLSAKVLRSSRYGVPLVTVQDPQNVVAEQFRVLRANIDFAAASLKNFKTVLFTSAEMSDGKSTAAQNLAVTW
AQTGKRVLLLDADFRRPTLHKTFAVPNEHGLTTVLAMHEQPASAIHSTEIPSLYVMTSGPMPPNPSELLASDKMLRVVSW
MREQFDMVVIDSTPLLLVPDAQALIPRADGVVLVAMLNKTRRRSMATAANILKLAKANVLGVVSRDQRRADKGYGYGYTS
TNVMKTNDASKASSSKTAPAKPKVPKASVTDTDASKVEQQVPSDVKKEAAHSTAVAEKKTVTAASKTAPTSAPKSSWSSF
SYTSTGSEKSEASSKAKEPGPNNAQEISLVDIHAHLLPRADDGSDSMTTSLQLAKEAVREGIHTIIATPNQMDGRYINDT
DKVLSDVDNLNNTLKRIGIDLRILPGQEIHLSDQFLTAFDQGRLLTLADSKKYMLVELPNDSVPPVIHQVISKLREHKIT
MIVAHPESNLVLLNDPKELNKLARRGVLFQVTSSSINGFFGKQIADFSLAMLRRGFVTTIASETHGITSDQHYHLADAYS
IADKLIGEGKTNIIKQNAVRIVKGEPVDGTTIREF
>gnl|bykdb|A0PZ02 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium novyi] (length=234 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDRKVLLIDCDLRKPTVHKKF
HISNEKGLSNYLVGEVPFEEVVVNYNENLYLLPAGTIPPNPAEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEKSKKRRKSKK
>gnl|bykdb|A0RL70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A1ILY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A3CQY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGACGTYGGYGSYGNYGK
>gnl|bykdb|A3ICA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. B14905] (length=232 residues).
MLFKRKTKRIPMARKLITVSDIMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMTFLLHEVKEQYDIVM
IDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
>gnl|bykdb|A4ITF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus thermodenitrificans] (length=232 residues).
MAAKKRKKFQKAERNLITFDDPKSPISEQYRTIRTNIQFSFIDEPLRSLMVTSSAPSEGKSTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYAGLTSVLTNASPLSSALQDTSVENLTVLTAGPIPPNPAELLSSKMMDRLLRELNEMYDLVI
FDTPPVLAVTDAQILANKCDCTVLVVSSGNTETDAAVKAKELLEAANAKLVGVVLNQRKQREGSGYYQYQYK
>gnl|bykdb|A4J8V0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfotomaculum reducens] (length=242 residues).
MMLNNRLVVLENPKSPVAEAYRIARTNIQFAAVDKELKTLLITSSGPAEGKSTTAANLGIAFAQSGKSVIIVDADLRKPT
QHKVWEIDNIIGLTNILLGDTEIATALQPSPMKNLHIVTTGPIPPNPAELLGSQRMTALLTSFREHADIIIIDSPPIIAV
TDAALLAPQADGVVLVVASGQAKIETAQKAKQMLLNGKAKILGTILNMVEEDSQDYYYYYYYGEGSGDKKKGKKRGHKAA
CL
>gnl|bykdb|A4VTU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=231 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVV
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEKTGTPFLGVILNKYDIATEKYSEYGNYGKESLISQIT
>gnl|bykdb|A4ZGZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus helveticus CNRZ32] (length=262 residues).
MSLFKKKRGTDETIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASISEGKSTVAANVAVTYAQAGH
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQESGIDDLAILTAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGEEDKKKKGFFSRRKK
>gnl|bykdb|A5LJS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae SP6-BS73] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKIGEGKSTNSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|A5M4L1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae SP14-BS69] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A5YTT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|A5YTV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEISQKKLDLARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVVQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQQCDASVLITAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGSYGNYGRK
>gnl|bykdb|A5Z5P9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium ventriosum ATCC 27560] (length=227 residues).
MNKIKMDLTKELPYAVEESINRLRINVSFLGNEIKKIMVVSTMPNEGKSFVTLQMWKQMASAGIKSVFVDGDMRNSVIVN
KYGIEKEDGSEMEGLAHYLAEEFPLENVVYNTPLEDGDIIPNVENIINPSMLLESDKFGNMLNQLAEDYRYVFVDAPPLG
LVSDAEKIGSMCDGAILVIRSGETSKSEVKSSIKQLERSGCKILGVVLNRATDAKGKKNEKKYYNGK
>gnl|bykdb|A6BIG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena DSM 13814] (length=233 residues).
MEDMADIVLKKVIKDYRSSEAYKTLRTNIEFSGADKKVIVFTSCIPNEGKSTVTMGLAEALAEGEKRVLFIDADLRKSVL
VGRYKVTGKIKGLTHFLSGQSDAKDVIQKTQDSNLHMIFAGAIPPNPAELLNSRRFQALLASARKLYDYVIIDAPPLGSV
IDAAVIAKYCDASVLVVASKTVGHKFAKDVKEQLEKADCPILGVVLNKVSVSNSRYYGKYYGKYTGYYGEYKY
>gnl|bykdb|A6M2L9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=240 residues).
MKRYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAASFAQNEKK
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A6YIA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDAFYFMDEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSIDKYGSYGNYGNYGKNKK
>gnl|bykdb|A7VF42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. L2-50] (length=243 residues).
MKKLSIDFNEMPYAIEEAMNRLRINIKFCGKNTKKLLITSSLPNEGKSTISINLWKMMAEAGFPTVFLDVDLRKSVIKGR
HNMKSESEIKDLGYYLSGQAEYEDVVYETNIPNAYIVPCCNLLENPSALLEDARFAELLDKLAEQYRYVIIDSPPLGSVA
DAAQVASLCDGAVLVVRSGETSRNVIRQSMQQLEQVNCRLLGVILNRVEASGRAYKSYYGKYGKDYGYGYGYGEKKYSGK
KEK
>gnl|bykdb|A7Z921 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus velezensis] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A7Z9K0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus velezensis] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAAEVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A8AZR3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=231 residues).
MPILELSNNKKQSIQKTEEYYNALRTNIQLSGEDIKIVAVTSVQPNEGKSTTSTNLAIAFARAGYTTLLIDADIRNSIMS
GVFKSKEKITGLTDYLVGKNDLSQGLCETDVPNLFVIESGQSSPNPTALLQSKNFDEMMNILRRHYDYIIVDTPPIGLVI
DAAIISQKCDASILVAEAGSVKRKALQKSKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
>gnl|bykdb|A8FHL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYEMVIV
DSAPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLDGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A8RK85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium bolteae] (length=266 residues).
MDEILHLKNTGRKDYFYEEAIKTLRTNIQFCGSGLKTIMFTSSMPDEGKSETAFALASSFGNIGKKVLLVDADIRKSVMV
KRYEIKGNPNGLSQYLSGQKSLEEICYETDMENLDMVLSGPFSPNPAELLEDELFKTMIESVKEIYDYIIIDTPPMANVI
DGAIIASQCDGAVIVIESGAISYRLVQKVRSQLEKSGCRILGAVLNRVGGGYEHSYYEKYYGRRGGKYYGKYGRHYGRYE
EGKAPPVNEVSGARIKNDTTAQSQDT
>gnl|bykdb|A8RSK9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium bolteae] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGNGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKRVVMIDADIRKSVLV
SRYQLEHEVPGLSQYLSGQRPLEHVLYDTNIENLSIIFAGPYSPNPAELLEESLFSDMISKLKEKYDYVIIDTPPMANLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYGKYGKYSKYGHYGKYDRYEK
AEA
>gnl|bykdb|A8SQS8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus eutactus ATCC 27759] (length=247 residues).
MKKLNVEFQELPYAVEEAMNRLRINIKFCGKNTKKILITSSMPNEGKSSIAINLWKMLAEAGFPTVLVDVDLRKSVIKER
HHINNTEKLQDLGYYLSGQAEIEDVVYETQVENAYIVPCMNLLENPSALLEDARFAEILDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAVLVVRAGETSRNLIKQSFQQLSQVGCTLLGVILNRVETAGRAYKKYYGKYGKYYKQYGYGEYGRYGQE
AASSKDK
>gnl|bykdb|A8U9F4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp. AT7] (length=235 residues).
MFNKKKKQLDTSERPSLVTLTRPSSVIAEQFRTIRTNIQFSMVDKNLKTLVITSAGPGAGKSTISANLAVTFAMQGKKVL
IVDADMRKPTVHKTFRLPNRDGLTTLLTERDVEIKDIAHRLETEGLFVITSGAIPPNPSELLASNRMNKLITEFEELFDL
IIFDMPPVIAVTDAQVMSSKADGTIFVITKNGTDKEMVTKSKELLEKVKANVIGVVFNRVELKGDNYYYYYGEGE
>gnl|bykdb|A8YPQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A8YX89 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus helveticus] (length=266 residues).
MSLFKKKRGTDETIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASISEGKSTVAANVAVTYAQAGH
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQESGIDDLAILTAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGYGYGEEDKKKKGFFSRRKK
>gnl|bykdb|A9QSJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAATGKSTESANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A9VRC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus weihenstephanensis] (length=234 residues).
MALNSLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYD
LVVFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|B0GAL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea formicigenerans ATCC 27755] (length=265 residues).
MMQENEKQARTTYTNAQAKAAMSRRDNKASKLRVELTDPRKSNYFYEEALKTLRTNIQFAGADIKTILVTSCFPNEGKSD
VVFQLAKEMGMAGKKTVLLDADIRKSVLVQRYLVDSDVKGLSQYLSGQAPVRDILYGTNYENMDVIFAGPMAPNPSELLN
GKVFAKLMIELKQRYDYVLIDTPPMANVVDAAIVGKVCDGAILLIESGFVGYRAAQKAIKQLEKSGTHMLGAVLNKVDAR
KEKYYSYYSYGSKYGYGYGQNHENA
>gnl|bykdb|B0K4N1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter sp.] (length=235 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTV
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|B0KAR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter pseudethanolicus] (length=235 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTV
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|B0P2G2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. SS2/1] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLTPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYSYYGESDTEKNHPNT
>gnl|bykdb|B1B736 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum C str. Eklund] (length=237 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
NISNIKGLSNYLVGEVSFEEVAVKYNENLYLLPAGTIPPNPAEMVASKTMRNFLESLKETFDYIVLDTPPVIAVTDAQIL
STVVDGVLLVTASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGNEEEKSKTSKKRRKNEK
>gnl|bykdb|B1BNH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens E str. JGS1987] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
GISNSVGLSEFLIGKVEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVIEAVKGLRAVKANIIGTVFNGEETQRGKYYHYYKKD
>gnl|bykdb|B1BNK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens E str. JGS1987] (length=225 residues).
MFLVDKDPKSIAAESYRVLRTSLEYSSIDKELKSIVVTSSEPGEGKSTVARNLASIIAQNNKKVIIIDCDLRRPTIHKKF
GISNSIGLTEYIIGKKDLNNVIQILNENFSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
AGKCDGTILVVRAESTSKESIIKAYKELEKVRANVLGSVLNGIKGNNKIYYYAEDNKKKKLKVRS
>gnl|bykdb|B1HR41 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sphaericus] (length=232 residues).
MLFKRKTKKIPMARKLVTVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNVFGLSSVLSRQATLQEVIQATFVDGVEIISSGAIPPNPTELLASETMTLLLHEVKERYDIVM
IDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSILTIAKANILGVILNNYKMKGSTYEQYYGKE
>gnl|bykdb|B1I967 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTAPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|B1MZT1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc citreum] (length=251 residues).
MAFFKKNKALGDGLSAETMTKGARLIAAAEPKNPVSEQFRTLRTNIDFASVAKGNVKTLLVSSALPSEGKSTITANLAVV
YAQQGKRVLLVDADLRRPTVAITFDVTDNHGLTNYLADAHSELGSIIHHTRMDTLDVITSGPVPPNPAELLASARMTTLI
TQLRDHYDLVIFDVPPFLMVTDAQVLMSRMDGVAIVVSGGRTTKGALQRTSEILKIAEAPVVGFIYNDQDQKKKAGSGYG
YGYGYGYGDAK
>gnl|bykdb|B1R3V1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens B str. ATCC 3626] (length=226 residues).
MWESKGGKWMLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDL
RKPVVHKNFGISNSVGLSEFLIGKVEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPV
NAVTDSKILSTKVDGTILVVKYGYTKKDAVIEAVKGLRAVKANIIGTVFNGEETQRGKYYHYYKKD
>gnl|bykdb|B1R3X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens B str. ATCC 3626] (length=225 residues).
MFLVDKDPKSIAAESYRVLRTSLEYSSIDKELKSIVITSSEPGEGKSTVAGNLASIIAQNDKKVIIIDCDLRRPTIHKKF
GISNSIGLTEYIIGKNDLNNVIQILNENFSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
AGKCDGTILVVRAESTSKESIIKAYKELEKVRANVLGSVLNGIKGNNKNYYYAEDNKKKKLKVRS
>gnl|bykdb|B1V0N7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens D str. JGS1721] (length=225 residues).
MFLVDKEPKSIAAESYRVLRTSLEYSSIDKDLKSIVVTSSEPGEGKSTVAGNLASIIAQNNKKVIIIDCDLRRPTIHKKF
GISNSIGLTEYIIGKNDLNNVIQILNENFSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
AGKCDGTILVVRAESTSKESIIKAYKELEKVRANVLGSVLNGIKGNNKIYYYAEDNKKKKLKVRS
>gnl|bykdb|B1V1Z4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens D str. JGS1721] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
GISNSVGLSEFLIGKVEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVADSKIL
STKVDGTILVVKYGYTKKDAVIEAVKGLRAVKANIIGTVFNGEESQRGKYYHYYKKD
>gnl|bykdb|B1YMM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sibiricum] (length=231 residues).
MAKKNKMNKDARNLITVTQPKSPVAEQYRTIRTNIEFMAVDREIQVILVTSATQGEGKSTTSSNLAVAYAQQGKKVLIID
TDMRRPTVHYTFRVANGLGLSSLLTRQADLGKAILPTKVDNLSILTAGPIPPNPAELLSSKAMETLILKLRDEYDIIVLD
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|B2GF33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=247 residues).
MGLFKHRYTESTDTMDNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMKSLINGV
RDAYDLVVLDVPPMLQVTDTQVLSGSLDGVVVVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
YGYEDER
>gnl|bykdb|B2ILP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|B3XL23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMRTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
GYGYGEDAGK
>gnl|bykdb|B3ZRD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus 03BB108] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|B5UQ73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus AH1134] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|B6W7H4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus hydrogenalis DSM 7454] (length=218 residues).
MAKKHGYYNTTSVFDEAIRSVRTNIQFSDIDNKKRVIAMTSSKPSEGKTTVLYSIAKSFAENGNSVVLLDFDLRMPKVGK
VAGIETNMGLTNVITGKVELDRALIKDQYEDNLFVLLSGPVPPNPAEILASNHVKELIEELSQRFDYVFLDTPPVGLFTD
ASIVSTYCDGVIFAIKSNDTKKDEVSHALENLNKVKGKVLGAILTFADLSESSYKGYY
>gnl|bykdb|B7HFH1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MVLNLFKKKQNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQKTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|B7HXB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|B7IQS8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSEHLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|B8D0N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halothermothrix orenii] (length=217 residues).
MVNYSRYTNDPALEAYRLLRANLEFVAKKNEARTVLITSTGPGAEGKSTISVNLAFAFAEIGKRVMLVDADLRKPRLHKI
LSINPDPGLSDILKGQTTPTEVTRKYLNPHEIEIVPCGTREKKSAPIIDRLSFTRLLKDLSNNRDLVIVDSPPLVISDSL
SMAASVDGVILVVSIGESNKRGFRDGLKMLENAEANLLGIVANKIPHKQKEYYYSYY
>gnl|bykdb|B9DUJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus uberis] (length=245 residues).
MAQLELVRSKQELYTRAEEYYNSIRTNIQFSGRDLRVIVLTSVQPNEGKSTTSVNLAVSFAKAGLKTLLIDADIRNSVIS
GTFKADEKYEGLSSYLSGNADLSSVISHTSVENLMVIPAGQVAPNPTTLLQNNNFNYMIDTLKEVFDYIIIDSPPIGLVI
DAAIIGQKADGSIIVTQAGAIKRRFIQKAKDQMEQSGALFLGVILNKVEEVIDSYGGYGAYGAYGNYGNYGKEDSKSKKK
NRRRK
>gnl|bykdb|B9IRQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
IIFDLPPILAVTDAQIMANVCDASILVVRSELTEKETAVKAKALLESAKGKLLGVVLNDREREQSLYYYYGTN
>gnl|bykdb|B9Y884 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Holdemania filiformis DSM 12042] (length=251 residues).
MLRVGEELITILDPESSASEAYRTLRTNILMRNFDRDMKVINIISTTAQEGKTTCVLNLAMVYAQLQKKVLVIDLDLRMP
TIHKKLKLKNKKGISDIIGHQAEFEEVVLQPYENVDVITAGTKIPFASEFIQSNALKEFIEERKKEYDLILLDCPPVGLV
TDGIVAASYCDGTILVCASNRNDRKELLRVKDQFEQTQVNVIGIVMTMMPVQRKYYNSYGYRYSDSQKKTAQKKKKNSIM
SSITKKGDKKK
>gnl|bykdb|C0C0F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] hylemonae DSM 15053] (length=231 residues).
MMEMQEIYLKNMTKDYRSNEAYKTLRTNVEFSGADNKVIVFTSCTPNEGKSTVSLSLAQSLAEGGKRVLFVDADLRKSVL
MGRHKVNGDLKGLSHFLSGQSEVDDIIYKTQEPGLMVIFSGVVPPNPAELLGNKRFSSFITSARKIYDYIIIDAPPLGSV
IDSAIAAAVCDAAVLVIAANAISYKFARVVKEQLEKSNCPILGVVLNKVNMKQNKYYGKYYGKYYGEYGKK
>gnl|bykdb|C0CK73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia hydrogenotrophica] (length=227 residues).
MQAKIVLPNEELEYGAAEAIKTLRTNIMYSEDVKAIMLTSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRR
LGIQEKIQGVSEYLSKQSMKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAI
ISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKYYSYEYKKEK
>gnl|bykdb|C0CZV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] asparagiforme DSM 15981] (length=244 residues).
MRQTVALNRSMKDDYHYNEAVKTLRTNIQFCGSGIRVIMMTSALPDEGKSDMAFALASSLAQIGKRVLLIDADIRKSVLV
SRYQLEDEVCGLSQYLSGQKPLEEIRYATSVENLHMIFSGPYSPNPAELLEEELFGALIRQMRQEYDYLIIDTPPMGNLI
DGAIVARQCDGAVMVVESGAVSYRLEQRVKNQLEKSGCRILGVVLNKIDPEYNSYGYYTRYGKYGKYSRYEKYAKYDKSE
ITEG
>gnl|bykdb|C0EBA6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] methylpentosum DSM 5476] (length=234 residues).
MSINHKKHTHLDVVLGKTSPFAITEAYKTMRTNLSFALADAKNKRVVITSSLPNEGKSTTATNIAITLAQTGKKTLLIDA
DMRKPTQYKIFRLTRGNGLSSLLGGFTKPENTIVEDVRENLDLITSGPIPPNPTELLSSSKMRELLEELNKTYEYIILDT
PPINIVSDALALADICAGVVLVIRQNQTKHETLQKAIKSLEFAEMKILGAVVTHAGNERKSRYYRYMKYKSYKE
>gnl|bykdb|C0GGR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dethiobacter alkaliphilus AHT 1] (length=237 residues).
MKKKKRKTNTHATDNYLDKLITSKNAKSPVSEAFRTIRTNIEFSDIDKDKKTLLTTSATQGEGKSVVTANLGVTMAMAGK
RVLILDADLRNPTMHKIFNVRNNVGITNLLLNGSISLEETLVSPRPNLYFLPCGPLPPNPAELLGSKKMRDFITSLEEHF
DIILVDAPPALAVTDASVLASYLDGVILIAASGQAPLEQVVAAKEQLLKVKANILGVVLNKVPQGNGSYYYHYHYGQ
>gnl|bykdb|C0WV35 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus buchneri ATCC 11577] (length=247 residues).
MNIFHRKRKKLSTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKTLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYDNEGK
>gnl|bykdb|C0WW26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum ATCC 14931] (length=245 residues).
MGLFKHHYTESIDTMDNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVMANVAIAWAQEG
KQVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSFINGV
REAYDIVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYG
YEDER
>gnl|bykdb|C0ZHV8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Brevibacillus brevis] (length=231 residues).
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKLMQTILVTSPGASEGKTITAANLSLMMAKDHKKTVLL
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIV
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAVKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
>gnl|bykdb|C1CBD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=224 residues).
MPTLEIVQKKLEFIKKTEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNIENLFVVQSGAVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGVVI
DSAIITQKCDASILVTATGEVNKRDVPKAKQQLEQTGKLFLGVVLNKFNVQHEKYGSYGNYGKR
>gnl|bykdb|C1CCB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|C1J9I3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=252 residues).
MMQLSFSKLFHRHQEDQETQKNGVMLVAFAEPKHVVSEQFRTVRTNIEFAGAALDRCQVVMFTSSAMSEGKSTVSANVAV
TWAQAGKKVLLIDADLRRPTIHATFRTLNIDGVTTILIGKDEAGAVVEETFVDNLSVITSGPIPPNPSELLNSKRMANLL
NWARENYDIIVLDTPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLRRTVEVLKLANAKILGSVERVKAKHGDRGYGYG
YGYGYGTNTGKK
>gnl|bykdb|C2CI44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus tetradius ATCC 35098] (length=217 residues).
MSKKNSYYSASMYDEAIRSVRTNIQFSSLDKKNKIIAVTSTKPSEGKSTVIYKLAKSFADNGERVILIDCDLRSPSLYEI
AGINDNVGVTNYLTGKVSIQRAINKDRDQANLDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFTDA
SIVSTLCDGVIFVIKSSDTKKEDITLALDNLKKVDAHILGAVLTYVPMKDKRYGNYY
>gnl|bykdb|C2EFR6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius DSM 20555 = ATCC 11741] (length=237 residues).
MEIMVKVRANGERGCEWMQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGK
KALLIDADLRKSVSRQLIRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEK
FDIVIIDTPPMGSVIDAAVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
>gnl|bykdb|C2EPK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus ultunensis DSM 16047] (length=273 residues).
MSLFRRKRGTNETIEKGAKLITVAKPKGPVSEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTIAANVAITYAQAGR
KTLLIDGDLRRPTVHTTFNLSNHVGLSTVISSSAKEVDLDKVIQDSGVKNLSVLTAGPMPPNPSELISSKRMHDFIDLTE
EHYDLVIIDLAPVLEVSDTQSLARHLDGIILVVRQGHTQKLAIKRSVEMLRFAKARILGYIMNDISSDNAGYGYGYGYGY
GYGYGYGYGYGYGYGYGYGEEKKKKSWFSRLKK
>gnl|bykdb|C2EWM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus vaginalis DSM 5837 = ATCC 49540] (length=253 residues).
MSLFKKKTNASNETIRYGAKLITVKDPKNVISEQFRTIRTNISFMGIDHPIKTLAFTSANISEGKSTVTDNIAVVWANAG
KRVLLIDADLRRPTLHQTFNISNREGLTTILTSDALEMDITNMIKETEIDNLSILTSGPIPPNPAELLNSQRMQALIASV
EQSYDVVILDVPPILAVSDTQALVSHLDGVVLVVKMGQTEKAGLKRSVELLKLAHANILGYVMNDVGRNGDSAYGYGYGY
GYGYGYGYSSDNK
>gnl|bykdb|C2JZS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus LMS2-1] (length=250 residues).
MTLKFKKLFSHNHVDQETQKNGVFLVTFAEPKHVVSEQFRTVRTNIEFAGAALDKCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLVDADLRRPTVHATFRKLNLDGVTTVLTGKTKPDEVVEDTFVDNLSVITSGPIPPNPSELLNSKRMGQLLD
WTREKFDIIVLDAPPVLAVSDVQVLVPRSDGVVVVANMGKTLKGDLKRTVEVLKLAKAKILGSVERVKARRGDKGYGYGY
GYGYTTENQR
>gnl|bykdb|C2KHF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc mesenteroides subsp. cremoris ATCC 19254] (length=479 residues).
MSFFKKQSSVGKYGLSVETMAKGARLITAAEPKNHVSEQFRTLRTNIEFAAVSRGEIKTLLISSALPSEGKSTVSSNLAI
VYAQQGKKVLLVDADLRRPTVAVSFGLNRNSAGLTNCLGDSHKEISDVVHRTAMDNLDVITSGPIPPNPAELLGSGRMTE
LVTQLKSQYDLIIFDVPPFLMVTDAQVLMSKVDGVAIVVNGGKINKGALKRTNEILKIAEAPVLGFIYNDQSRRKKGSYG
YGYGYGYGYGYGDTKSKWLINRHDRERRKRLMVYRRFLKRFFDLLLAFFLFLILLLPLLIIALIVKLTSKGPILFIQERY
GRNSRPFKLYKFRSMTDSAPQIANSKFTDIQNYITPFGMFIRKTSLDELPQLWNIIKGDMSFIGPRPLAKTDERVLSLRK
QNGADQVLPGISGLAQVNGRNNLSDEDKASYDAKYTEYLSFRIDMLLTFKTFVSVLKRDGVFKEVTLKREEGLKKIHDL
>gnl|bykdb|C2LSE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius SK126] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGTQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVAKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|C2MTG3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus m1293] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVENLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSTYDLVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGLLESAKGK
LLGVVLNDREREHGLYYYYGAK
>gnl|bykdb|C2NQN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus BGSC 6E1] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2P8H3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus 172560W] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNILGLTNVLTNSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|C2PN22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKVLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2QJY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus R309803] (length=182 residues).
MITSAKPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQTDNIFGLTNVLTHSERLEKCVQMTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKGLLQSAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2RG49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus m1550] (length=188 residues).
MNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDN
LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLL
ESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2SBU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus BDRD-ST26] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSTYDLVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2SSX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus BDRD-ST196] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|C2T8T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus BDRD-Cer4] (length=188 residues).
MNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDN
LSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLL
ESANGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2ULR6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus Rock1-15] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|C2V4M2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus Rock3-28] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLSFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGK
LLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|C2WVG6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus Rock4-2] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2XJH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus F65185] (length=182 residues).
MFTSANPSEGKTTTTANIAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2Y452 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=182 residues).
MVTSANPSEGKTTTTANIAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLSLSERLEKCVQTTLVDNLHFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C2YZB2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus AH1271] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQATLVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSLYDLVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C3EBC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar pakistani str. T13001] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C3GBJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDLPPILAVTDAQIMANLCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C3GRR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLAC
GPIPPNPAELLGSKSMQELLAQAYSLYDLVIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|C3H979 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] (length=182 residues).
MVTSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLAC
GPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGK
LLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|C4VP08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus jensenii 269-3] (length=254 residues).
MALFRKKRGTDETMHYGAKLITIAKPQSQITEQFRTVRTNINFKAIDHDINTLAFTSAAISEGKSTVAANVAITYAQSGK
KTLLIDGDLRRPTVHSTFSLSNRRGLTTILTSNNNKFNLDDFAQESGIENLSILTAGPIPPNPAELMGSKRMKTFIDFIK
SYYEMVIIDLAPILEVSDTQELARELDGVVLVVRQAKTQKQAVKRAVEMLEFAQAHVLGYIMNDVKSEDAGYGYGYGYGK
ENKEKKSLFLWLKK
>gnl|bykdb|C4Z672 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium eligens] (length=233 residues).
MQEFSVKKSYLDFRTREAYKMLRTNIEFSGDNNKVIFITSTTPGEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
WRKGKIKYGLTHYLSGKNELTDVISVSDEPNFCMIFAGPVPPNPSELVGNDRFAELIESARETFDMIIVDTPPIGSVIDA
AVMSKFCDGGILVIGAGDISYKFARKSKEQLDLVGCKILGCVLNKVDMAGNSYYGRYYGKYYGKYYGKYGEES
>gnl|bykdb|C4Z8M5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Agathobacter rectalis] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
>gnl|bykdb|C5D961 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp.] (length=232 residues).
MARRDRKKIQKIERSLITMEDPKSPISEQYRTIRTNVQFSFVDKTMRSIMITSAGPGEGKSTTTVNLAIVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYMGLTNVLTNSAPLLPSCQETSVENLYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLI
FDTPPVLAVTDAQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRYK
>gnl|bykdb|C5EN03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 1_7_47FAA] (length=249 residues).
MKQIITLNREMKDDYHYNEAIKTLRTNIQFCGSGIRTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMIDADIRKSVLV
SRYQLDTEVYGLSQYLSGQKTLEEVLYDTNVENLSMVFAGPYSPNPAELLEEDLFGKMIDTLKKEYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKSQLDKSGCRILGVVLNKMSMERSGYYSKYYGRYGKYGKYSKYGKYGKYGK
YEKYEKANA
>gnl|bykdb|C5NWJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemella haemolysans ATCC 10379] (length=234 residues).
MAQINLLTNQKIVDPKNEEYYNALRTNIQFLGKDKKVIAITSTSENEGKSTVSTNLAISLAKLGLKTILVDADTRKSVMA
GRFKFKHKISGLTNYLSGVSPIEDVIYETDVEHLNVIPAGQVPPNPTGLLQNKNFNIMIEVFREYYDYVIIDTPPIGQVI
DAAIIAPKTDGVVLLVEANRVKKKSIEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYGHYGSYGIKGNKDKK
>gnl|bykdb|C5QNG4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus caprae M23864:W1] (length=231 residues).
MMAEKRKKLEQPLFVNDKPKSIISEKFRGIRSNIMFSRAKDEIVSIIVTSEKPAAGKSIVSANIATTYAQAGYRTLIIDG
DMRKPTQNYIFEEANYDGLSNLIIGKSDYDKAIRSTRVPNLDLLTSGPIPPNPSELIDSDRFYEIYNELLRRYDFVLIDT
PPVNTVTDAQVFLQYVKDAIIVIDAEKNNKYEVKKAKSLIEKADGKIIGAVLNKTPRDKSSSYYSYYGEEE
>gnl|bykdb|C6CS80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp.] (length=228 residues).
MSRSDLKLRPVVADANPTSPISEAYRTLRTNLQYAETDRPLQLLMVTSAGPEEGKSTTILNLAVTYAQMERRTILVDADL
RKPTSHYNFGLSNRTGLSHVLSGQADLSEVIKETRIKGLDVLPSGPVPPNPSELLGSSRMEELLGKLREQYDMVLIDTPP
VLAVADAQVVANKCDGVLLVVNARTGKKQHAIKAKNALKFVQARIVGIALNQTAHREAGPYYEYVDRT
>gnl|bykdb|C6CSC8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp.] (length=230 residues).
MSQSENKRRLISVANPRSPVSETYRTLRTNIEFAAIDSALQVIMVSSAGPGEGKSTTIANLAVTFSQSDRKVVLIDADMR
KPTAHKTFQISNRFGLSSVISQQSTLQEVIQATDIPNMDVITAGPIPPNPAEMLASKRMTALLDELRTMYDIVLVDTPPL
LAVTDAQIAATKSDGVVLVVDQGRVKRQFAQKAIQNLQNVNARILGVVLNNVKRRSNEEAYYYYYSADVK
>gnl|bykdb|C6CW37 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp.] (length=229 residues).
MSMRRSTSDNRLVVLLNPSSPVAEAYRTLRTNIQYSSVDAPIQLLMAASAQSGEGKSTVISNLAVAYALEGKRVLLIDTD
LRKPTIHRIFSQTNRQGLTNLLTSQSTLQEVIKDGGIDNLEIITSGPTPPNPAELLGSHRMKVILEELRARYDLILFDTP
PVLPVTDSLIMSSYCDGVLLVIHAGKVKKAYVRKAKERLDFVQSRIIGAVFNQMKRQDIAFVKYYGTSK
>gnl|bykdb|C6LCS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marvinbryantia formatexigens DSM 14469] (length=226 residues).
MANINIDTMTKLSFRVSEAYKSLRTNITFCGKDCRVIAITSCTPNEGKSNVSLNLAASLAETGKKVLFIDADLRKSVLIG
RLGVTEKIVGLTNYITGQCEFKEIVCTTNYPSLHIIFPGPEPPNPAELLGSEAFSDMLGHMRENYDYVIIDTPPLGNVID
SAVIAKECDGAAIVIAADAVSYKFVRKVKEQIERSQCRLLGVILNKVSLNEKGYYGKYYGNYYGKD
>gnl|bykdb|C6LDI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marvinbryantia formatexigens DSM 14469] (length=225 residues).
MQIAFEKLRTMDSVSREAYKALRTNITFCGEDIKAIAITSSMPNEGKSTVAFSLAQAFAEDNKQVLLIDADNRKSTLEYR
YGVDRTVKGLSHFLAGTAELRDVLCQTNIPYFHIILSGAAAPNPSELLGNGKFSALLDGAREVYDYIFVDSPPIGSVIDA
AVVAKQCDGVVYVVESGVTSYHLAKRGKEQIEKSGCRILGAVLNKVERKSKGYGYGRYYGDYYKK
>gnl|bykdb|C7ISF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter ethanolicus CCSD1] (length=235 residues).
MVIARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKAIVIDADLRNPTV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTV
TDAVILAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|C7RGH6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus prevotii] (length=217 residues).
MTSRNNYYSASMYDEAIRSVRTNIQFSSLDKKNKVISITSTKPAEGKSTVIYKLAKSFADNGDKVILLDCDLRSPSISEI
AGINDNVGITNYLTGKVNIQRAINKDREQSNLDMIFTGPVPPNPAEILASNAFKDFVEDLSKQYDYVFIDTPPVGLFTDA
SLVSTISDGVIFVIKSSDTKKEDISLAIENLKKVDAHILGAVLTHMPMKEKKYGNYY
>gnl|bykdb|C7XKF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus 125-2-CHN] (length=261 residues).
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADAINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|C8VYQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfotomaculum acetoxidans] (length=246 residues).
MAVEKLITLHSPKSPIAEAYRILRTNIQFSSLDKPIKSLLVTSAGPNEGKSLTVANLAVAFAQAGLKVLIIDCDMRKPTQ
HKIFELSNIKGLSNVLIGELSLMKGLLDVGIEGLKLLPTGPTPPNPSELLGSQRMKNFIAELYEVFDIILVDTPPVVPVT
DAALMAANVDGVLLVVASGQAKIEMTLKAKELLLNVNARIIGTVLNMLNVQGEEYYYYYYYYSGEDGGKKPKNKGHRKKN
LPAATM
>gnl|bykdb|C8W5K2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfotomaculum acetoxidans] (length=221 residues).
MFSNKLITINNPKSPIAEAYRILRTNIHFSVLNKPLKTLLITSAGCGEGKTLTVANLGVAFAQAGEKAVLLDCDFRKPGL
HTVFGQSNNKGLVDIILGRLPLDLGLKNVGIDGLKLITTGSVPPNPVELISSNRTKEFISDLAEMFDIVLIDTPPVAPLT
DAALMASNMDGVLLVVAQSKSKIAMVQKSKELLLNVNARIIATVLNMTDDPGEDYRYYNYG
>gnl|bykdb|C8ZXT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus gallinarum] (length=234 residues).
MAKQQERKGTQTHAVSLITLVDPSSPISEQYRTIRTNIQFASSADQQIKTLVVTSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVHKTFNLLNNVGVSTVLSTSTNLAEAAQQTVIDNLSILPSGPKPPNPSELLGSSRMNQVMAEAKKLYDI
VIFDMPPVVAVTDAQIMASKADGTILVVRENVSRKEPLTKAKELLNMVQARVLGVVYNGAENNKDSGYYYYYGN
>gnl|bykdb|C9A6V5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus EC20] (length=218 residues).
MITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQRVLLVDADMRKPTVYKTF
SLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDVVIFDMPPVVAVTDAQI
MASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHTKDSGYYYYYGN
>gnl|bykdb|C9AAE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus EC20] (length=214 residues).
MRSMKENYSIISEQVKLIRENVEYLCQQQEAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFS
QEMHVGLSNYIRRDISIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQRYDVIIIDTPPVNVVSDAL
ILAKKVDGVLLVVHAEKTNKQSAKNAVKKLRLVNANILGVVANGTTDTAVNYYY
>gnl|bykdb|C9ALZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium Com15] (length=232 residues).
MARTQKQKAAQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVDNLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSRDAGYYYGN
>gnl|bykdb|C9B454 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium 1,231,501] (length=232 residues).
MARTQKQKAAQTNAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTIAANIAVVFAKSGQRV
LLVDADLRKPVVYETFQLNNASGLSTALSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKTKELLEMVQARVLGVVYNGAEHSKDAGYYYRN
>gnl|bykdb|C9BUG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium 1,231,408] (length=232 residues).
MARTQKQKAAQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILSEARQLFDV
VIFDMPPVVAVTDAQIMSLKTDGTLLVVRENMSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|C9CHY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=234 residues).
MPKKQERTGTETHAVSLITLVDPSSPIAEQYRTIRTNIQFASSADKQIKTIVVTSSGPAEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFNLNNASGLSTVLSTSTSVLEVAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|C9LAS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia hansenii DSM 20583] (length=226 residues).
MEQKVVLTDIRKKDYFYEEAIKTLRTNIQFTGKNVKTIMFTSCFPNEGKSDVTFQLCQEIGNMGKRVLLIDADIRKSAYV
SRYRIKQKVNGLSQYLSGQLAKEFLIYQTNFLNVDIIFAGPMAPNPSELLEEEAFRELLAEVRGYYDYIIIDTPPVGSVI
DAAIIAKESDGAVLVIESERVSYKVAQKSMEQLEKTGCKILGAVLNKVNIEKNKYYGKYDYYYKSK
>gnl|bykdb|D0DJH0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus MV-3A-US] (length=259 residues).
MALFRKKRGTDDTIKNGAQLITVADPRSAISEQFRTIRTNSNFMSVDKEIHTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLPPVLEVSDTQELASHLDGVVLVVRQSVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|D0DSJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum 28-3-CHN] (length=246 residues).
MGLFKHRYTESTDTMDNGAMLITLANPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTDNVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIKGV
REAYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYG
YEGDEE
>gnl|bykdb|D0RXH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. 2_1_36FAA] (length=233 residues).
MATLEIIKNKLAEMHQAEEYFNALSTNIQLSGSDIKVVAVSSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKFDVKSEKYGSYGNYGNYGNYGNYGKK
>gnl|bykdb|D2ERX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. M143] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGTVSPNPTALLQSKNLSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTGKPFLGVVLNKFDTSVYKHSPYGNYGDYGKK
>gnl|bykdb|D2RIR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acidaminococcus fermentans] (length=240 residues).
MEEIKLIVENDPKSPIAETYRAIRTNLQFAGAGQDLKYICFTSSVPGEGKSTTISNMALTLAQDGKKVLLVDCDLRKPVQ
HKIFGVINQGVTNCLAQGVPFAQVVHPNVFRNLDVLTSGPVPPNPSELIGSEKMEQLLDRAGNAYDYVLIDLPPVLAVTD
AALLGNLADGVVLVVHSGMVAPEEVQEAKKRLQAGKANILGVVLNGVPQQHKGYGYGYYYYDYYDENHVKHHKKKGKREE
>gnl|bykdb|D3AC80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi DSM 13479] (length=244 residues).
MQKVLLRKHEKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAISFAEADNRVLFIDADIRKSVLVG
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVID
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGKYYGNYGEETKK
QDKK
>gnl|bykdb|D3AE78 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi DSM 13479] (length=270 residues).
MQKVEFKKLPRLDFRANEAFKTLRTNITFCGDAQRVILFTSTIPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
HYRVDQETRGLSHYLVGQESAENVAYRTNIDNMDVIFAGPSTPNPAELLGNAKFEEMLRGAREHYDYVLIDSPPLGSVID
AAIIARNVDGAVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVNQESKGYYGGYYSKYYGKNYVKYSGYGSGGSSG
KAEKSEEKTEMKTAAAGGEENQVKRSRRRK
>gnl|bykdb|D3FZP4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudofirmus] (length=235 residues).
MLKRNQSVSTRTQQQRKVVSHSNPKSPIAEQYRTLRTNIQFANMDGEEMRSILVTSAGPGEGKSTTIANLAIVLAQQGKR
VLLLDADLRKPTVHYTFQVDNTFGLTNVLTKQHTLSEAVKETKVEELHVLTCGPIPPNPSELLSSKAMADLLEDAFQYYD
YVLLDTPPTLAVTDAQILANLTDGSILVVSSGKTNRDGAKKATEQLKQAQAKLIGAVLNDKKKDNTSYYYYYGDK
>gnl|bykdb|D3LB10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oenococcus oeni AWRIB429] (length=350 residues).
MFSKKNPQKLSANDLRSSRYGVPLITVQDPQDVVAGQFRVLRANIDFAAASLKNFKTVLFTSAEMSDGKSTVAQNLAVAW
AQNGKRVLLLDADFRRPTVHKTFAISNERGLTTVLAMHDQPASLIHSTEVPNLYVMASGPMPPNPSELLSSDKMLKVINW
MKEQFEMVVIDSTPLLLVPDSQALIPRSDGIVLTAMLGKTKRKSMASAAHILKLAKANVLGVVSRDPHRADKGYGYNYRY
DYASTNMMKTDDVSKDASRHSTPVKAETQSTSLKNTEQLKHAAAKESSPSPKAQAPKSGRFFNKETVQETPRAPRVKKPQ
ASWSSFSYTSSGSEKSEIPKETEKPGPSGA
>gnl|bykdb|D4CG08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. M62/1] (length=233 residues).
MGKMMKVVNIHTDENRDFRFEEAIKTLRTNIQFSGPDIKTVMFTSAVPGEGKSQITISEAMSLAGLGKKVLVVDADIRKS
VLLTRYQVEQEVHGLTEYLSGQRQMEEVICTTDIQGMDIIFAGPYSPNPSELLAEPLFKELILKKREEYDYILIDTPPMA
GITDGAIISTVCDGAVLVIAAGTVSRRIERRIKEQLEKSGCRILGAVLNKVTSEHGGYYGKRYRKYYGYGAEK
>gnl|bykdb|D4G1R2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. natto] (length=175 residues).
MPGEGKSFSAANLAAVFAQQQEKKVLLVDADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTP
PNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGA
LLNKKKMKKSEHYSY
>gnl|bykdb|D4G2E1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. natto] (length=228 residues).
MRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|D4J4T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus catus GD/7] (length=230 residues).
MNSINLTRIDDGEAVSEYYKQLRTNIYFCGQDKQCIAFTSSFPNEGKSTVVFNLCKALAEDGKRVILLDADLRKSVLYNR
CMPDQEVKGLSHYLAGFVPLNDVICKTNIKNMYMAFAGLNAPNPAELLGNPKFKAAIEAMKKSFNYIIVDCAPIGAVIDA
AVVAKSVDGMVMVIEQKKVSRRMAQKMKEQLEASGCPLLGVVLNKVKISENKGYGGYGQYYGHYGKYGEY
>gnl|bykdb|D4JI67 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale M104/1] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQEILNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
>gnl|bykdb|D4JMC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale M104/1] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLIVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVVYATNIKGVFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
K
>gnl|bykdb|D4LG06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. SR1/5] (length=242 residues).
MNKLKVVFPDLPYAVEEAMNRLRINVKFCGKNTKKILLTSCMPNEGKSTVSSYLWKMLAEAGFSTVMVDVDLRKSVQMQR
MQVENASETKGLNHYLSGMAEYEDVVYKTNIENAYIVPCTQLLENPSPLLEDARFRELLDRLAGEYRFVIVDTPPLGSVS
DGALIASLCDGAILVVRAGQTPKAMIKQSLYEIEQSGCKLLGTVLNRAEVSTRGYGKYGKYGNYGYGYGYEPDTKHKKHS
EK
>gnl|bykdb|D4LTH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum A2-162] (length=247 residues).
MDELKLVFPDLPYAVEEAMNRLRINVKFCGKNTKKIMLTSCLPNEGKSTVAVYLWKMLAEAGFPSVLVDVDLRNSVLMKS
VQVDVSDKKGLNHYLSGLAEYDEVVYKTNIENASIVPCTQLLENPSPLLEDIRFRELLDKLATEYRFVIIDTPPLGSVSD
GALIASMCDGALLVIRAGSVPKTIIRQSLHEIDQAGCKLLGTVLNCVEGAGGRYGKYGHYGKYGKYGHYGQYGYGPQAEE
ENKKSKK
>gnl|bykdb|D4M2S0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques L2-14] (length=231 residues).
MAIQRVMLTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVLTSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSY
IKRYQVKQKTNGLSQYLSGQISLEEIIYSTNYRNLEIIFSGPYAPNPSELLEQGRFGRLIEETRKVYDYILIDTPPIISM
SDAAIAAKQCDGAILVIESEAVSRRDAMKAKEQLTKSGCKILGAVLNKVDMKKEKYYSKYSSYYYGKSKQE
>gnl|bykdb|D4MP30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][butyrate-producing bacterium SM4/1] (length=233 residues).
MGKMMKVVNIHTDENRDFRFEEAIKTLRTNIQFSGPDIKTVMFTSAVPGEGKSQITVSEAMSLAGLGKKVLVVDADIRKS
VLLTRYQVEQEVHGLTEYLSGQRQMEEVICTTDIQGMDIIFAGPYSPNPSELLAEPLFKELILKKREEYDYILIDTPPMA
GITDGAIISTVCDGAVLVIAAGTVSRRIERRIKEQLEKSGCRILGAVLNKVTSEHGGYYGKRYRKYYGYGAEK
>gnl|bykdb|D4MW29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLTPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYSYYGESDTEKNHPNT
>gnl|bykdb|D4RJF4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium E1679] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTSANIAVVFAKSGQRV
LLVDADLRKPVVYKAFQLNNTSGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLSKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|D4RX67 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio crossotus DSM 2876] (length=238 residues).
MQKISISKIGKLDYRTNEAFKRLRTNILFSGSDVKCIAITSCLPGDGKSTVSMNLAKSFAEMGKKTIFIDSDLRKSVLMG
RYKISKSIGGLSHYLSGMYPLEEVVCTTNVENLDMILSGPVPPNPAELLGGKLLKEMITRLKKVYDYIIIDTPPLGNVVD
SAIISSQCDGTALVMASGVISARFAEEIVEQIKNTGTKFLGIILNKVSMSGNGYYGKYYGKYYGRYGHGGDSTDSQKG
>gnl|bykdb|D4YF13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus viridans ATCC 11563 = CCUG 4311] (length=242 residues).
MFNFKSKKKQQKLENEQKLGSPLVTYFEPMSAIAEQYKTIRTNIEFAQIGSSVKSIAVTSSISMEGKSTTTVNLAYTYAQ
TGKKVLIVDTDLRKPTLHKTFKLNNNVGLTTALVNEEYSLESVIQYSEDFDLYILPSGPIPPNPAELVGSQEFSVLLDQI
TELFDLVIFDTPPLHSVTDGQIISGKVDGTILVVRQNYVRRDQVVEAKVSLDNVKANLIGYILNDVPINKNKGYGYYEYY
NV
>gnl|bykdb|D4YHG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus viridans ATCC 11563 = CCUG 4311] (length=249 residues).
MFKNKRKHFDKMNAEQRRGASLITVTQPNDVISESFRQIRTNIQFSMVDHDFKSIMFTSSGVWEGKSTVTANTAAVMAQQ
GLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDRDASIMDTVNYVADANIYILAAGPIPPNPSELLGSNRMAELIGELE
EMFDLVIFDTPPILAVTDAQVVATRVDGVIVVVRSGIANKNEVRKTKDLLDVVNANVIGAVYNGEDANKLGYGYGYGYGY
GYGQSETSK
>gnl|bykdb|D5AGQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYSEYGNYGKKA
>gnl|bykdb|D5DBK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKRKENKNDKVLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSDADEEIKALLVTSSGSAEGKSTTASNLATVYAQQGL
KVLLIDADLRKPTAHYTFRLENHAGLTNVLTRQSTLGQGVQESEVPNLYLLTSGPIPPNPAELLSSNQMTELLKEMKQEF
DMVIFDTPPILAVADAQILASQVDGSILVVSSGKTDKEAALKAKELLVNAKSKLLGAVLNNRKVYDENYYYYYGSN
>gnl|bykdb|D5DY81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKDQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEDIKSLVLTSSGPSEGKSTTAANLATVYAQQGL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTRQSSLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLGEMTERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSSKTEKEAALKAKDLLTQAKSKLLGAVLNNRKMKEGNYYYYYGSN
>gnl|bykdb|D5GZJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIENLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLRFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDGQ
>gnl|bykdb|D5HFS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus sp. ART55/1] (length=250 residues).
MKKLNIEFQELPYAVEEAMNRLRINIKFCGKNTRKILITSSMPNEGKSSVAINLWKMLAEAGFPAVLVDVDLRKSVIKDR
HHIKDADKLPDLGYFLSGQSEMEDVIYETQVENAYIVPCMNILENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAALVVRAGETSKSLIKQSFQQLDQVGCTLLGVILNRAQTTGRAYKKYYGKYGKYYSQYGYGYGTYGKEA
AAASDSTPSK
>gnl|bykdb|D6E0V4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale DSM 17629] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLIVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVVYATNIKGVFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
K
>gnl|bykdb|D6E330 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale DSM 17629] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGQSDKA
>gnl|bykdb|D6R2T8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis] (length=232 residues).
MAVLELVRKRRDLVKLTEEYYNALSTNVQLSGANIKVVEVTSVMPNEGKSTTSTNLAIAFARSGYKTLLIDSDIRNSVMS
GVFKSHGKVLGLTDFLSGQSDVKAILNTTDIANLHIILAGQPSPNPTGLLQSKNFEILLEALRTRYDYIIIDTSPIGLVI
DAAIIAQKCDASLLVTEAGAVKRKAVAKAKEQLAQTGTPFLGVVLNKFNVQLERYGSYGSYGGYGDYGNYGK
>gnl|bykdb|D6S4X4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus jensenii JV-V16] (length=258 residues).
MALFRKKRGTDETMHYGAKLITVAKPQSQTTEQFRTVRTNINFKAIDHDINTLAFTSAAISEGKSTVAANVAITYAQSGK
KTLLIDGDLRRPTVHSTFSLTNRRGLTSILTSDSNELNLDEFTQDSGIENLSILTAGPIPPNPAELVGSKRMKTFIDLVR
NYYEMVIIDLAPILEVSDTQELARKLDGVVLVVRQGKTQKQAVKRAVEMLEIAQAHVLGYIMNDVKSEDAGYGYGYGYGY
GYGEPEKEKKSIFSWMNK
>gnl|bykdb|D6Y034 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus selenitireducens] (length=238 residues).
MAFRNPFAKKVEDHLTEKQRSLITHFSPKSPISEQFRAIRTNIQFASPDISLKRLLVTSTSPGEGKSTTAANLAIVLAQQ
ENRVLLIDGDMRKPTGHFTFQLPNKQGLSNVLAKQASLSSCVQESQIEGVSVLTCGPIPPNPAELLGSKQMDTVLQEAEE
MYDYIIIDSPPILAVTDAQLLAAKVEGVVLVTSSGKTEREAAKKSKELLDNAHARILGVILNRKDKKETTYYYYYGND
>gnl|bykdb|D6ZQI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae serotype A19] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKVGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|D7UYE4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria grayi DSM 20601] (length=233 residues).
MKKKETGMRRGLSLIAHNKPKSIVSEKFRGIRTNIMFSTADSEVKTVVVTSEKPSSGKSTISANLAITYAQAGFKTLLID
GDMRKPTQHYQFNKSNIEGLSKLIIKKSDFEKSILDTGIDNLHLLTSGPIPPYPSELIGSVNFSLIFEELQKEYDFIVVD
TPPVNTVTDAQLFAELAKHVVYVVDAKKSHRDDVKKGKELLEKAGAKILGVVLNKATPEKASSYYYYYGDDKK
>gnl|bykdb|D7VBW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|D7VC13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437] (length=242 residues).
MFKRKEKNIATTAPINLTTINEPMSVITEQIKTIRTNINFTATDHKLRTLMVTSAMLGEGKSKVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYNSGYGYYSDE
DK
>gnl|bykdb|D7WMM8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus fusiformis ZC1] (length=233 residues).
MFWKKKKKKKLVKMARKLVTIANGHSFISEQFRTIRTNITFSMPDREIKTILVTSATPGEGKSTNAANIGVVFAQEGKRV
VIVDADLRKPTMHYTFLLQNARGLSNLLTRHFTISEVVNNTDIANLYVLTSGPIPPNPAELLASTLMGSVMEELKKEFDI
IIFDAPPLLSVTDAQILSNKCDGTLLIVNSGVAENENVLKAKSYLEASKANILGVVLNNYKMPLHQYYEQYYR
>gnl|bykdb|D8FLF8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] (length=261 residues).
MAFGRKNYLDNETMKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAGK
KTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRAKEMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVIDLAPILDAAETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGYGEEKEKKGLFGRKK
>gnl|bykdb|D9QTC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetohalobium arabaticum] (length=238 residues).
MIKMDKERRERIQSRDVELITNYSSKSPLAEAYRTLRTNIEFLSPDDPLETMVITSSVPQEGKSITIANLAVSMAENGQQ
VIVIDADMRKPMQHRIFEITNFGGLSDLLTGELNFAEGLQKTNIEGISLISGGNVPPNPAELLGSQKMEEVIKQAENKAD
IVLIDSPPVIAVTDSRLLANKVDGVMLVVAAQETDEEALAKSQQMLEKVQANVIGTVLTKYPAEESNSYYSGYYNYYG
>gnl|bykdb|D9S1J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermosediminibacter oceani] (length=238 residues).
MEEMDAQLFVMDDPKSVVSEAFRVLRTNLQFSSIDRPLKKVVVTSSIPQEGKSTVIANLAVSIASAGSRVLLVDADLRRP
KLYKLFLLENYKGLSNLLAEDLPLDTVVNTTKVENLHVITSGPVPPNPAEVLGSAKMKNFLDEVASLYDMVLIDAPPVNS
VADAAILSTLVDGVILVVEEGSTEREAAVAAKQQLDKVNARILGVVLNKVKQQKGGGYYYYYYYYGEGDHKRKKKKIT
>gnl|bykdb|D9SR41 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium cellulovorans] (length=228 residues).
MLKSLVTHLDPKSVISETYRTLRTNIQYANIDGDLRSIIITSSSPSEGKSTTVANLAIATAQTGKKILIIDADLRKPSVH
KKFGISNQLGLTNVLTEQCEIFSAIQKSEVRNLYILASGPIPPNPSELLGSKKMQNLLDLLKSKFDMVIIDTPPVLAVTD
SQILSTEVDGVILVAVYGKTDKKALIKAKERLDKVDANLLGSILTRVPANSKNGSSYYYYYYGEKKAK
>gnl|bykdb|D9ST44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium cellulovorans] (length=216 residues).
MNNNRLITVEHPNSQISEAYRTLRTNIQFSSLDKNVKTIVVTSSVAGEGKSTTCANLGVVMAENGYNTILIDCDFRNPSL
HRQFNIPNRKGLLGFLEGNALFSESVQKTKVSNLDIAMVGTKANNPSKLISSEKLKNLIEDLKETYDYIIIDTPPVTIAT
DAQLLSTYADGCVLVVASSQVEKAAALKAKALLEKVKAKILGVVLNKLDVKQNGYY
>gnl|bykdb|D9SVC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium cellulovorans] (length=228 residues).
MFKSLITYRDPDSITSEIYRTLKTKLQFVNIDNDIRTLLVTSASKAEGKSTTTANLAITVAQSGRKVLIIDSDIRKPYIH
KLFSLPNKTGLTTVLTNQCDLMDAIQETEVDNLHILCGGKIETNSHQLIGSKKMSKLIDLVENNFDMVIIDGPPILLVTD
SQLLANQVDGVLLVTCYGKTEKKALVKAKKTLDSVNANTLGVVITKVPKPPKIEENYSYYYSEEDDDE
>gnl|bykdb|E0I7B5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus curdlanolyticus YK9] (length=229 residues).
MSRQNSQANLITISNPKSPISEAYRTLRTNIQFSSVDEPIKVIMIASAQAGEGKTTTVTNLAITYAMEGKRVLLIDADLR
KPSLHRMFDLSNRIGLTNLLAGQFHLSEVEQATLVDNLTVIPSGPVPPNPSELLGSQKMKQLLAELKNQYDMILIDTPPN
LAVPDGMIISANCDGVVLVVQAGKVKRDMVRKAKTNLDHVNARILGVVLNNVERKQTEGYYYYYYGSKE
>gnl|bykdb|E0NHP4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus acidilactici DSM 20284] (length=248 residues).
MFFKKKPKLDNESLKNGVGLITYNDPTSTIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTVSNNVAVTWADQGK
SVLIVDADMRRPTVHRTFRTSNAIGLSNLLAGTGSLDDAIHSTVVENLSVMPSGPIPPNPSELLGSPKMVNLLGVLTTKF
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYYGGYYG
GYYGTDDK
>gnl|bykdb|E0PD83 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus ATCC 700338] (length=246 residues).
MPQLELVRSKAQMVKSMEEYYNSIRTNVQFSGRDLKVITLTSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTTIDNLMIIPSGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGSYGGYGAYGNYGKGKEKTKTG
RVKRKK
>gnl|bykdb|E0PPH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis ATCC 6249] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAVGEANRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGNYGKK
>gnl|bykdb|E0Q2S8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 071 str. 73H25AP] (length=227 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMLDALRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAVGETNRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|E0RZL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio proteoclasticus] (length=276 residues).
MQNAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVKVVSVTSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
GRYKTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKALENMKQVFDYIIVDTPPLGSVI
DAAVVAKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDIAGKGYYGHYGNYYGKYYGKYYGKYYGKYGE
DNIDVPTKPNATVTDPEPDEDDLDELNYLAGVMRKD
>gnl|bykdb|E0TTZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=238 residues).
MALRKTRGSWMRRTVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKTVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHLENMIGLTTVLLKKSSLEQAVQASNEKYLDVLTSGPIPPNPAELLSSKWMKELADEACAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|E0U2Z3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=227 residues).
MFFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKLKKSEHYSY
>gnl|bykdb|E1LPE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK564] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNVQLSGNDLKVIVVTSVDSSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVSSPNPTALLQSDNFGIVIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVVESGAAKRREVQKAKSQLEQAGKPFLGVVLNKFDVQREKYGSYGGYGNYGKK
>gnl|bykdb|E1LQJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK597] (length=237 residues).
MPTLEIAQKHLNFAKKAEEHYNALRTNIQLSGDNLKVLSISSVKSGEGKSTTSINIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNIENLFVIQAGPVSPNPTALLQSENFATMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTATGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNIEVGKYGAYGGYGAYGAYGSYGNYGKKK
>gnl|bykdb|E3CBS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis F0405] (length=230 residues).
MNTLEISKNKLQEIHKAEEYFNALATNIQLSGVNLKVIAVSSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSRDKIQGLTDFLSGRSQLNQILYPTDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGIVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKEQLEQTGTPFLGVVLNKFNIKATEYGSYGGYGSYGEYGKK
>gnl|bykdb|E3CP62 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus vestibularis F0396] (length=723 residues).
MPLLKLVKSKVQFAKQTEEYYNAIRTNIQFSGAQMKVISISSVEAGEGKSTTSVNLAISFASVGLRTLFIDADTRNSVLS
GTFKSNAPYKGLSNFLSGNADLNETICQTNISGLDVIASGPVPPNPTSLLQNDNFRHLMDVARSRYDYVIIDTPPIGLVI
DAAIIAHQADASILVTAAGKIKRRFVAKAVEQLEQSSPQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGEYGKKENKKKVI
QEHIVVEKDSVNGDNAAPYALIFKEELRVKEKQEIRRIEIGVVQLVVVVFAAWLASKLPYTEITKGSMVILGVVHVVTYY
ISSYYENLKYRGYLDELIATVKYGFIFALVVTFLSFFADGDFSISRRGLLYVTLITCTLLYLTNTLLRYFRSSIYTRRKG
NKNILLISDQARLEDVLIRMKDNMDGRITAVCVLDNPYFTSPFIKSVKPENLVEYATHSVVDQVLINLPSEQYKIWDYAS
PFELMGIPVSINLNSLEFMSQGKKRIQQLGPFNVVTFSTQFYSYGDIVAKRFLDICGALFGLLLCGLVGIFLYPLIRRDG
GPAIFVQDRVGENGRIFKFYKFRSMRVDAEEIKKNLMSQNKMSGGMFKMDNDPRITKIGHFIRKTSLDELPQFWNVLKGD
MSLVGTRPPTLDEYESYTPEQKRRLSFRPGITGLWQVSGRSEITDFDEVVKLDVAYMDDWTIWRDIRILLKTIKVVVKKD
GAK
>gnl|bykdb|E3GPC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium callanderi] (length=244 residues).
MKDSIITYKSPKDPISEAFRNMRTNITFADIDEELRVLTITSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIH
RLFEQPNKRGLTNILLRECEPTEAIQTTDVENLFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
AAVLSHVTDGYIVVAAISVTNKEGVRMALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQSKKEKKHRKIKE
KRGK
>gnl|bykdb|E3R264 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus CTV-05] (length=261 residues).
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADAINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|E4Q5T5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldicellulosiruptor owensensis] (length=257 residues).
MNAVKEVIALYNPRSPITESYRMLRTNIQYSSLDKPIKTIVITSTGPSEGKTITCANLAVVMAQAGSKVLVIDADLRRPA
IHKVFGVSNKVGLTNLLVENKKFEEIVQKDGVEGLDLITSGPIPPNPAELLGSKKFENFLNTISQSYDYIIIDTPPCGSL
TDAAIIGRIVDGVILVAAAGEVQIEAIQQAKENLQKVNANIIGVVLNKVKRQTSSYYYYYYYYYYYTDESGETVKKKKVG
RRRKKDDRYTLPSDGRR
>gnl|bykdb|E4S7Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldicellulosiruptor kristjanssonii] (length=258 residues).
MSIVKEVIAYYNPRSPITESYRMLRTNIQYSSLDKPIKSLVITSSGPSEGKTITTANLAVVMAQAGSKVLVIDADLRRPA
IHKVFGVNNRFGLTNILAENKLFEEVVQKDGIENLDLLTSGPIPPNPAELLGSKKFENFLSYVRERYDYVIIDTPPCGSI
TDAAIVGRIVDGVILVASAGEVEIEAIQHAKENLQKVNANIIGVVLNKVNKQTSGYYYYYYYYYYYYQDDSGEIIKKKKG
ERRKKRKERYTAPVESKN
>gnl|bykdb|E4SDX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldicellulosiruptor kronotskyensis] (length=257 residues).
MNAVKEVIALYNPRSPITESYRMLRTNIQYSSLDKPIKTIVVTSTGPSEGKTVTCANLAVVMAQAGSKVLVIDADLRRPA
IHKVFGVSNKVGLTNLLVENKNFEEIVQKDGVEGLDLITSGPIPPNPAELLGSKKFENFLNTISQSYDYIIIDTPPCGSL
TDAAIIGRIVDGVILVAAAGEVQIEAIQQAKENLQKVNANIIGVVLNKVKRQTSSYYYYYYYYYYYQDENGEVVKKKKTG
RRRKKDDRYTLPSDGGR
>gnl|bykdb|E4SMV5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus] (length=260 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|E5F5C5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARNKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGNYGNYGKNKK
>gnl|bykdb|E5VMX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 5_1_63FAA] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVLNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIEKVRDMFDYVIIDTPPLGIVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRIFGAVLNKVDERIGAYGNYEYKYSYSYYGESDTEKNHQNT
>gnl|bykdb|E6IZC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus anginosus F0211] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIIAQKCDASVLVVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|E6KKS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis ATCC 49296] (length=227 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|E6LD64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus italicus] (length=232 residues).
MAKNNKRGTETKPVSLITLIDKSSPISEQYRTIRTNIQFASTVDHEIKTIVVTSSGAGEGKSTTAANLAVVFANAGQRVL
LVDADLRKPTVHKTFHLQNNVGFSNLLSTKETMSNVIQASVVPNLSLLTSGPKPPNPSELLSTARMDQLIRELRGAFDLV
IFDMPPIVQVTDAQIMASKVDGTMLVVREDVSSKDAVVKAQKLLQMVNANILGAIYHGTKNAVDQGYYYYGS
>gnl|bykdb|E6U7N4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ethanoligenens harbinense] (length=240 residues).
MANKHRVLSHDVLLSSGNVPFQFVESYKTLRTNLDFIPIDEPCKKFLITSSIPEEGKSTVSINLAITLAESQKRVLLIDL
DLRKPTIKKNLKLKDVRSGISSVLADQKSEDDCIVYLSDLNLYVMTSGPIPPNPAELIGSDRMQHLIRRLEEKFDYILID
TPPVSVVTDAALASRLVHGVIFVLRQKYTTTEIAQQAQNNLKNVGARIVGCVFNAFNAQKSRKYAYGHYRYKRYYTEAYK
>gnl|bykdb|E6UHY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus albus] (length=262 residues).
MANTKKIPGGNRNRRRTLMDKNVAFPVTEAYKNLRTNISFALSTKKNKIFAISSALASEGKSTVAANIAITLAQNNNHVL
LIDGDLRKPVQHRVFSLTNDLGLSTLISGTNTFKEIVHHNVIDNLDIVTCGPIPPNPSEMLGSDNMKQLLDQLSAHYDYI
IIDTPPINIVTDCLTLLDSIAGVLLIAKFAQSTYDALQEAIEAIKMADGSLLGVVVNNVSVMSGKYGGKYGYRYRYGYRY
GYGYGYGYSYSRKPSDEGENDE
>gnl|bykdb|E7GL40 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] symbiosum WAL-14163] (length=259 residues).
MHDEIVIEDLISPDERGMGELVLKGFEVNDYQYEEAMKTLRTNIQFSGSNIHAVMFTSSAPNEGKSETTFQLAASMVQLG
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
YGYGHENAKQGKEVKTASV
>gnl|bykdb|E7GL57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] symbiosum WAL-14163] (length=233 residues).
MDNEVFLKRTAIEDYQYNEAMKTLRTNIQFSGTGIQVVMLTSSVPGEGKSETTFHLAASLAQLDKKVLLIDADIRKSILV
TRYQLDRRVDGLSQYLSGQKKLEEVVYKTNLPNLTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLI
DGAIISRNCDGAILVIESGNISHRLLQKVKGQLEKSGCRILGAVLNKVDVRQNSYYYYGKYGKYYGKEYSSEH
>gnl|bykdb|E7GL81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] symbiosum WAL-14163] (length=239 residues).
MGKEISLMRDQKEDYQYEEAIKTLRTNIQFSGTNLQVIMLTSAVPNEGKSEISFSLASSLAQIDNRVLLIDADVRKSVLV
TRYKLDRKIEGLSQYLSGQKKLEEVIYTTNIPNLDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTII
DGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQLERSGCRILGTVLNRVNMQVQGYYRYYGKYGRYHYVYGYGYGRENKK
>gnl|bykdb|E7RDR3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis MPA1U2] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSVVTEQFRTLRTNINFSSPDSEIRTMVVTSAAPSEGKSTTAANLAVVFAQEGKKVLLI
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSIQEVIRATAVERLDLMTCGPIPPNPAELLASKSMDTLIAQLKNTYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDKALKAKEAIESSNSRLIGAVLNNFELPKDSYYYQYYGNAE
>gnl|bykdb|E7RG08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis MPA1U2] (length=237 residues).
MVKKKNKPEVKNRKLIAFTNPKSRVSEQFRTLRTNIHFTVPGGKVRSLVVTSASHLEGKSTTSSNLAIVFAQEGKRVLLI
DADMRKPTMHQTFKISNSKGLSNVLVRRFSLKMAIQASGIENLDLLPSGPIPPNPAELLGSSNMDLLFESALDTYDMIIF
DSPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKDAITASTKTRLLGTVLNNVQVEKDFNYAQYYTRAPNEK
>gnl|bykdb|E7S8W3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus australis ATCC 700641] (length=231 residues).
MATLEIVKSKLAAMTQAEEYFNALSTNIQLSGTNIKVVAISSVQPNEGKSTISTNLATAFARAGYRTLLIDADIRNSVMT
GVFKSQGRVAGLTEVLSGKSEISQAIATTDYPKLDVLLSGQVSPNPTGLLQSKNFEVIIEALRNHYDYIIVDTPPIGMVI
DAAIIAQRCDGSLIVTAAGAVSRKAVQKAKEQLEQTGTPFLGVVLNKFDIQLEKYGSYGNYGNYGNYGKKR
>gnl|bykdb|E8JMT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus ATCC 9812] (length=231 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFAHAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGEYGEKN
>gnl|bykdb|E8JWI5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus cristatus ATCC 51100] (length=233 residues).
MPILELAKKKKISISRVEEYYNALRTNIQLSGEDIKVIAVSSTFPGEGKTTTSTNLALTFAKAGHKTLLIDADIRNSKML
GGVFKSGEKVSGLTEYLARNTDLSQGLCETDEENLFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMV
VDATLIAKVCDASLLVVSTNEVKRKMVQKSKTQLEQSSTPFLGVVLNKYNVQADKYGFYGSYGHYGDNLSKEE
>gnl|bykdb|E8K322 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis ATCC 700779] (length=230 residues).
MAKLELSEQRLHSVKKAEEYYNALRTNIQLSGDGLKVIALSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSDKFEAMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKDQLEQTGTPFLGVILNKFNIQLEKYGSYGSYGNYGSYGKK
>gnl|bykdb|E8K786 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis ATCC 903] (length=230 residues).
MNTLEISKNKLQEVRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSRDKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKEQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|E8KDN2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus peroris ATCC 700780] (length=230 residues).
MAKLELSVKRQAFVKKAEEYYNALRTNIQLSGDKLKVIAISSVRPGEGKSTTSINIAWAFARAGYKTLLVDADIRNSVMS
GDFMSREKITGLTDYLSGTKDLSQGLCETNVENLFVIQSGAISPNPTALLQSDKFETMIDTLRKYFDYIIVDTAPIGVVI
DAAIIAQKCDASILVTEASVTKRREVQKAKTQLEQTGTPFLGVILNKFNIHLEKYGSYGSYGSYGAYGKK
>gnl|bykdb|E8KLY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis VMC66] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLENLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|E8KUY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus vestibularis ATCC 49124] (length=249 residues).
MPLLKLVKSKVQFAKQTEEYYNAIRTNIQFSGAQMKVISISSVEAGEGKSTTSVNLAISFASVGLRTLFIDADTRNSVLS
GTFKSNAPYKGLSNFLSGNADLNETICQTNISGLDVIASGPVPPNPTSLLQNDNFRHLMDVARSRYDYVIIDTPPIGLVI
DAAIIAHQADASILVTAAGKIKRRFVAKAVEQLEQSSSQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGEYGKKGKQKESH
SRAHRRRKG
>gnl|bykdb|E8UV29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter brockii subsp. finnii] (length=235 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTV
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|E9DM17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. C150] (length=246 residues).
MPLLKLVNSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNIAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNATLEETVCRTDIASLDVISSGPVPPNPTSLLQNENFTHLMDVARSQYDYVIIDTPPIGLVI
DAVIVAHQADASLLVTAAGKIKRRFVTKAVEQLTQSGSQFLGVVLNKVDMTVDKYGTYGSYGSYGDYGKKSEQKSSHSRS
QRRRKG
>gnl|bykdb|E9FEC5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. C300] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|E9SAU1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus albus 8] (length=267 residues).
MASIKKNQSSNTRTRRRTLMDKSVAFPVTEAYKNLRTNLSFALSTKKNHIIAISSALAAEGKSTVAANIAITLAQNNNSV
LLIDGDLRKPVQHKVFNIKNEVGISSLIGGLNSFKEVVHADVIENLDVVTCGPIPPNPSELMGSDNMKMLLEQLAAHYDY
IIIDTPPINIVTDALTLLDTIAGVLLVAKHGQSTYDALEEAIEAVRMADGSLLGVVINNVSVTGGKYGGKYSYKYKYGYK
YGYGYGYGYSYGNNASVGSGKSNDNDE
>gnl|bykdb|F0EKB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus ATCC 12755] (length=235 residues).
MMAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYD
VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|F0FHA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK353] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFDALLADLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F0FQQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK678] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTSFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F0GT81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus prevotii ACS-065-V-Col13] (length=218 residues).
MSKKGNKYYTASLYDEAIRSLRTNIQFSSLDNKNKVIAITSTKPSEGKSTVIYNLAKSFAQNGERVILLDCDLRSPSISE
VSGIKDNVGLTNYLTGKVSLERAINADTSQDNLDIILTGPVPPNPAEVLASNVFKKLIEKLSSMYDYVLIDTPPVGLFTD
ASIVSTLSDAVIFAIKSSDTKRDEISQALDNLKKVDAHILGCVLTHMPRKDNQYGSYY
>gnl|bykdb|F0HVF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. lactis DSM 20072] (length=260 residues).
MALFGRKNHLDNETIKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAG
KKTILIDADLRWPTLHSTFNVSNSNGLTTLLTSRSKEMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDL
KQEYDMVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGYGYGY
GYGYGYGEEKEKKGLFGRKK
>gnl|bykdb|F0I4H5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK72] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F0IAY3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK115] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLENLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F0IJI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK150] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLENLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F0IS53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK160] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F0K0J7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=255 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDREVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILVDADLRRPTMHSTFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGEEDEKKGLFGRKK
>gnl|bykdb|F0NWJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus helveticus] (length=262 residues).
MSLFKKKRGTDETIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHNIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHAGLSTVISSTAKEVDLDEVVQESGIDDLAILTAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDMAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEILNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGEEDKKKKGFFSRRKK
>gnl|bykdb|F0PU64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. finitimus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|F0SX22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Syntrophobotulus glycolicus] (length=240 residues).
MRGIKRLLNKGRNKTPDIVRDKLNILNSDSAFSTIEEYKALRTNITFCLPSGQCKIIGITSAEAEEGKSITCINLALAFA
ETKARVLIIDCDLRRPRISSLLSMPASPGLSNVLVSLSSPDEVIHTMSNSTADVILSGDIPPNPSELLASDQMRLLLEQL
AKKYDYIFLDSPPINLVTDAVILSKWLTGILFVVRAGLSEKGSVINAVNHLTFVGGNILGFLLNGIKTKSTSSRYSKYYR
>gnl|bykdb|F0TGY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus] (length=260 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|F1Z124 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis NCFD 2020] (length=239 residues).
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTTSANIAISFAKAGLKTLLIDADIRNSVMS
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGAYGNYGKPAKKKSRKRR
>gnl|bykdb|F2C9N0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK330] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F2CH53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK408] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLENLDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F2I4B7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=214 residues).
MVVDNPTSAMAEQFRTIRTNIQFSMLDKELKTFNVTSPGPASGKSFLSANIAAAFASDDKRVLLLDADMRKPTVHKTFGV
PNDRGLTNLLTDSRLEIHQVIKKSYVPNLFYLTCGAIPPNPSELLASKRMQELMDQLRNVFDIIVLDCPPVLAATDAQVV
SARVDGTVVVVPYGQCTKDEVKESQALLDKVNTNVLGVIMNRTERTEDYYYYYE
>gnl|bykdb|F2I6Z7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=251 residues).
MFNFKQRKIDKKNKEQRRGVSLITAADPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
DEDIDSEDLQS
>gnl|bykdb|F2M2M6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus] (length=260 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVVIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|F2QF90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|F3A499 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemella haemolysans M341] (length=234 residues).
MAQINLLTNQKIVDPKNDEYYNAIRTNIQFLGKDKKVIVITSTSENEGKSTVSTNLAISLAKLGLKTILVDADTRKSVMA
GRFKFKHKISGLTNYLSGVSPIEDVIYETDVEHLNVIPVGQVPPNPTGLLQNKNFNIMIEVFREYYDYVIIDTPPIGQVI
DAAIVAPKTDGVILLVEANRVKKKSIEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYGHYGSYGLNGNKDKK
>gnl|bykdb|F3AH92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 6_1_63FAA] (length=232 residues).
MNTELKVVMKDPKRSDYFYEEALKTLRTNIQFSNKEVKVILLTSCYPNEGKSDIAFNLSKEMGSIGKKVLLLDADIRKSV
YVKRYSVKQEVKGLSQCLSGQVDKEQITYQTNFENVDIVFAGPIAPNPSELLSSKEFDDFLKEKKEQYDYIFVDTPPIGS
MIDAAVVAEKSDGAILIVESDAVSYKVAQKAKQQLERSKCHILGAVLNKADLKKSKYYSSYYGKKYGGYRGR
>gnl|bykdb|F3AHH0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 6_1_63FAA] (length=230 residues).
MINVEIKVPKLGYNSAESYKSLRANLQFCGDDKKVLAITSCTPNEGKSSVTLNLAVSLAESGKKVLLLDADLRKSMLLGR
TKIKGTAKGMTHFLSGQVEIKDVLCSTNIENMHIAYAGPVPPNPAELLGSKRFHDLLVSLRKVYDYILIDTPPLGSVIDS
AIVAEECDGAILVIEAGVISHRFAQEVKGQLDKTNCPVLGVVLNKVDMSRQKYYGKYYGRHYGRYYGKDE
>gnl|bykdb|F3ATF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_46FAA] (length=240 residues).
MAEQKVIMTDPRQEDYFYQEAIKTLRTNIQFAGMDVKTILFTSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSIL
ASRYGVGKQVQGLSNYLSGQASIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSI
IDAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYDYYYHGYQEKKEVTKKNKEK
>gnl|bykdb|F3SM32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK1087] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F3UDW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK1056] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLENLDVILSGPVSPNPTGLLQSKQFDALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F3UNJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK355] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDLDNLDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|F3UUQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK49] (length=232 residues).
MAVLELVRKRRDLVKLTEEYYNALSTNVQLSGANIKVVEVTSVMPNEGKSTTSTNLAIAFARSGYKTLLIDSDIRNSVMS
GVFKSHGKVLGLTDFLSGQSDVKAILNTTDIANLHIILAGQPSPNPTGLLQSKNFEILLEALRTRYDYIIIDTSPIGLVI
DAAIIAQKCDASLLVTEAGAVKRKAVAKAKEQLAQTGTPFLGVVLNKFNVQLERYGSYGSYGGYGDYGNYGK
>gnl|bykdb|F3Y922 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Melissococcus plutonius] (length=233 residues).
MSEKNSLKKQRTKPISLITMSDPASPISEQYKTIRTNIQYAMVDKTLQTLAITSSNASEGKSTSTINLAIVFANSNKKVL
LVDADMRNPTIAKTFELINNRGLSTLLSNKTMTTEEVLQPTNLENLNILPSGPIPPNPSELLDSLQMKRLIEEWKNNYDL
IIFDTPPILAVTDAQILASKVDGTILVAREKIAEKSALLKAKELLIMVKATIIGAIYNDASSVKDQGYYYGVK
>gnl|bykdb|F4BS19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp.] (length=240 residues).
MFKKRLKEKKYEDKNLITLIDPSSIISEEFRTLRTNIQFSMIDKELKTLMVTSSKQGEGKSTIAANLAVVFASQGKKVLL
VDADMRNPSLHKLFKVRNQQGLTSILTTKNRQIANLLHKTSQENLELLTSGILPPNPSELLASQRMSQFIETVKQEYDLI
VFDLPPVNVVTDAQVMGNKSDGTVFVIRKEVADLSEILKAKELLNLVQANVLGAVFNSKERMKSLNNGYYAKEKELDSVG
>gnl|bykdb|F4BSD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp.] (length=234 residues).
MFNKKEKKLDNNERPSLVTLTRPSSVIAEQFRTIRTNIQFSMVDKNLKTLVITSAGPGAGKSTISANLAVTFAMQGKKVL
IVDADMRKPTVHKTFRLPNRDGLTTLLTERDVEIKDIAHRLDTEGLFVITSGVIPPNPSELLASNRMNQLMSEFEELFDL
IIFDMPPVIAVTDAQVMSSKTDGTIFVVNKDGADKEMVTKSKNLLEKVNANVIGVVLNRVELKGDNYYYYYGEE
>gnl|bykdb|F4FXQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus buchneri] (length=251 residues).
MNIFRRKQKKISTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYGYGYDNEGK
>gnl|bykdb|F5LE48 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. HGF7] (length=230 residues).
MLASTNNSKVLIADVNPKSQISEAYRVLRTNIQYSSIDKEITTILVTSAQPAEGKSTTVSNLAITYAQEEKNVLLIDADL
RKPTMHKLFGISNRSGLTNLLLGEAPVREVAIPSHLPNLYLIPSGPSTPNPAEMLASKRMTQFIEQAKAEYDIVLIDSPP
ILAVTDAQILATKCEGVILVLNHGKVKREVAKRAVDRLEHVGVKPLGVVINNKTNTKTSSSYYSYYGESK
>gnl|bykdb|F5LM71 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. HGF7] (length=227 residues).
MSPSNKQRPIIAHSNPMSPISETYRTLRTNIQYSGVDGEIRTLMVTSASPWEGKSTTIDNLAVVYAQTDKKVLLIDADLR
KPTAHRTFGLSNRTGLTDVLTRQAEVEEALKETDIPGLYVMTCGTVPPNPSEILGSRRMTDLLERLKQEFDVILVDTPPV
LAVSDAQVVATQCDGVVLVVNAGGVKRELVQKARDSLQFVHARILGVVLNKVARKDAKMNTYYDYSS
>gnl|bykdb|F5VSG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis SK255] (length=227 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DVAIVTQKCDASVLVTAVGETNRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|F5X0J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=246 residues).
MPQLELVRAKAQMIKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDAICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGEDRRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|F5X652 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pasteurianus] (length=243 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNVQFSGRDLKVITLTSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTTIDNLMIIPAGQVPPNPTSLIQNDNFKVMIETVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGSYGGYGTYGAKEEKSKKGKGR
RRK
>gnl|bykdb|F6BI62 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacterium xylanolyticum] (length=240 residues).
MIDVNNNVFKNNVVNSKTTVSEAFRSLRTNLQFTSVDKKVKSILITSSLPNEGKSTIIKNLAYALAMTGVKVIVVDCDLR
NPTVHQMFKIPNMSGLTNIIVEDDRYEKYVISDKEFDNLGIITSGPIPPNPSELIGSNRMKVFLDRLKEDYDYVLLDAPP
VLLVTDPTVLAPVVDGVILVIQANKTEIEATKRAKEILTNLKANILGAVLNKVKEQRSDYYYYYYYNNDGSKHKRKRRKK
>gnl|bykdb|F6CNF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfotomaculum kuznetsovii] (length=235 residues).
MSKANGYELITHKHPRSPVAEAYRVLRTNLGFSGLDRPCRSILVTSAGPEDGKSTTAANLAVVLAQAGNKVILVDCDLRK
PTQHRIFEVENHRGLTNCLLQNLDPAEVSKNGLVENLTLVTSGPIPPNPAELLGSGRVRALWPALLERFDYLIIDSPPVL
AVTDAALLAAQVDGVILVIRAATTRVEIAQEARDQLLKANARIIGVVLNQVKMPARDYHYYYYYHRREKEEEVRL
>gnl|bykdb|F6IR93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus MP-10] (length=238 residues).
MGLKRLKRKTTAETSGVQLTTITAPMSVVTEQIKTIRTNLNYAMVGKPLKTLMVTSAIQGEGKSTVAGNLAIEYAKKGLQ
VLLVDADLRRPTVHQTFGVPNQRGLSSWLSGQLEDVNDAIHPVLAHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLD
LVIVDAPPVLPVTDARILAGQVDGTMLVVRQNGVEKTAVRQAVGALKKAHTQLLGAVLNDVDVKTHGYGYGYYGNDAN
>gnl|bykdb|F6ITB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus MP-10] (length=242 residues).
MFKRKEQSTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKVAVRDAVHSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|F7K0U1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 2_1_58FAA] (length=228 residues).
MREIVLNGLEKDFRSNEAYKNLRTNIEFSGEENKVLVFTSCTPNEGKSTVSLSVASSLAESGKKVLFIDADLRKSVLAGR
HRVQGELKGLSHFLSGRAKVEDVVCKTQIEGLMVIFAGIIPPNPAELLGQERFGNLISSGRKVYDYIIIDAPPLGSVIDS
AIIARVCDASVLVISANAISHKFARVVKEQLERSECPILGVVLNKVDMSQNKYYGKYYGKYYGKYGEK
>gnl|bykdb|F7K8E9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_57FAA_CT1] (length=308 residues).
MQTITFSAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSVLKG
RYKSNAARYGLSHYLSGQASISDIFCKTNIPNFYVIFSGPVPPNPSELLGNDAFGLLLEYLRKEYDYVIVDTPPLGSVID
GAVAARYCDGTLIVIESGAISYKFAQKVTEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGLKSGKAAKGEENTHSHEIKNGSDPVKEKIPEESQIPEDDMIQLDIDMVELTEDTEPIEELR
>gnl|bykdb|F7K9V1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_57FAA_CT1] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNSEEGGLH
AAVVQKGTKGAKAVKGEGNLHSHDNKSTRESGKEKAAEEDVIAEDDMIQLDMDMVELVEDTELIEELK
>gnl|bykdb|F7KL96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_57FAA_CT1] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVILVDADLRKSVLKG
RYKSNASRYGLSHYLSGQASISDISCKTNIPNFYVIFSGPVPPNPSELLGNDAFQLLLEYLKKEYDYVVVDTPPLGSVID
GAVAAQHCDGTLIVIESGAISYKFAQKVTEQLKKVGCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGLKSGKTAKGEENTHSHENKNGPELVKEKNPEESLVPEEDMIQLDIDMVELVEDTEPIEELK
>gnl|bykdb|F7V792 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp.] (length=267 residues).
MEYRNQEGFERKSGSGENIIPKHSLEIEGIQELSYALEEAINRLRINVSFMGKKVRKIMVTSTFPNEGKSFIAQQLWRRM
AEAGIDSVLVDADLRNSTLADRCRMETDSGQPMGLSHYLANDCELEDVLYATKTEGAHIIPNLNNVVNPSILFEGDRMKS
LLDELTKTHRYVFVDTPPLELASDGQLLGTLCDGVILVVRADSTSKRLVQKSIHQIERSGCQLLGIVLNRAGSKKNSRYY
YGKEKYGYGYYRKSDYYGKHAAENAKS
>gnl|bykdb|F8DFF4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis] (length=230 residues).
MNTLEISKNKLQEIHKAEEYFNALATNIQLSGVDLKVIAVSSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSREKIQGLTDFLSGQSQLDQVLYTTEFPNLDIIESGQIAPNPTGLLQSKNFTMMMEALRRHYDYIIVDTPPIGVVI
DAAIIAQRCDGTVLVVESGTNRRKMVQKAKEQLEQTGTPFLGVILNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|F8DRU2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFHRTQQQSTDTMNNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QRVLLIDSDLRRPTLHATFSKNNQHGLTTILTSGTNSVDLHEIIQPSGVNNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGENTK
>gnl|bykdb|F8FCE2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus mucilaginosus] (length=225 residues).
MPQRSSKNNVIITEANPQSPISESYRTLRTNIDFSLVDNDNKVIMVTSTQQAEGKTTTAVNMAVAYAQTEKKVLIVDADM
RRPNVHNMFRRPNRVGLSNLLAGQYTVQELVTETHIPHLEMLSAGVIPHNPSELLSSERWVQFIEFAKNKYDVVIIDTPP
ALSLPDAQLVAGHSCGVVIVIDVGKVKREAVKKMKSNLEHAKGRILGVVLNNMNKKEAGTYAYQY
>gnl|bykdb|F8HDC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|F8KGP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKSLALTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
GYGYGEDTNK
>gnl|bykdb|F8LJ75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|F8LXJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus JIM 8232] (length=246 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKYDQKEGHSRA
HRRRKG
>gnl|bykdb|F9HC65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK1073] (length=234 residues).
MPTLEISKKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTATNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIDNLFVIQAGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDILKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYRKKK
>gnl|bykdb|F9HJP6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 056 str. F0418] (length=231 residues).
MPVLELSTKKKNSIQRTEEYYNALRTNIQLSGENIKIVSLTSVHPNEGKSTTSTNLAIAFARAGYKTLLIDADIRNSVMS
GVFKSSAKITGLTDYLSGKTDLSQGLCETDVKNLFVIESGQSSPNPIALLQSKNFDIMMNILRRYYDYVIVDTPPVGLVI
DAAIISQKCDASILVAESGSVKRKALQKAKEQLEQTSTPFLGVILNKYDVSNDRYGAYGAYGNYGNYGKKH
>gnl|bykdb|F9LZC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis bv. 2 str. SK95] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGAVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKK
>gnl|bykdb|F9M366 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis SK236] (length=230 residues).
MNTLEISKNKLQEIHKAEEYFNALATNIQLSGVNLKVIAVSSVKENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSRDKIQGLTDFLSGRSQLNQILYPTDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGIVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKEQLEQTGTPFLGVVLNKFNIKATEYGSYGGYGSYGEYGKK
>gnl|bykdb|F9MJW5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK569] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNVQLSGNDLKVIVVTSVDSSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVSSPNPTALLQSDNFGIMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVVESGAAKRREVQKAKSQLEQAGKPFLGVVLNKFDVQREKYGSYGGYGNYGKK
>gnl|bykdb|F9P1W8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis bv. 2 str. F0392] (length=224 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVNPGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTTIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGAVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGKK
>gnl|bykdb|F9PEU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis X] (length=230 residues).
MAKLELSEQRLHSVKKAEEYYNALRTNIQLSGDGLKVIALSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSDKFEAMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKDQLEQTGTPFLGVILNKFNIQLEKYGSYGSYGNYGSYGKK
>gnl|bykdb|F9PZP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis SK970] (length=230 residues).
MAKLELSQQRLNSVKKAEEYYNALRTNIQLSGDGLKVIALSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSEKFEAMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKDQLEQTGTPFLGVILNKFNIKLEKYGTYGGYGNYGAYGKK
>gnl|bykdb|F9Q345 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis SK313] (length=215 residues).
MARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMSGVFKSREKITGL
TEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVIDAAIITQKCDAS
ILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|F9UMZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDSSHHGYYGYNSGYGYYSDE
DK
>gnl|bykdb|F9UQ54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVSSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMSEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|F9VC44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus garvieae] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|G0LYN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus IG1] (length=242 residues).
MFKRKGQNITTTAPINLTTINEPKSVITEQIKTIRTNINFAATDKNLRTLMVTSAMLGEGKSTVSCNLAVEYAKEGMQVL
LVDADLRRPTIHTTFGLENHKGLSSWLANQMDNVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKVQANILGAVLNDVRDGSHHGYYGYSSGYGYYSDE
DK
>gnl|bykdb|G0M0F9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus IG1] (length=238 residues).
MGLKRLKRKTTAETSGVQLTTITAPMSVVTEQIKTIRTNLNYAMVGKPLKTLMVTSAIQGEGKSTVAGNLAIEYAKKGLQ
VLLVDADLRRPTVHQTFGVPNQRGLSSWLSGQLEDVNDAIHPALAHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLD
LVIVDAPPVLPVTDARILAGQVDGTMLVVRQNGVEKTAVRQAVGALKKAHTQLLGAVLNDVDVKTHGYGYGYYGNDAN
>gnl|bykdb|G0M1X9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus IG1] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|G0V447 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloramator australicus RC3] (length=225 residues).
MKPILLKNPKSPISEAYRTLRTNVQFSSVDKNLKVILVTSSGPSEGKTTTAVNLALSFAELNKKVLVIDCDLRKPTVHKR
FNLSNQKGLTNLFVEDITFEETVQRINDNLYVLTSGILPPNPAEMLSSSKFKSFIENLRQSFDVIILDTPPVIAVTDAQV
LSTISDGVILVVSSGQADKEAAKRAKELLESVRANIIGVVLNKVEINSRNKYGYYYYYGEAEGKK
>gnl|bykdb|G0VNK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera elsdenii DSM 20460] (length=232 residues).
MAEIDFITHYDSRSPVSEAYRAIRTNLQFAGAGKQLKTLVFTSAIPGEGKSTTVANLAIAMGQDDKKILLIDCDMRKPVV
HRRFGLLNRGLSNCFAEDLPLKEVIQADVFPNLDVVTSGPVPPNPAELLGSKKMEALLQEAAETYDYVFLDMPPVLAVTD
AALMSSRVDGTVIILGSGDIGPDEGKQAKSLLEKVHANILGVILNKVPQHHKSGYYYYYYYDENHNKKRKRR
>gnl|bykdb|G1WUK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea formicigenerans 4_6_53AFAA] (length=273 residues).
MDQERRSQREMMQENEKQAKTTYTNAQAKAAMSRRDNKASKLRVELTDPRKSNYFYEEALKTLRTNIQFAGADIKTILVT
SCFPNEGKSDVAFQLAREMGMAGKKTVFLDADIRKSVLVQRYFVDSDVKGLSQYLSGQAPVRDILYGTNYENVDMIFAGP
MAPNPSELLNGRVFAKLMGELKQRYDYVLIDTPPMASVVDAAIVGKVCDGAILVIESGFVGYRAAQKAIKQLEKSGTHML
GAVLNKVDTKKEKYYSYYSYGSKYGYGQNHENE
>gnl|bykdb|G2FM59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. OT] (length=235 residues).
MAYSLITLEQTKSPISEAYRMLRTNVQFTSVDLDTQKIMITSSGPREGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQH
KLFGLDNGTGLSVSLVQDQDYCNYIRETDVPGVMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMILIDTPPVIAVTD
AAILAQEVDGVILVLAAGEVNKGYAQKAKEQLDKLGVKILGAVLNKVGMNTKEYYYYYYYNASDDTKKKHNRRSL
>gnl|bykdb|G2FWT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. OT] (length=236 residues).
MAYSLITLEQSKSPISEAYRTLRTNVQFTSVDSETKKIMITSSGPREGKSSTVANLAVSIAQAGKSVIVVDADMRNPTQH
KLFGLDNGQGLSVALVQDQDYRQYVQETAVPGVMVLTGGPIPPNPAELVGSKRMKRLIEEFSEQFDTVLIDTPPIIAVTD
AAIIAQEVDGVILVLASGEVNKEFAQRAKEQLDKVGAKILGAVLNKADMKTSEYYYYYYYHGSDDSAKKPKRHKAR
>gnl|bykdb|G2FWX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. OT] (length=235 residues).
MAYSLITLEESKSPISEAYRTLRTNIQFRSVNSENNKIMITSAGRREGKSFTVANLAVSMAQDGKSVLVVDADLRNPTQD
KLFGLDNGKGLSVALTQDQDISQYIQETSVPGVMVLTAGPVPLNPAELIGTVRMKQLVKEVSELYDMVLFDTPPIIAVTD
GSILAQEVDWVVLVMDLGEENKNYVQHAKELLDKVDAKFLGAVLNKVDMKPSEYYYYEYNESKHPKKRHRRHKAG
>gnl|bykdb|G2KUP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sanfranciscensis] (length=247 residues).
MIMSLFRKNKKLDDNTMKNGAPLIVEYKPISPIAEQFRTVRTNIKFSIVANQNKVVSITSANPSEGKSVFISNLACTFAE
QGEKTILIDADMRRPTVYKTFMVSNQNGLSTYLSGNSNLDESILKTDVDNLDVMVGGPVPPNPAELIGSDRFKNLLNTLS
KDYEWVLIDTPPVNSATDASLIAAASNGTIIVVPQGIADKSSVKVAVEQLKKVNAKILGSVMNRVNAKESAGYGGYYGGG
YYGVDDK
>gnl|bykdb|G2MWC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter wiegelii Rt8.B1] (length=237 residues).
MVAARNLIVADPKSPFAEAFRALRTNLQFTSVDKKVKSILITSSLPNEGKSTVVKNLAYSVALTGSKVIVIDADLRNPTV
HKTFNLPNSRGLTNLLIDEGDYEAYLNIDNSYNNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTV
TDAVVLAPVVDGVILVIQAGKTEIEAISRAKEILESVKANILGVVLNRVKESHRGYYYYYYYYYDDNKPQHKKRRKR
>gnl|bykdb|G2TR25 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans 36D1] (length=247 residues).
MVCTVQEKKQKERLRRLAPKKTKLLNTRRKLIAKLNPKSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTIVG
NLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGLTTVLTKQGTLEETAVKTDVDHLHVLTSGPIPPNPAELLSSKAM
KEFFKEAKEQYDIILLDTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVEAVKKAKELLESANANLLGVVLNNKKTQNTHY
YYYYGKD
>gnl|bykdb|G2Z8Q3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria ivanovii] (length=221 residues).
MPKERSKLLIKHQKGSKTAEQFRMIRTNIEFISKQRMLKIMMITSTKPQEGKSTIIANLADVMGRQELKVLIIDADLRLP
SQHYILGVDNSIGLTDILEETIQSQNAIQKTSLYNVDLISAGQVPHNPSELLSKPILRKLLKEAKDYYDYILVDSPPVIV
ADTTIISQQMDGIIMVAEESKTQKQKFHKALTTLRSTHTPIIGIILNKTKQDKSSKYYYYN
>gnl|bykdb|G3G7C1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQLNEGKSTIAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVI
DAAIIAQKCDAMVLVAGAGHVKRSAVKKVKEQLEQTGTQFLGVILNKYDIATEKYGDYGNYGNYGKKA
>gnl|bykdb|G3G7G6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=227 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSRTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYGNYGRK
>gnl|bykdb|G3G7I8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGYVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSEYGNYGNYGKKA
>gnl|bykdb|G3G7J4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSEYGNYGNYGKKA
>gnl|bykdb|G3G7J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQLNKGKSTIAASLAIAYARSGYKTVLVDADIRNSVMS
GFFEPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVI
DAAIIAQKCDAMVLVAGAGHVKRSAVKKVKEQLEQTGTQFLGVILNKYDIATEKYGDYGNYGNYGKKA
>gnl|bykdb|G4EQF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. subtilis str. SC-8] (length=227 residues).
MQRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALATCKSKLLGAIMNGKKLSKHSEYGYYGTKDNFMQK
>gnl|bykdb|G4EQZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. subtilis str. SC-8] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|G4L594 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus halophilus] (length=233 residues).
MKRKNERKGTQTHAVSLVSLIDPSSPVAEQYRTIRTNIQFASSADQQVKTIVVTSSGPSEGKSLSSANLAAVFAQTGQKV
LLVDADLRKPTIHKTFQLNNEAGLSTVLSTGVKAGETAQKTAVENLSILTSGPKPPNPSELLGSAKMNQIMEEARNIFDI
VIFDMSPVVAVTDAQIMSSKADGTLLVVRENWTRKDALSKAKELLDLVQARVLGVIYNGSEQGKDKAYYYYSD
>gnl|bykdb|G4P114 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|G4P1M7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=238 residues).
MALRKSSGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHFENMIGLTTVLLKKSSLEQAVQASNATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|G5F9A9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 7_3_54FAA] (length=233 residues).
MDNEVFLKRTAIEDYQYNEAMKTLRTNIQFSGTGIQVVMLTSSVPGEGKSETTFHLAASLAQLDKKVLLIDADIRKSILV
TRYQLDRRVDGLSQYLSGQKKLEEVVYKTNLPNLTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLI
DGAIISRNCDGAILVIESGNISHRLLQKVKGQLEKSGCRILGAVLNKVDVRQNSYYYYGKYGKYYGKEYSSEH
>gnl|bykdb|G5F9E2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 7_3_54FAA] (length=239 residues).
MGKEISLMRDQKEDYQYEEAIKTLRTNIQFSGTNLQVIMLTSAVPNEGKSEISFSLASSLAQIDNRVLLIDADVRKSVLV
TRYKLDRKIEGLSQYLSGQKKLEEVIYTANIPNLDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTII
DGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQLERSGCRILGTVLNRVNMQVQGYYRYYGKYGRYHYVYGYGYGRENKK
>gnl|bykdb|G5F9H2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 7_3_54FAA] (length=257 residues).
MHDEIVIEDLISPDERGMGELVLKGFEVNDYQYEEAMKTLRTNIQFSGSNIHAVMFTSSAPNEGKSETTFQLAASMAQLG
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
YGYGHENAKQGKEAKVL
>gnl|bykdb|G5GFW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Johnsonella ignava ATCC 51276] (length=253 residues).
MDIRGQNGTVKLRPPNKEDYFYNEAIKALRTNIQFCGNNIHVIMITSSIPGEGKTMTSFALARSFSQIGRKTLFIDADIR
KSVMLTRYQVDIDVYGLSQYLSGQIKLEEVIYSTNIEDMDIIFSGRFAPNPAELLEEELFIQLIDRASKEYDYIIIDTPP
MANVIDSAVIAKSCDGAVIVIESGKISYKTAQKVKLQLEKSGCRILGAVLNKTAVQERGYYAKYYGGRNKYKYSKDTEQA
GRSKWIQRDKAER
>gnl|bykdb|G5HG45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-17108] (length=249 residues).
MKQIITLNRDMKDDYHYNEAIKTLRTNIQFCGNGIRTIMLTSSLPDEGKSDITFAMAASLAQIGKKVVMIDADIRKSVLV
SRYQLETEVYGLSQYLSGQKTLADVLYDTNVENLSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYSRYGKYGKYSKYGKYGKYGK
YEKYEKAEA
>gnl|bykdb|G5HNC5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-17108] (length=247 residues).
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
QILDEAR
>gnl|bykdb|G5HTB2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-17108] (length=231 residues).
MDQILNLKNTGEKNYHFEESIKTLRTNMQFCGSSLKTIMFTSSLPNEGKSEITFSVAASLGSIGKKVLMIDADIRKSVLI
KRYEIKGNPNGLSQYLSGQKSLDEICYATDVENFDIILAGPYSPNPAELLEDSLFRELLEKAKERYDYIIIDTPPMANLI
DGAIIANQCDGAVIVIESGTISYHLVQKVKGQLEKSGCRILGAVLNRVDKEYENGYYKKYYGKYYGKYGEA
>gnl|bykdb|G5IFS3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi WAL-18680] (length=235 residues).
MEQIRFRKREQLDFRATEAFKALRTNILFCGDNIKVIGLTSSTPDEGKTSVSVQLATSFAEAGKRVLLIDADIRKSVILG
RYRINKEVFGLTHYLTRQRGKREVIYNTNIPGMDIIIAGPVSPNPTELLSGRLFEQLLQSERDNYDYIIVDAPPLGSVID
AAIIAKHIDGAIIVVESGAISYKLAQNVKSQLEKSECRILGVVLNKMDLEKNGYYGSYYGKYYGKNYGNYGDYGN
>gnl|bykdb|G5IRQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus saccharolyticus 30_1] (length=234 residues).
MAKQQERKGTQTHAVSLITLVDPSSPISEQYRTIRTNIQFASSADQQIKTLVVTSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVHKTFNLLNNVGVSTVLSTSTNLAEAAQQTVIDNLSILPSGPKPPNPSELLGSSRMNQVMAEAKKLYDI
VIFDMPPVVAVTDAQIMASKADGTILVVRENVSRKEPLTKAKELLNMVQARVLGVVYNGAENSKDSGYYYYYGN
>gnl|bykdb|G5JTD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus criceti HS-6] (length=246 residues).
MGYLELSSKQEKTIDKAEEYYNSIRANIQFSGSDIKVIALTSVQPKEGKSTTTMSLAVSFARAGYRTLLIDADTRNSVMM
GSFKPDGPVKGLTDFLSGNADLQTTISRTNIPNLTMIPAGQVPPNPTALFQSDNFKRMIEAVREHYDYVLLDTPPIGKVV
DAAIIAQDCDASVLITEAGVIRSRFVKKAIEQMEKSGAQFLGVILNKVDEKSENYGNYGSYGSYGDYGKRTAVTRTNHAS
HTRRSK
>gnl|bykdb|G5KAJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pseudoporcinus LQ 940-04] (length=242 residues).
MAQLDLIRSKRDLFLAAEEYYNSIRTNIQFSGRDLRVIVLTSVQPGEGKSTSSINLAVSFANAGFKTLLIDADIRNSVMS
GTFKSDEKYEGLSSYLSGNADLSHVISHTNISNLMIIPAGQVPPNPTTLLQNNNFNYMIDTLREVFDYIIIDTPPIGLVI
DSAIVAQKADASVLVTEAGVIKRRFVQKAKEQMEQSGAQFLGVILNKVEHTVDSYGSYGSYGNYGKKEKPRKHVRKSSRK
RK
>gnl|bykdb|G5KD11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus urinalis 2285-97] (length=251 residues).
MSHLELVRSKQELYNTAEEYYNTIRTNIQFSGRDLKVIVLTSVQPNEGKSTTSVNLAISLAKAGLKTLLIDADIRNSVMS
GTFKSDSKYEGLSSYLSGNTELSKVIVSTNIDKLMVIPAGQVPPNPTTLLQNAHFNQMIETLRGIFDYIIIDTPPIGLVI
DSAIVAQKADASILVTQEGVIKKRFIQKAKDQMEQSGATFLGIILNKVENTVDSYGGYGAYGGYGAYGAYGSYGSYGKEN
EKSRKASRRRK
>gnl|bykdb|G6A745 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus intermedius F0395] (length=230 residues).
MPRLELAKNKEKALKKSEEYYNALRTNIQLSGENIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GVFKTRDKITGLTDYLAGAADLSNGLCDTNVENLFVIEAGQISPNPTALLQSKNFGMMVDILRNHYDYIIIDTPPIGIVI
DAAIIAQKCDASALVVESGNVKRKALQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGDYGNYGKK
>gnl|bykdb|G6C7Z1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 058 str. F0407] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVYKHSPYGNYGDYGKK
>gnl|bykdb|G6ERT1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus CNCM I-1630] (length=249 residues).
MPLLKLVKSKVDFAKKTEEYYNTIRTNIQFSGAQMKVIAISSVEAREGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPIPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMFI
DAAIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSNQKEGHSRA
HRRRKVGWN
>gnl|bykdb|G6F8G9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus CNCM I-1519] (length=244 residues).
MKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGKKTILVDADLRRPT
MHSTFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLAPI
LDAGETQQLTSSLDGTILVVRQAHSQKLAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYGYGYGEEKEKKGLF
GRKK
>gnl|bykdb|G6FD42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis CNCM I-1631] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNKVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|G6J8A4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae GA47502] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|G6LKG5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae GA44500] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|G7M0Q3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=229 residues).
MKIRNKKNKNKKNIFSVEDKPKSVVSEAYKTLRTNIQYSSFDNEIKSLVITSAEMAEGKSTVAENIALTFAQGEKRVLLI
DCDLRKPSVHVNFNVSNLVGISEVLLGKVPIEEAVQGYNEKLFVLTSGKIPPNPSEMLASLAMTYLIEKLKQDYDMIILD
TAPLNLVTDAQILSAKVDGTILVVRAAKTKKDVVIEAKSLLDKVGANIIGTILYAAENKYNKKYCYYES
>gnl|bykdb|G7M1R9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=240 residues).
MFKARKLEKAVASQQYRGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKQIRTIVVTSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKVSNLKGLSEVLIGKEELDNVVLKRNDNLDILTSGKIPPNPSEMLSSSSMTKLIEALRERYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAKRTSRESVIDAKRLLDKVGANILGTVLHAVENTRGKYYYYYGTKDDEKKN
>gnl|bykdb|G7M566 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=246 residues).
MSVLEAIKHYKKGKDNNTIDDRIHAGFIVEEKPKSVVSEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAL
TFAQSDKKVILVDCDLRKPSVHKNFKASNLVGISEILIGKVSIEEAVQKRNDNLYFLTSGKIPPNPSEMLASSAMSNLIE
ELKKRYDFVVLDTAPIKAVTDAQILSTKVEGTILVVRAAVTKRDAVIEAKNLLDKVGANIIGAVLHAVENTRGKYSNYYG
NEEDKE
>gnl|bykdb|G7SG34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis D12] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|G7SNU6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis ST1] (length=225 residues).
MAMLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSDYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSGYGNYGKKA
>gnl|bykdb|G7W773 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus orientis] (length=234 residues).
MTLITHEQTKSPISEAYRTLRTNVQFTSIDTKTKRIMVTSSGPREGKSTTVANLAVSMAQSGKSVLVIDADLRNPTQHKL
FELENFEGLSNFLVQDDQDKDFIRETAVPRVKVLTGGPIPPNPAELVGSQRMKRLIEEVSELYDVVLIDTPPIIAVTDAA
VLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADLKTSEYYYYYYYHGSDDPKKKRTRKNRS
>gnl|bykdb|G7WJV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus orientis] (length=226 residues).
MVYSLITFEKTKSPISEAYRTLRTNVQFTNVDSNTQKIVVTSSGPGEGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQH
KLFGLDNRVGLSIYLVEDGDYGGYIRDTAVPSVRVLPAGPVPPNPAELLGSKGMEHLLEGAGGEFDMVLIDTPPVIAVTD
ALILAQEVDGVILVLASGEVDKGYAQKAKGLLDKLEIKILGAVLNKVGMNSHEYYYYNYYNSAKDM
>gnl|bykdb|G8DTZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|G8DU07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|G8DU31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSDYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSGYGNYGKKA
>gnl|bykdb|G8DUB0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYLNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|G8MZ93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus thermoleovorans CCB_US3_UF5] (length=232 residues).
MARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|G8P3D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris A76] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTESANLAVAFAQQGKKVLLID
GDLRKPTVNLTFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLI
DTPPLSAVADAQILSSYVGGVVLVVRAYETKKESLAKTKKFLEQVNVNILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|G8PE06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus claussenii] (length=245 residues).
MSIFNRKRKLDDESLKNGVGLIAYTEPASVIAEQFRTIRTNIKFSAIDQKLKTIVFTSSAPSEGKSTVSNNVAVTWAVQG
RKILLVDADLRRPTVHRTFSQNNAKGLSTLLSGNVDMDTAIHETPIKDLSIMTSGPIPPNPSELLGSERMGEIMKSLSEK
FDVVIIDAPPVNTVTDAQVLAARADGTILVVPQGYADKAGVRHAKQLLDVVHAKILGAIMNRVTAEKSTGYYGGNYGGYY
GTGGK
>gnl|bykdb|G9M880 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Firmicutes bacterium] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTSSANIAVAFAQQGKKVLLID
SDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|G9QCG3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7_6_55CFAA_CT2] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|G9QKR4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus smithii 7_3_47FAA] (length=230 residues).
MARKTKKIDNKRKLIAKLNPKSPISEQYRTIRTNIQFASADGELRSFMVTSASQGEGKSTTAANLAIVFAQQGKRVLLVD
SDLRKPTMHYTFRVTNTVGLTNVLTRQASLVEAVQATDVEKLDLLSSGPIPPNPAELLSSRMMEQMLAEAYKQYDLVIFD
SPPVLAVTDAQVLANQCQGTVLVVKSGVTELESALKAKELLQAAKAKLLGAVLNNKALKSSSYYYYYGDK
>gnl|bykdb|G9RSY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Subdoligranulum sp. 4_3_54A2FAA] (length=222 residues).
TPFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPVIHRYLKIDNSAY
KGITSALADGSLAESIINMKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVTDAAVLSQYAD
GVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENADR
>gnl|bykdb|G9WIQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oenococcus kitaharae DSM 17330] (length=580 residues).
MPSKRKAKKASAVDLRSSRYGVPLITLDDPQDVVSEQFRVLRANIDFAAATINHFQTILFTSSEMSDGKSTVAQNLAVTW
AQTGKRVLLVDADFRRPTIHKTFGLTNDRGLTTVLAMNDQPAEIINTSEQSNLFIMTSGPMPPNPSELLASDKMVQIIDW
MRRNFDLVVIDSTPLLLVPDAQSLIPRSDGVVLVATLGKTKKKSLLEAAHILTLARAHLLGLVSRDPERAEKAYGYGYGY
GYTTTNVMSSDAMKRASNAQVHQNTHHHRPEKKSETVQNQAKSTEVTPTKAVVEPTKVWSSFEATNRIASRQTKTPPAPS
AAANEETTAKVLPMVDIHAHLLPDPTRGPVTIDNSLQAARAAVADNIQTLVVTPYQSADKMANTADDIQAAIAPLRNSIK
EAGIPINILPGQVVPLTANLLAAFDHGNLLTLADSKKFLLVELPEDQIPKIAASVIFQLKTRGVTMIIAHPETNRAVLAN
PGQLNHLVEQGAILQVAAASINGQFGSEVADLALDLVRRGLAATVASGADSSEMNQRYHLSDAYALLTRAVGRRSVDILK
KNAIRIIGGLPVDSMAAEEF
>gnl|bykdb|H1BJT1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. 3_1_31] (length=224 residues).
MSKNKNTYKFDNMEAFRKLKTNIEFSAVEKPIKVVNITSSCANEGKSTVAFHLAQVYAAKYKKVLVIDCDLRRPKMHRYF
QISNQVGLSDLLVFIDKQPDLSTYIQEVTVTDCENAISVLTSGSKVPNPQELLGSSKFKKLLQALSKQYDFIILDCPPIS
MISDTFYVSNVSDGTIFVISMKDTKKDIALSSIRQLERSRSKILGIVLTKTQNLSSYDYYYTYE
>gnl|bykdb|H1LCW3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kisonensis F0435] (length=251 residues).
MNIFHRKRKKLSTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKTLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYGYGYDNEGK
>gnl|bykdb|H1WR06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc citreum LBAE C10] (length=252 residues).
MAFFKKNKALGDGLSAETMTKGARLIAAAEPKNPVSEQFRTLRTNIDFASVAKGNVKTLLVSSALPSEGKSTITANLAVV
YAQQGKRVLLVDADLRRPTVAITFDVTDNHGLTNYLADVHSELGSIIHHTRMDTLDVITSGPVPPNPAELLASARMTTLI
TQLRDHYDLVIFDVPPFLMVTDAQVLMSRMDGVAIVVSGGKVTKGALQRTSEILKIAGAPVVGFIYNDQNQKKKAGSGYG
YGYGYGYGDAKS
>gnl|bykdb|H1X4N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Weissella confusa LBAE C39-2] (length=257 residues).
MSFFKKRSSVDKDGLSVETMTTGARLITAAEPKNPVSEQFRTLRTNIEFAAVSRGEIKTLLISSALPSEGKSTVSSNLAI
VYAQQGKKVLLVDADLRRPTVSVSFGLNRNSVGLTNYLGDSHKEISYVVHHTAMDNLDVITSGPIPPNPAELLGSGRMTE
LVTQLKSQYDLIIFDVPPFLMVTDAQVLMSKVDGVAIVINGGKTNKGALQRTNEILKIAEAPVLGFIYNDQSRRKKGSSV
YGYGYGYGYGYGETKTK
>gnl|bykdb|H2A602 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus macedonicus] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQSGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSKERYQGLTSFLSGNAELSDVICDTNIDNLMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLLVVKAGADKRRTVTKLKEQLEQSGSAFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|H4GK03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gastricus PS3] (length=251 residues).
MGLFSRKKIQSVDTMVNGANLVTLTKPQSLVAEQFRTIKTNITFMGVDHPIKALAFTSSNISEGKSTVTANVGVTWAQDN
KRVLMVDADLRRPTMHSTFDLDNRQGLTTLLMDQEHVINSQDVIQATEVPNLDVLTVGPVPPNATGLLNSQRMRDLVATF
EQMYDVVIIDVPPILEVNDTQVLSSMLDGVVLVVRSGVTQKVAIKRAVEMLNISKANLLGYVMNDVASGDDDGYGYGYGY
GYGYGTVEPED
>gnl|bykdb|H5XZD4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus youngiae DSM 17734] (length=236 residues).
MVYSLITFEQTKSPISEAYRSLRTNVQFTSVDSDTQKIVVTSSGPREGKSHTVANLAVSIAQSGKSVLIIDADLRNPTQH
KLFGLDNRAGLSVYLVEDQDYRKYIWETVVPGVRVLPAGPVPPNPAELVGSKRMKCLIEEVSGEFDMVLMDTPPVIAVTD
AAILALEVDGVILVLASGEVDKGHAQKAKGLLDKLGIKILGAVLNKVAMNTKGYYCYNYYNAADDTKKKQSKMAYL
>gnl|bykdb|H5XZG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus youngiae DSM 17734] (length=236 residues).
MSHSLITHEQTKSPISEAYRTLRTNVQFTSVDSKTKKIMITSSGPREGKSTTAANLAVSIAQSGKSVLLIDADMRNPTQH
KLFGLSNMEGLSVSLVQDQGSHAFIKETEVPGVSVLPGGPIPPNPAELVGSKRMKHLIEELSGQFDVVIIDTPPIIAVTD
AAIIAQKVDGVILVLASGEVNKDFALRAKDQLDKVGAKILGAVLNKADIKTSEYYYYYYYHGSDDPGKKRKSRGNP
>gnl|bykdb|H6LKR8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetobacterium woodii] (length=238 residues).
MNLASLITLNDPTSHVTESYKLLRTNLNFINLENKYQVLLFTSAAKEEGKTTTIANLAITLAQSGKRVLLIDADLRLPRI
GKIFDISLNQPGLSNMLVDGLIFDSVLNKVKDLEKFEILTAGDRQVSPTELLNSDAFEQLIIACRKEYDIILIDTPPVLN
FADASIVSKVADGSLLVVAANETKKAMIVEAKKTIDKVGGVLLGVILTKVKFKKSSDYYGYGEDKGHSKKEKKLKKKK
>gnl|bykdb|H6NE43 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus mucilaginosus 3016] (length=225 residues).
MPQRSSKNNVIITEANPQSPISESYRTLRTNIDFSLVDNDNKVIMVTSTQQAEGKTTTAVNMAVAYAQTEKKVLIVDADM
RRPNVHNMFRRPNRVGLSNLLAGQYTVQELVTETHIPHLEMLSAGVIPHNPSELLSSERWVQFIEFAKNKYDVVIIDTPP
ALSLPDAQLVAGHSCGVVIVIDVGKVKREAVKKMKSNLEHAKGRILGVVLNNMNKKEAGTYAYQY
>gnl|bykdb|H7F1R7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=224 residues).
MLKLSERKLITYANPSSPIAEQFKTLRAGIHFSSADHKYKTILITSTEPESGKSTVSANLAVVYAQHGQKTLLIDADMRK
PTGHLTFRIRSNIGLSNLLASSDLAAEEVCSQTAIENLDILTSGTLPPNPNELLASKKMGQILEELASCYDQIIIDTPPI
LASSDALVLTSYVNGVILVLRSDKTLKERAKIAVEQLRNTHVHIIGTVLNYVKSDSDNYYYYYQ
>gnl|bykdb|H7F571 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=224 residues).
MGERTSGGKNLITIVNPNGPISEQFKTLRTGIHFSSVDTNYKTIMVTSPEPGSGKSTISANLAVCYAKQGIRTLLIDADM
RKPTVHRAFGIRVNIGLSNLLTGDVEYDEVFRETEIDNLFVLTSGTIPPNPNELLASKKMGKFMQQFIQDFDQVIVDTPP
ILASSDALVITPYVDGTVVVLRSEKTLKDRAKIAIDQLRKTKIPIIGTVLNCVKNRVDNYYDYS
>gnl|bykdb|H7F5T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=232 residues).
MKKTDKKDLKNRLVALHEPSSPQAEYFRTIKTNIEMMNIDSKVKSLLITSPTQDSGKTMISVNLASTYANDGVKTLLIDL
DLRRPSLGFAIPIVKASPGLTGILDSSQNLTPEDVIVPVTDTNLYVLPVGARPLSPYSILNSAKLGQLIEQLKEIFDMII
IDTPPVMMVKDALLVSKWAEASVLIARGGYSNKIDIKKSLKNMQDANANILGVIFNNPQMKQDHYYYPESEV
>gnl|bykdb|H7F6C8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=219 residues).
MSNTKRNKRRKDSYSPTSEQFKLIRTGIDFSGIDEKKQVILITSPESGTGKSTVSSHLAVAYAEKGARTLLIDADMRKPT
LHKRFSKNLHLGLSNVMTGDISLEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMSELIEALRDSFDKIIIDTPPVT
IVSDALVLADSADGTVLVCRYHKTLKEKAKHAVNQLRLSKAKLIGVIFNGTKNAENYYY
>gnl|bykdb|I0BSG4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus mucilaginosus K02] (length=225 residues).
MPQRSSKNNVIITEANPQSPISESYRTLRTNIDFSLVDNDNKVIMVTSTQQAEGKTTTAVNMAVAYAQTEKKVLIVDADM
RRPNVHNMFRRPNRVGLSNLLAGQYTVQELVTETHIPHLEMLSAGVIPHNPSELLSSERWVQFIEFAKNKYDVVIIDTPP
ALSLPDAQLVAGHSCGVVIVIDVGKVKREAVKKMKSNLEHAKGRILGVVLNNMSKKEAGTYAYQY
>gnl|bykdb|I0F9R6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. JS] (length=228 residues).
MRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELADEASVAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALESCNSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|I0GRR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Selenomonas ruminantium subsp. lactilytica] (length=242 residues).
MANIDLIVHNDAKSPISEAYRAIRTNLQFAGAGKMIKFISFTSATPGEGKSTTISNVAIAMAQDGKRVLLIDADMRKPVQ
HKKFRLQNKGLSNIIATGESLESMIQNNVIQNLDVLPSGPVPPNPSEMLGSERMDNLLKTVGENYDYVFIDMPPILAVTD
ATIIGTKMDGVVFVVRSGKVTPDEAKEAKQRLVQSQVNIIGTVLNGVPKKNKAGYGYGYGYYYYYDEKHEKHKGRHKSKQ
KD
>gnl|bykdb|I0J9C9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDDLKVFSITSVKLGEGKSTTSTNIAWAFAHAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITQKCDASILVTEVGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGGYGNYGNK
>gnl|bykdb|I0JRK4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus halophilus] (length=232 residues).
MALSKKKKNQQTSVRSIIANDNPKSPIAEQYRTIRTNLQFASVDKELETMIVTSAGPSEGKSLTTANVAVVFAQQGKKVL
LVDADLRKPTVHYTFRADNTSGLSNYLVRNRSLKELAKESRVENLDLLPSGPIPPNPSELLGSTMMEKLIEEAKEHYDMI
IFDTPPVLAVADSQVLSKFVDGALLVVRSKQTEQEAAGKAKEQLEQSRANILGVVLNDMDAKDSNYYYYYGN
>gnl|bykdb|I0QIK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius PS4] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNIAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNATLEETVCRTDIAGLDVISSGPIPPNPTSLLQNENFTHLLDVARSQYDYVIIDTPPIGLVI
DAVIVAHQADASLLVTAAGKIKRRFVTKAVEQLTQSGSQFLGVVLNKVDMTVDKYGTYGSYGAYGDYGKKSEQKSSHSRS
QRRRKG
>gnl|bykdb|I1ZPH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis FW213] (length=230 residues).
MNTLEISKNKLQEIHKAEEYFNALATNIQLSGVDLKVIAVSSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSREKIQGLTDFLSGQSQLDQVLYTTEFPNLDIIESGQIAPNPTGLLQSKNFTMMMEALRRHYDYIIVDTPPIGVVI
DAAIIAQRCDGTVLVVESGTNRRKMVQKAKEQLEQTGTPFLGVILNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|I2CAF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens Y2] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|I2CB16 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens Y2] (length=229 residues).
MLTRKKDKPGKRSVIAMTEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAAAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|I2HVL2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 5B6] (length=229 residues).
MRRLGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVL
LVDADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLV
IFDSPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|I2HW53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 5B6] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAAAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|I3EBB3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus methanolicus] (length=233 residues).
MVLKNKKKALLQHKRKLITKLNPKSPISEQYRTIRTNIQFSSIDKEIRSLIVTSPGPGEGKTTTIANLAVVFAQQGKTVL
LIDADMRKPTVHYTFNLMNTIGLTNVLTRQMDLMEAVVQTDEKKLYVLPSGPIPPNPAELLGSKAMDEFLERVYEEFDVV
LFDTPPILAVTDAQIMANRCDGTILVVSSGKTEIEQAIKAKEMLQAANARILGVVLNNKKVKGNQYYYYYGGK
>gnl|bykdb|I4DBG8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus acidiphilus] (length=239 residues).
MKHSLITLEQSKSPVSEAFRTLRTNVQFTSVDSQTKKIMVTSAGPQEGKSSTVANLAVSIAQTGKTVLVVDADLRNPTQH
KLFGLPNVEGLSVALVQDQDYINYARETSVSGLRVITGGPIPPNPAELVGSKRMKRLIEEASEQFDMVLIDTPPVVAVTD
ASILAQEVDGVILILASGEVNKDYAQRAKEQLDKVGAKILGAVLNKADLKTSEYYYYYYYHGSEDPNESKRKHKRQRAH
>gnl|bykdb|I5ASF8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] cellulosolvens 6] (length=246 residues).
MMLTNYVKLIDSEEGDCFYREEIKKLRANIVFTGRKYKKIMFTSCFQGEGKSDTVFHLAVDMTKLGKRVLLIDADIRNSQ
YVSRFGVKQHVLGLSEYLSGQVDEVNQIFYQTNYDNLFLIFSGAYASNPSEMLADESFGRLLAASAESFDYVFIDTPPLG
QIIDAAQIGRFCDGCIIVIESGAVSYRAAQKVKRQLEQADIHILGVALNKVDRTAAGAYGHYGKYGKYGKYGKYGRYGYD
KSAQTQ
>gnl|bykdb|I5AV01 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] cellulosolvens 6] (length=262 residues).
MDVIKIKQPDQDYFTREAYKTLRANFLFSGPEKKVIDVTSCSENEGKSTVSMQLAISLAQSGKRTLLIDADMRKSVLVGR
TGVSGKQIKGLAHALSGQCDGVDVVYATDIPNFFMIYSGPFPPNPTELLGGKIFHSMLDSLRKVFDYIIIDTPPLGSVID
SAVIAGHCDGSILVIAAEEVSRRFAMDVKDQLERANCPILGCVLNKASQENERYGRYGRYGRYGKYGRYGKYYGHYGYYA
ASDDSKDSGKTKGEKAKKRKKK
>gnl|bykdb|O06030 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=231 residues).
MAKNKRSIDNNHYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSETDEGKTTVSANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DIPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKKLEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|O87931 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=249 residues).
MPLLKLVKSKVDFAKKTEEYYNTIRTNIQFSGAQMKVIAISSVEAREGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPIPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMFI
DAAIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSNQKEGHSRA
HRRRKVGWN
>gnl|bykdb|P0C0T9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIASACDGFVLVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
>gnl|bykdb|P39851 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MAKKKSTISPLYVHDKPKSTISEKFRGIRSNIMFSNAENEIKSLLITSEKSASGKSILSANIAVTYAQAGYKTLIIDGDM
RKPTQHYIFDLPNNSGLSNLIINKTTYSDSIKETRVENLNVLTAGPTPPNPSELIASSKFATIFNELLNHYDFIVIDTPP
INTVTDAQVYARIVKNCVLVIDAEKNNKSEVKKAKGLLTKAGGKVLGAVLNKMPIDKNSSYYYYYGED
>gnl|bykdb|P71051 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|P72512 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGPVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|P95696 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|P96475 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=221 residues).
MPTLEIAQKKLEFIKKAEEYYNTLCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGELFLGVVLNKLDISVDKYGVYGRK
>gnl|bykdb|P96716 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=237 residues).
MALRKNRGSRMQRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALATCKSKLLGAIMNGKKLSKHSEYGYYGTKDNFMQK
>gnl|bykdb|Q03GL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus pentosaceus] (length=243 residues).
MFKKKQKLDNESLKNGVGLVTFTDPTSTIAEQFRTVRTNIQFSSVDKALKSIVFTSSAPSEGKSTVSNNVAVTWADQGKR
VLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGSLENAIHETIINNLSVMPSGPIPPNPSELLGSGKMAALLDQLTDHYD
LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYYGGYYGT
DNK
>gnl|bykdb|Q03W95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc mesenteroides subsp. mesenteroides] (length=252 residues).
MSFFNKGRAVGKDGLSVETMTKGARLITAAEPKNPVSEQFRTLRTNIEFASVAKGEIKTLLISSALPSEGKSTVTANLAV
AYAQQGKKVLLVDSDLRRPTVAVTFGLNKNASGLTNYLGDSEKEVGSIIHRTSMDNLNVMPSGPIPPNPAELLGSGRMTN
LITQLKTHYDMIIFDVPPFLMVTDAQVLMSKMDGVAIVVNGGKTNRGAIQRTHEILKIAEAPVLGFIYNDQSRKKKGSAG
YGYGYGYGETKA
>gnl|bykdb|Q04663 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae serotype III] (length=232 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGDYGNYGKRDRKRK
>gnl|bykdb|Q04DV8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oenococcus oeni] (length=585 residues).
MFSKKNPQKLSANDLRSSRYGVPLVTVQDPQNVVAEQFRVLRANIDFAAASLKNFKTVLFTSAEMSDGKSTAAQNLAITW
AQTGKRVLLLDADFRRPTLHKTFAVPNEHGLTTVLAMHEQPASVIHSTEIPNLYVMTSGPMPPNPSELLASDKMLRVVSW
MREQFDMVVIDSTPLLLVTDAQALIPRADGVVLVAMLDKTKRRSMATAAHILKLAKANVLGVVSRDQRRADKGYGYGYGY
GYTSTNVMKTNDASKASSRKTAPAKPKVLKASVTDASKVEQQVPSDTKKEASRPNAAASKTAPKSSWSSFSYTSTGSEKS
EASSKAKEPGPSNVQEISLVDIHTHLLPRADDGSDSMTTSLQLAKEAVQEGVHTIVASPNQMDGRYINDPDKVLSDVDNL
NNTLKRVGIDLRILPGQEIHLSDQFLTAFDQGRLLTLADSKKYMLVELPNDSVPPVIHQVISKLREHKITMIVAHPERNL
TLLNDPKELNKLARRGVLFQVTSSSINGFFGQEVADFALEMLRRGFVTTIASETHGVTSDQHYHLADAYAIANKLIGEGK
TNIIKQNAVLIVKGEPVDGTTIQEF
>gnl|bykdb|Q0SVR8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILEKNPKSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKKVILIDCDLRKPVVHKEF
QISNSRGLSEFLIGNVEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRSMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDGVIEAVKGLRAVKANIIGTVFNGEENQRGKYYHYYKKD
>gnl|bykdb|Q1G8E4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=257 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDREVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILVDADLRRPTMHSTFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSFLNGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGEEKEKKGLFGRKK
>gnl|bykdb|Q1WCR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=246 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKYDQKEGHSRA
HRRRKG
>gnl|bykdb|Q1WTC8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius] (length=220 residues).
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
>gnl|bykdb|Q2BFS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. NRRL B-14911] (length=234 residues).
MLFKNKPKASVNDSRRKLVAAYNTKSPIAEQYRTVRTNIQFSSVDQDVRSILVTSSGPGEGKSTTVANLAVVFAQQNKRV
LLVDADLRKPTAHYTFNLTNNNGLTNVLTKSSSLLKAVKETAIENLSVLTSGPIPPNPAELLGSQAMEEFLVNVQKEFDV
VLFDTPPILAVADAQILANKVEGTMLVISSGYTEMEQAEKATELLRTSKGKLLGAVLNQKKLQDSHYYYYYGGK
>gnl|bykdb|Q2FUV2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|Q2G1K7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|Q2KM74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus iniae] (length=239 residues).
MSQLNLVRSKREHYQHAEEYYNSIRTNIQFSGRDYKAIVLTSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILNKVDQQLGSYGAYGSYGDYGKTKKSSKSKKHSRK
>gnl|bykdb|Q38VG5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sakei subsp. sakei] (length=248 residues).
MGLFRKEKKLDQDSMKEGVGLITLTSPTSVIAEQFRTIRTNIQFSSIDQKLRSIVFTSSGPSQGKSTISANVAVTWADQG
VNVLLVDADMRRPTIHQTFQVPNKKGLTSLLTEDEFDFNTTIQKTPVEHLFVLPCGVVPPNPSELLNTKKMDKLIVELTK
HFDLVIFDAPPVISVTDAQILASKVDGTILVAPQGIADKRSVIKSKELLDVVHARILGTIMNRVKPENTGGYYGGYYGGY
YGAEESKK
>gnl|bykdb|Q3EV64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar israelensis ATCC 35646] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|Q3K0T0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae serotype Ia] (length=232 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVSESVATYGDYGDYGNYGKRDRKRK
>gnl|bykdb|Q3XYS6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium DO] (length=232 residues).
MARTQKQKVIQTHAVSLITLTNPSSPISEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSLGSVVDVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLNKAKGLLDMVQARVLGVVYNGAEHSKDVGYYYGN
>gnl|bykdb|Q3ZK50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSNGSANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDSFDVVLI
DAPPLYAVTDAQILSVYVGGVVLVVRAYETKKESLAKAKKILEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|Q4A120 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus saprophyticus subsp. saprophyticus] (length=230 residues).
MAKKIDTEITTLITHKKPKAVVSEKFRGIRSNILFSTADAEIQTLLIASDKPSSGKSTVSANIAVTYAQAGFKTLLIDGD
MRKPTQHYIFNKNNIKGLSNVIINKSTFEDAVYSTEVLNLDVLTSGPIPPNPSELIGSSNMMDLFEELKQRYDFILIDTP
PVNTVTDAQLFGELTKNAVYIIDVETNNKESVKKGKNLLEKSGTKILGAVLNKAQLDKSSSSYYYYGEES
>gnl|bykdb|Q4JYH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVSIARSFARAGYKTLLIDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDAFILVTATGDVNKRDVQKAKQQLEQAGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|Q4JYK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDDLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNRFDTSVDKYGSYGNYGNYGKE
>gnl|bykdb|Q4JYT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MPTLAIEQKRLDFAKKAEENYNALRTNIQLSGDNLRVLSISSVKPGEGKSTTSINIAWAFARAGYKALLVDADIRNSIMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNIENLFVIQAGPVSPNPTALLQSENFATMIDTMRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAARETKRRDILKAKEQLEQTGVPFLGVVLNKFNTEVEKYGAYGGYGTYGFYGNYRKG
>gnl|bykdb|Q4JYX9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDNLRVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEITRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4JZ18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEHYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDAQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|Q4JZ55 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MGKLELTRKYYQLYNETKEYFNALQTNIQLSGDGLKVISVTSTVKNEGKSTISVGLSMSLALSGYKVLLLDVDLRNSVMS
GMFHSRERITGLTEYLSGKAGMADSMQETTLDNLYILQAGVVSPNPLSLLRSVKFETLIDSMKKYFDYIIVDTPPIGQVI
DAAIIAQQCDGIFLVTEMRKTTRRQIFSSLQQLEQTGVPVLGLVANKAIIKKDSYGYYGKNTASETERY
>gnl|bykdb|Q4JZ84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFAYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|Q4JZG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKIGEGKSTTSANIAWAFARAGYKTLLIDGDIRNSVML
GVFKARNKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGDYGDYGKNKK
>gnl|bykdb|Q4JZK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKIGEGKSTTSANIAWAFARAGYKTLLIDGDIRNSVML
GVFKARNKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4JZL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEISHAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKIGEGKSTTSANIAWAFARAGYKTLLIDGDIRNSVML
GVFKARNKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSENFTTMLETLRKYFDYIIVDTAPIGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGGYGNYGNK
>gnl|bykdb|Q4JZS3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEENYNALCTNLQLSGDDLKVFSITSVKQGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4JZW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=224 residues).
MPTLEISQAKLDFVKKAEENYNALCTNLQLSGDDLKVFSITSVKLGEGKSTTSTNIAWAFAHAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGKK
>gnl|bykdb|Q4JZY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLAIEQKRLDFAKKAEENYNALRTNIQLSGDNLKVLSISSVKPGEGKSVTSMNIAWAFARAGYKALLVDADIRNSIMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNIENLFVIQAGPVSPNPTALLQSENFATMIDTMRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAARETKRRDILKAKEQLEQTGVPFLGVILNKFNTEVEKYGAYGVYGDYRKG
>gnl|bykdb|Q4K005 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEENYNALCTNLQLSGDDLKVFSITSVKAGEGKSMTSTNIAWAFAHAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEVNRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4K045 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MPTLEISQAKLDFVKKVEENYNALCTNLQLSGDDLKVFSITSVKLGEGKSMTSTSIAWTFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIPAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGGVNRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGKYGDYEKNKKYVEG
>gnl|bykdb|Q4K0A0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILVTATGEANKRDVQKVKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|Q4K0E1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIAWSFARAGYKTLLIDGDTRNSVMS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVTPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|Q4K0I2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLELAKKTEEYYNALCTNPQLSGDDLKVFSISSVKAGEGKTTTSTNIAWAFAHAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
DAAIIMQKCDASILVTKAGETKRRELQKAKEQLEQTGKSCLGVVLNKFDTSVDKYGFYGSYGSYRKQKK
>gnl|bykdb|Q4K0K2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVSPGEGKTTTSVNIAWSFARAGYKTLLIDGDTRNSVIS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEANKRDVQKAKQQLKQTGKLFLGVVLNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|Q4K0M3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDDLKVFSITSVKLGEGKSTTSTNIAWAFAHAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEVDEVNRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4K0R7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDNLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4K0T5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTEKLFLGVILNKFDVQHEKYGSYGGYGNYGKK
>gnl|bykdb|Q4K0V2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVNPEEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGFYGNYGKKII
>gnl|bykdb|Q4K0X5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSRGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|Q4K0Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|Q4K195 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEHYNALCTNIQLSGDKLKVISVTSVSPGEGKTTTSVNIAWSFARAGYKTLLIDGDTRNSVIS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGAVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGETNKRDVQKAKQQLKQTGKLFLGVVLNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|Q4K1B7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKIGEGKSTTSANIAWAFARAGYKTLLIDGDIRNSVML
GVFKARNKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4K1F9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVSPGEGKTTTSVNIAWSFARAGYKTLLIDGDIRNSVIS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEANKRDVQKAQQQLKQTGKLFLGVVFNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|Q4K1K6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q4K1M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVILNKFDVQHKKYGSYGDYGNYGKK
>gnl|bykdb|Q4K1S7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|Q4K237 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQVKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKFDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|Q4K254 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLEPVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSINIAWAFARAGYKTLLIDADMRNSVMS
GVFKPRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKFDTSVEKYGSYGNYGNYRKQKK
>gnl|bykdb|Q4K2A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEISQVKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKPRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPIALLQSRNFSTMLETLRKYFDYIVVDTAPVGVVI
DAAIIMQKCDASILVTKAGETKRRDIQKAKEQLEQTGKPCLGVVLNKFDTSVDKYGSYGSYGNDRKK
>gnl|bykdb|Q4K2E1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLKITQKKLEIVKKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
GVFRSSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGGYGNYGNK
>gnl|bykdb|Q4K2F7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEITQKKLEIVKKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
GVFRSSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGGYGNYGNK
>gnl|bykdb|Q4K2Q7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLLDGDTRNSVIS
GFFKSREKITGLTEFLSGTADLSHGLCDTNTENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGSYGKK
>gnl|bykdb|Q4L9H7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus haemolyticus] (length=233 residues).
MPKKNKEKRKKLSHPLYVHDKPKSVASERFRGIRSNIMFSGVEEANSIIVTSEKPAAGKSIVSANIAITYAQAGYKTLII
DGDMRKPTQHYVFETSNYDGLSNLIVGKSDFETAIRSTRVENLDLLTSGPIPPNPSELIASEKFENILNDLFKYYDFILI
DTPPVNTVTDAQVFMQYVKECVLIIDVENNNKDELKKAKSLIEKAEGRLLGAVLNKTPVDKSSSYYYYYGEDE
>gnl|bykdb|Q54520 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|Q55205 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGMVI
DAVIISHQADASLLVTEAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSNQKEGHSRA
HRRRKG
>gnl|bykdb|Q58Z10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=250 residues).
MNFSLEKILHRHKEDQETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALDQCQVVMFTSSAMSEGKSKVSANVAVT
WAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKEKPDDVVEETFVDNMSIITSGPVPPNPSELLNSKRMAGLLE
WAREKYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLKRTVEVLKLANAKILGSVERVKAKHGDRGYGYGY
GYGYGNESNK
>gnl|bykdb|Q5FIC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acidophilus] (length=260 residues).
MPLFKKKRGTDETIKHGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
EHYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|Q5KUM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus kaustophilus] (length=235 residues).
MKPLARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKK
TLLIDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLSTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFD
LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|Q5WBB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus clausii] (length=231 residues).
MARLTRAKKKPVQKKRQLIADVNRRSPITEQYRTIRTNIEYSAVDTEIKSLLVTSAGPGEGKSTTASNLAVVIAQNGQTV
LLIDADMRKPTAHYTFGLMNNRGLTNVLTRQQKQDDVIQETNVENVSLLTCGPIPPNPAELLNSKMMELVLQEAREKFDM
VILDTPPVMAVADAQILANKVDGTIIVTSSGKTDREQLQKTKENLVKANAHLLGVVLNNKPIDDTTYYYYK
>gnl|bykdb|Q67AY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=231 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGDYGNYGKRDRKR
>gnl|bykdb|Q6HB09 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. konkukian] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|Q6L5R0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|Q6L5T0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|Q72XH8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLITHQQPKSPISEQYRNIRTNIEFAAVDKNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTDKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|Q7WVX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=224 residues).
MPTLEIVQKKLEFIKKTEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNIENLFVVQSGAVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGVVI
DSAIITQKCDASILVTATGEVNKRDVPKAKQQLEQTGKLFLGVVLNKFNVQHEKYGSYGNYGKR
>gnl|bykdb|Q7X549 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=218 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNGDLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTEAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSY
>gnl|bykdb|Q7X553 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=228 residues).
MPLLKLVKSKVDFAKKTEEYYNTIRTNIQFSGAQMKVIAISSVEAREGKSTTSVNLAISFASVGLPTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNAVLNETICQTDISGLDVIASGRIPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMFI
DAAIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLIKVDMTVDKYGSYGSYGSYGEYG
>gnl|bykdb|Q7X555 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=233 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLYRNADLNETICQTDISGLDVISSGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAGIIAHQADASLLVTAAGKIKRRFVTKAVEQLKQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKTDQ
>gnl|bykdb|Q7X557 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=233 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQIKVIAISSVEVGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAGIIAHQADASLLVTAAGKIKRRFVTKAVEQLKQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKTDQ
>gnl|bykdb|Q7X559 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=233 residues).
MPLLKLVKSKVNFFKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTNISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADAKFLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYEKKTDQ
>gnl|bykdb|Q7X561 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=233 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSPTSLNLAISFASVGLRTLLIDADTRNSVFS
GTFKTNEPYKGLSNFLSGNADLNDRICQPYISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
LAVIIAHQADASLLVTAAGKITRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDRYGSYGSYGSYGSNGSYGSQ
>gnl|bykdb|Q7X563 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=233 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQIKVIAVSSVEAGEGKSAISVNLAISFASVGLRTLLIDADLRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGRVI
DAVIIAHQADASLLVIAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGSYGEY
>gnl|bykdb|Q814Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKSHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDMNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESANGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|Q83VF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=231 residues).
MAKNKRSIDNNLYLITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGKKVLLID
GDLRKPTVDITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVASAYETKKESLAKTKKMLEQVNANILGVVLNGVDSSDSPSYYYYGVE
>gnl|bykdb|Q83YR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=233 residues).
MATLEIIKNKLAEMHQAEEYFNALSTNIQLSGSDIKVVAVSSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKFDVKSEKYGSYGNYGNYGNYGNYGKK
>gnl|bykdb|Q8EME8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oceanobacillus iheyensis] (length=231 residues).
MARKKLSNVNNKMRHLITKINPRSPISEQYRTIRTNLQFASVDSDLRSILLTSAGPSEGKSMTTANLAIVYAQQGKRVLL
VDADLRKPTIHYTFRLDNLRGLSNILVGETSLRDAVESSDVENLDLISCGPIPPNPSELLGSKRMQFFIEEAKQSYDIVI
FDMPPVLAVTDAQVMSNFVDGTILVVRSKQTENDAANRAMEALQSVNANVLGAVLNDRDKKDANYYYYYGS
>gnl|bykdb|Q8GMA5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=252 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSLNLAISFASVGLRTLLIDADTRNSVFS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGSYGEYRKKTDQT
EGHSRAHRRRKG
>gnl|bykdb|Q8GP54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=247 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLV
IDAVIIAHQADASLLVTEAGKIKRRFVTKTVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSR
AHRRRKG
>gnl|bykdb|Q8GP92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=248 residues).
MPLLKLVKSKVDFAKKTEEYYNAIRTNIQFSGAQMKVIAISSVEVGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGRVI
DAVIIAHQADASLLVTEAGKIRRRLVTKAVEQLAESGSQFLGVVLNKVDMTVDKYGFYGSYGLYGEYGKKSDQKEGHSRA
YRRRKGKH
>gnl|bykdb|Q8GPA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=252 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSLNLAISFASVGLRTLLIDADTRNSVFS
GTFKTNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGSYGEYRKKTDQT
EGHSRAHRRRKG
>gnl|bykdb|Q8GPC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=246 residues).
MPLLKLVKSKVNFFKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTNISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASFLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYEKKTDQTEGHSRA
HRRRKG
>gnl|bykdb|Q8GPF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=245 residues).
MPLLKLVKSKVNFAKQTEENYNAIRTNIQFSGAQIKVIAISSVEVGEGKTTTSVNLAISFASIGIRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGRVI
DAVIIAHQADASLLVTEAGKIKRRFVTKAVEQLAESGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
YRRRK
>gnl|bykdb|Q8KWQ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDGLKVFSITSVKLGEGKSTTSINIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDQYGSYGNYGDYGKNKK
>gnl|bykdb|Q8RBS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldanaerobacter subterraneus subsp. tengcongensis] (length=236 residues).
MVMARNLILSDPKSPFAEAFRALRTNLQFTGIDKKVKSILITSSLPNEGKSTVVKNLAYSVALTGNKVVVIDGDLRNPTV
HKSFNLPNNRGLTNLLIDEGDYEAYLNVDNSYDNLHILTSGPLPPNPTELLGSNKMKKLISLIRENYDYLFIDSPPVVTV
TDAVVLAPVVDGVILVVHAGKTEIEAASRAKEILESVKANILGVVLNRVKESRNGYYYYYYYYGDHKSQSKKRRKR
>gnl|bykdb|Q8VU31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=226 residues).
MPTLEISQVKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKTTTSTNIARAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSRNFSTMLETVRKYFDYIVVDTAPVGVVI
DAAIITQKCDASILVTKAGETKRRDIQKAKEQIEQTGKPCLGVVLNKFDTSVDEYGSYGSYGKKKK
>gnl|bykdb|Q8XN46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNL
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVIEAVKGLRAVKANIIGTVFNGEENQRGKYYHYYKKD
>gnl|bykdb|Q8XN76 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=225 residues).
MFLVDKDPKSIAAESYRVLRTSLEYSSIDKELKSIVVTSSEPGEGKSTVAGNLASIIAQNNKKVIIIDCDLRRPTIHKKF
GISNSIGLTEYIIGKNDLNNVIQILNENFSVITSGRIPPNPSEILSSKSMENLLKALSVCYDYVILDTPPLTAVTDAQIL
AGKCDGTILVVRAESTSKESIIKAYKELEKVRANVLGSVLNGIKGNNKNYYYAEDNKKKKLKVRS
>gnl|bykdb|Q97EP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium acetobutylicum] (length=232 residues).
MLVVKDKPKSPISEAYRTLRSNIQFSSFDKDMQLILITSSGPGEGKSTTSCNLALAMAEAGNSVLLLDCDLRKPSVHKKF
KISNNIGLSNVLAGQTKFESASHWYNQNLCILTAGKIPPNPAEMLSSKRMKAFLNEAKGVFKYIILDAPPVIAVTDPQIL
STMVDGVVLVVSSGVADIEAAKRAKELLENVNANIIGSVLNRVDTESRRGYYGGYYYYYGDEGEKVKKHKDR
>gnl|bykdb|Q97ER5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium acetobutylicum] (length=224 residues).
MLVVKDKPKSPIAEAYRTLRSNIQFSSFDKDMQLILVTSSGPGEGKSTTSCNLALAMAEAGNSVLLMDCDLRKPSVHKKF
KISNNDGLSNVLAGHTKFENASNWYSKNLCILTAGKIPPNPAEMLASKRMKAFLAEARGVFKYIILDAPPVIAVTDPQIL
STMVDGVILVVTSGVADIEAAKRAKELLENVNANIIGSVLNRVDTESRKGYYGSYYYYGHEEEN
>gnl|bykdb|Q9AH95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDTRQSVMS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILITATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGAYGSYGNYGKK
>gnl|bykdb|Q9AHA4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNSLCMNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVNKYGSYGNYGDYGKNKK
>gnl|bykdb|Q9AHB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKIGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|Q9AHD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae serotype 4] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDTRNSVML
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIIDTPPIGIVI
DAAIITQKCDASILVTATGEANKRDIQKAKQQLKQTGKLFLGVVLNKLDISVNKYGVYGSYGNYGKK
>gnl|bykdb|Q9K6R0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus halodurans] (length=235 residues).
MLGKGSKQKNGSKQRELITHIKKNSPISEQYRTIRTNIEFAAVDRELKTIVVTSSGPGEGKSTTSANLAVVMAQNGHNVL
FVDADLRKPTAHYTFRAVNTRGLTRVLMRQETLEEAIQETKVENLSLLTSGPIPPNPAELLNSKMMELIIKEVRDQFDIV
IIDSPPLNAVTDAQILSSKCDGTVLVISSGKTQKEEALKAKDLLDKSNANLLGVVLNNKELRNSNMYYYYGESDR
>gnl|bykdb|Q9X4U7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYSEYGNYGKKA
>gnl|bykdb|Q9X9A1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNSLCMNLQLSGGGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVNKYGSYGNYGDYGKNKK
>gnl|bykdb|Q9ZFT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIVVDTAPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|Q9ZII6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae serotype 2] (length=226 residues).
MPTLEISQAKLDFVKKAEEYYNSLCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQRKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGDYGKNKK
>gnl|bykdb|C3WFM9 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacterium mortiferum ATCC 9817] (length=274 residues).
MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLAGNYGASLAIAGKKVLLIDCDIRRPRA
HESFGIKVERGLESVLTENVNPKDVIIKDLIPNFDLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVAS
DAAILSKYVDGVVVVVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSDSNGNRK
KHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK
>gnl|bykdb|E3H7M5 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=233 residues).
MRRRKLVFFDRDKEHIAEAIRILRTNLYFTESKDRKVVLVTSSIPKEGKSTIAANYALSVAISGEKVILVDCDIRRPRVV
DSFGIKANYGLEEVLRGKKNLEDVILHNVERNLDLLPATSFGENVTELFLGKKIVEILDGLKEKYNLIVLDTPPLTVATD
AALLSTYADGVVYVVGYDMVFKKELLSGKKLLEKAGANIYGVVVNKVSINGYSMGNYGHYSSNYKYYDEYKKR
>gnl|bykdb|E3HB18 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=237 residues).
MTERKLYFKLDGQSPVAESLRVLRTNIHFIDEKEKKTVVVTSAIPKEGKSFIAANYAMSEAMVGKKVLLLDCDLRRPRAH
STFGVEGRHGLSEVLMGERNVEELIVKEVEKNLDLLPTKPMEQNVTELLQSKKMESLVEEVQEKYDLVVIDTAPLMVATD
AAILSKISDGVIFVNGYDMVSKKELLYAKEILSSAGANIYGMVVNKIDNSGYGYGYKSHGYYNNNYRYYQDYIKEDK
>gnl|bykdb|E6PYQ3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=294 residues).
MSSVAIQSRRSSRLKSLYLCLSLPQFQSIGMSWHPDHPAKNGIALITLLAPRSASAEAYRLLRTSISLMPVSQKHRVIAL
TSGGPGEGKSTTTLNLAVVLATQSKRVLLIDADLRKPTIAQRLKMSATDQPGLSRYLSDSSVLPEDCVQRVTEIPGLDVM
PVQEIPPFPSELLSQGRLEELLVWARDHYDYVLIDTPPILLVTDALIIANYCDTLLVVARIGVAQRKGLFRIRHDLAKYP
SKQTGIVVNALPFSDTYYSGYGNYRKYYGTGYGKESGDYYSSGYISPAKKKKQQ
>gnl|bykdb|A1ARV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelobacter propionicus] (length=282 residues).
MSRIEKAMERAAQVRNSAGVMRQPQETAARSGMVHTAPLPDMVVNKVMSDDPLLVSLNDPASPVAEEYRKLKAILVKMTS
VHPFKNVLMVTSAIPNEGKSLTSLNLAISLAQEYDHTVLLLDADLRRPSLHRYLNIERNVGLADCLTRGVDLGEAIIPTG
IGKLSVVTAGCAVSNPAELLSSARMKTFVEEIKHRYTDRYIIFDTPPLLPFAETRSLAHLVDGVVFVVKEQTATKDNVSD
AIEALKGADLLGIVYNDTTITQNVERYYSYRSYAAVSPGESA
>gnl|bykdb|A3K8W7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sagittula stellata E-37] (length=607 residues).
MNMMDSRKFRRKRKPLTTETPSPQEDASKDMAPVPPLETREERLARRAREEGEGQTRPDPDAARQARAREAARIAAAAAR
QKAEAESKAQADAQRRAEEQAHDEAEAEAQRQAEEQARAKAEAEAQRQAEEQAHAEAEAEAQRRAEEQARAEAEAEAQRQ
AEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQ
AEEQARAKAEAEAQRQAEEQARAEAEAEAQRQAEEQARTDAETEGRRRKLAEARQAAKLRRAEEARRAAEADADDADDED
EDGTAEQADTPVARPAPAMPTLALTPEQRSPAADQTPLPQSTRLQTDTAWRDLPVARFELSQLNRHRVVTADRLDPAHAT
FDVLRTRLMHTLSERGWKRVAVTSPGKGCGKTFTVANLAISLSRQENTRTLVMDFDMRRPSLHRVLGVDSPGPIGDVLRG
KLAPEDHLIRLGENDFNAGHNIAFGLNTVTEAYASELLQDPRTRVTLDRIEEELRPDVVLFDLPPALSYDDVIAFQPLFD
GVLLVVGGGLTTEREVKEVERRLGTETPLLGMILNKAEGVDVERYAY
>gnl|bykdb|A3W0H7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius sp. 217] (length=377 residues).
MKLKRHEEYMRRRAARRAEMEAEAEEDAAVLHPNLDWPDDEDSVLATVPELLNLPEPEPEPEPEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPVVASDVAPEPTPAPPPLLWPALRRVVLDPKHLAMHRLIS
ATREDPAHVAFDVLRTKLLAALRANGWHRVAITSPSPDCGKSFVAANLAISLSRQSSVRTVLMDMDLRRPSLAHTLGQPD
PGRMAGFLSGDLPLERFLACPEDNPLHIGQTLAMGLNDRAEPYAAEILHAPETGEVLQDMYRRLAPDVVIFDMPPALYYD
DVLGFRPQFDGVLIVVGGGRTTARHLRDLKARFGTDTPLLGVVMNRAEGESIAKYGY
>gnl|bykdb|A5G424 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter uraniireducens] (length=275 residues).
MSRIEEALEKAARLRSSERSNVTVGKTVATAVHVPPLPSSPAAAKIENPFIVTVNDPHTPAAEEYRKLKSILVKLTKGEH
FQNTLMVTSSVGSEGKSLTALNLAVSLAQEYDHTVLLVDADLRKPSIHQYIGLDPKVGLAECLLDGVDVGEAIVNTGIGK
LSVLLHGKTIRNPAELFSSLRMKELVKELKHRYPDRYIIIDTPPVLPFAETRSISTLIDGIVFVVKEGAASLNDVSDAIA
ALKGTNLLGIVYNEASIDGFNDRYNYYYRYDAEKW
>gnl|bykdb|B5EA81 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter bemidjiensis] (length=294 residues).
MSRIEEAMEKAARMRNGMEPPPPESVREPAGASALPPQTPQPVGSPALPPQPPQIPAVSPQYGRLAPQNPFLVNLHDPHS
PAAEEYRKLKSALVKMTTGDVFRNCLMVTSSIPSEGKSLTALNLALSLAQELDHTVLLVDADLRRPSVHRYLNVEQGVGL
SELLTGEAQVGETIIPTGIGKLSIIRAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVD
GVLFVVMERLVSQANLKDALESLKACPILGMVYNAAAVDDKDGRYSYYRSADNA
>gnl|bykdb|B9M2X6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter daltonii] (length=281 residues).
MSRIEEALEKAAKMRGTDGKAALGKVPGSPLAVAHGSVHAYQQPMPNERLKVKNPLVVSVTAPQTSVAEEYRKLKSLLVK
LTNGDRFRNTLMVTSAFASEGKSITAINLAVSLAQEFDHTVLLVDADLRKPSIHKYFGFEPKLGLTDCLTRGIDVGETLI
KTGIGKLSILPYGKKVENPGELFSSSKMKSLIAEIKSRYPDRYIIIDTPPVLLFAETRTISTIVDGIVFVVKEGAASVKE
VNDALTALDKSNLLGIVYNETVNENLNGHYHDYYQHKQYAW
>gnl|bykdb|C0QCJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterium autotrophicum] (length=285 residues).
MGKIFKALEKSKEIDMGDSAVVENDSREDDLQDDTAGEENSRGDESPETGAHVQEDPQTIELPQSLDKSLVTHLKPHSSE
AEQFRILKTTILFPKTGIPPRTIMVTSTAPGEGKSFVASNIAISIAKSIDEHVLLIDCDLRLPSLHTRFGFSDIPGLSEY
LRAGKSLGSILRKTAIDKLSLLPAGKPPANPSELISSEQMRRLLQEVKGRYEDRYIIIDSPPPYLTAEANALARQVDGII
IVVKAGKTKRSDVQDLIDTYGKEKILGVVKNFADARHGFKKYEYK
>gnl|bykdb|C6DZX5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=294 residues).
MSRIEEAMEKAARMRQGMEPPPPGAAPQSAGNSALPPQTPQPVVSPALPPQPPQISPVSPQYGRLAPQNPFLVNLHDPHS
PAAEEYRKLKSALVKMTTGDVFRNCLMVTSSIPSEGKSLTALNLAISLAQELDHTVLLVDADLRRPSVHRYLNVEQGVGL
SELLTGEAQVSETIVPTGIGKLSIIRAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVD
GVLFVVMERLVSQANLKDALESLKACPILGMVYNAATVDHNDGRYSYYRSADNA
>gnl|bykdb|C7LPS3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium baculatum] (length=266 residues).
MSRIEEALAKAAGMQSGLHSKGNRAGVSGIARAPMGESTSVGGVRLAEETMVVINAPLSPMAEEYRKLKEALVKMTKRER
FDNLIAVTSSTAGEGKSMTAVNLAASLAGEYDHTVLLVDADLRRPAVHKYLGLGSCKGLSDCMREGLDVGELLVKTGIGK
LSVLPAGTPTPNPVELFSSDAMRSLFREMKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPSLEQIEEAID
ALDQKVLGIVYNGAHLQSRSSYYYAE
>gnl|bykdb|D0D9W0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreicella sp. SE45] (length=331 residues).
MTERRRFRRRNRPLDDLPDEDIAPVEPLGTRAEGLARRETKTSAAQATRRAEAERVAEPARPEARRGQTAPRPAAPAVAT
RTAQSPTLPQQRGWDDLAEFSVDARHLERNRIVTAARQDPAHAAFDILRTKLLQGLADHGWKRVAITSPTKDCGKTFTAA
NLAISLSRHQNCRTLLLDCDLRRPSLHKIMGFRDPGFMGDMLRGLLPPERHLVRMGENAIHAGHNIACGFNGAVEPYASE
LLQTPRTAETLRQVETMLQPDVVLFDLPPALYFDDVMAFRPLFDGVLLVIGGGLTTDKEVREVERLLGKNTPLLGMVLNK
AEGTSLDKYTY
>gnl|bykdb|E7T801 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri CDC 796-83] (length=513 residues).
MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVY
RQQRDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVL
RLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGV
EAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNI
LMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVIT
RGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGV
NIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|E8WSZ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=290 residues).
MSRIEMAMEKAARLRENGGQTPAQDQAQARPDTATAAAAPRAREAERVPPVVPAGQALSPQNPFLVTILDPHSQAAEEYR
KLKSMLVKLTDGENFKNAVMVTSSVPNEGKSLTALNLAVSLAQGLDHTVLLIDADLRRPSLHDYLEIEPGAGLSDILKGE
ADIGETIVQTGIGKLAVIRSGSQVENPVELFSSQKMRALVDELKRRYPDRYLIFDTPPVLPFAESRALANIVDGTIFVVR
ERLATQAEIKEAYDHLKGSGVLGVVYNAADAAAGDESLSYYKHYQKTPAA
>gnl|bykdb|E9TE88 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli MS 117-3] (length=200 residues).
MMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTS
IAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSL
SRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|F0G6H5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. TJI49] (length=308 residues).
MAVVAALLLGVLAAGAYLMLRQRFVGTVSDPGEIEWTTGLPVIATVPRGESPRLAGADARNRPHASAASRGGLADPAIES
LRNFRTTLQLSLPDAPNRIVLISGPTTGVGKSYIASNLAALAAAASQRVLLIDADLRKGALHDHFRYSRAPGLSDVVMGT
HRLDEALKRDVRPGLDFLSMGSIVADPGEVLLQPALAELIERLSSQYRMIVIDGSPLLPVTDGLALGRLAGIVFLVARSG
VTTLTEIDESVRRLQDVQVDVRGVILNDFARGPGHGYGYGNAETHQAASGYAGMMAHRPAGAGGKGDR
>gnl|bykdb|F0JCB8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio desulfuricans ND132] (length=292 residues).
MSRIEDALKKASEKRDENRRREPETVPSVEPVAAPVMEAASPVDASLDFSPLQSDCLDRARQQRMLVAMNEPISLAAEEF
RKLKQSLVRKTKREGFQNTILVTSGTVGEGKSVTAVNLAISLAQEFDHTVLLVDADIRSPSCHELLCMENGYGLSDCLVD
GSPIGKGLVKTGIGKLSFLSAGSPVPNVGELLASKRMAESLAEMKNRYADRYIIIDSPPVLPFAESRNLSRLADGVVLVI
KEGQASQADLRDTIEALQGSNILGAVYTQASRMHRSLNADAYMKYKYYHYAS
>gnl|bykdb|F3CAY9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea str. race 4] (length=645 residues).
ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
LIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYL
SIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQ
VVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNK
SQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLP
HSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGR
RVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLY
DLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNY
HPAPR
>gnl|bykdb|F4SM97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli H736] (length=509 residues).
MQESFSVTDQGKDTGILTLTLRGEDPKHLEQVLDSISDNYLAQNIARQAAQDAKSLEFLNAQLPKIRSDLDLAEDKLNQY
RRQKDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKSKLNQRVTAMPKTQQEIL
RLSRDVNSGQAVYMQLLNRQQELNIAKSSAIGNVRIIDNAVSQPKPVKPKKILVLAVGFVLGLIVSLSLVFSRIFLRRGI
ESPEQLEEIGINVYASIPVAENSVKKASQIKRFKQKAEKEYTTFLFIENPADLAIESIRGLRTSLHFAMMEARNNILMIS
GASPNAGKTFVSSNLAAIIAQTGKKVLFIDTDMRKGYTHKLFNKNNENGLSDVLSGKIAFEKAIKQIDTCGFDYISRGSV
PPNPAELLMHRRLNELLIWANSQYDIVILDTPPILAVTDAAIIGQYVGTTLLVVRFEQNTVKEIEVSFKRFEQSGVTVKG
CILNGVIKKASSYYGYGYNHYGYNYGEDK
>gnl|bykdb|G5LQM6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Alachua str. R6-377] (length=511 residues).
MINNLQNNLTVTETGKDTGVLSLTFTGEDRDKIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENK
LNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQ
QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLF
NRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVL
MLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPR
GQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFDQNGIQ
VKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|G5Q4J0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Montevideo str. S5-403] (length=519 residues).
MSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRS
RLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGR
VTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIV
GVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAM
MQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAI
ANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLS
RFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|G5SDT8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580] (length=511 residues).
MINNLQNNLTVTETGKDTGVLSLTFTGEDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENK
LNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQ
QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLF
NRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVL
MLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPR
GQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQ
VKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|G7EJX6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. BSi20652] (length=596 residues).
MLLSPEEQAAQQMLSLVAVFNAKLSIEPVRSTQLVKISFESSDPKLAALVANTVGEVYIESQMRAKMGITQQASNWLNTR
LSQLRIQLDTSEQKLQAYREAQKLVDIEGIAGLVTQELEQMSQQLVVARNEKNNLQSINRVISEYGNNNLELLGSMPEIT
SHKVVQDVKREVILVERKVSELSEVYGPKHPKIISAKAELATVKTNLNKQIKGLITGIEKELNRITRTVSALEADLAKIR
AEYQNITRKETQYNQLKREVETNRSIFNTFLSRSKETEVTSDFTSAAARFTDRAYAPNKPSKPNKKLIVVLAFVASFGFA
IVMSFVFDALNDTAKTKNDVEGKLAQRMLGLLPHVKLPKNSVFPIHAYLDENYRRFAESVRTFRTSLLLTQLERDLKVIA
VTSSSPGEGKTTTSANLAMSLAQMGKVLIIDGDLRKPSIAKRFDIPVFHPGLSNLIVGTEELTECVHIDEQSGVAIMPSG
QIPGNPLELLSNIRFSELLELLKAKYDHIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGIERLFESKAHV
AGIVLNQVDMSKSNDEHSYGYYDYHDYSQKPEQPTA
>gnl|bykdb|G7QCG1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. FW1012B] (length=273 residues).
MSRIEEALGKAAERQAGMPRPEARLFFRQEATLPPPSQAIDPARLSEEKLVVLKSPASPEAEEFRKLKEALVKAIRDPDN
FNNIILVTSAHHGEGKSLLVVNLAISLAQEFDHTVLVVDADLRAPTCHRYLEVAPERGLSDCLLDGLDVGQALINTGIGK
LVLLPAGKAVKNPMELLSSNSMRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLT
LLNNKVLGLVYNATDYVKPCSSYYSSYYAACND
>gnl|bykdb|G8AU96 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense Sp245] (length=403 residues).
MNLRRGVGELKLRIRDEVGKIQKGLDADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLYRSLAER
YEQTMALKNTGALDAHLSAPALPPIRPAFPQLRMSLGVGLVGSTALAVALVLLLERLSSGLRTPTQVERATGVPCLGMVP
SLPRNEATWNLPLHPDSRRAREIGAFREAIQTVRTMACMPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGLGLNTL
LIDADFRRPSIAKLLGYQPHGSVADLLDGRVGIDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVV
IDSAPVMLFSDALALSFLADSVIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDAYYYALHAP
ARH
>gnl|bykdb|H8YYB9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thiorhodovibrio sp. 970] (length=279 residues).
MERIKQALERARAERAAAQLADVPVLSTQKVIAQEQETKPAGPGVQVSYTETRSLSLDPEQLRAKRVLLNEVRSPIVDAY
NVLRTRILQRLRANAWNAVAITSPRPGCGKTLTSINLAISLAREVNQTVLLVDLDLRRPSVIRYFTDADLPGVSDYLLEQ
RELAEILVNPGIERLVLLPGHSSFTNSSEMLSTPRMVRLVTELKTRYPDRIVLFDMPPLLAGDDVLAFSPYIDAIMLVVE
AGGTTRDDLRRAWNLLGGKRILGVVLNKADGDSSGDGYY
>gnl|bykdb|I1AYC5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreicella sp. 357] (length=381 residues).
MTDDRKFRRRNPLSAEIAAGEQAAKLARAEDARRMAAAEEQSRIAAAQEAERQHKLTAERQAEAGRRAAAERQGEVERQG
EVERLAEVERRAKAEQQAEAKRRAEAEQLAEATRRAEAEHQAQAERQAGADRQAKDDASPDMVWSRLPVFSVNARHLDRN
RIVTAGRQDPAHAAFDVLRTRLLQALSENGWRRVAITSPTKDCGKTFTAANLAISLSRHQNCRALLIDCDLRRPTLHKVM
GADNPGSMGDVLRGRLSAEEHFQRMGDNDIHAGPNVAFGFNGVVEPYASELLQSPETAQTLETIERRLAPDVILFDLPPA
LFSDDVIAFRPLFDGVLLVVGGGLTTDKEIREVERRLGENTPLLGTVLNRAEGTQLSKYSY
>gnl|bykdb|I2Q341 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. U5L] (length=273 residues).
MSRIEEALGKAAERQAGMPRPEARLFFRQDAPLPQPSQAIDPARLSEEKLVVLKSPASPEAEEFRKLKEALVKAIRDPDG
FNNVILVTSAHHGEGKSLLVVNLAISLAQEFDHTVLVVDADLRAPTCHRYLEVAPERGLSDCLLEGLDVGPALINTGIGK
LVLLPAGKAVKNPMELLSSNSMRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLT
LLNNKVLGLVYNATDYVKPCSSYYSSYYAACND
>gnl|bykdb|I5B296 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacter postgatei 2ac9] (length=284 residues).
MGKIFKALEKAGNKVTAEKESELRDDTALVCDNPDSQVYKQSDEVTQSGSRRTDSALVTASDPHSPVSEQFRLLKNNILF
PEKGTPPKTIMVTSASPHEGKSFVAANLAVSIAQSIDEYVLLMDCDLRSPTIHTSFGYSGKEQGLSDYLAKNIPLSSVLK
KSSVNKLTILPAGQIPPNPSELLSSDQMRRLLHEVKLRYNDRYIIIDTSPPYITSETNAIARFVDGIILVIRHGKTRIKE
VLDILDIYGREKVLGVVTNFSKKTIGYGYGYHKSGYGYGYHQQR
>gnl|bykdb|Q0FMP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelagibaca bermudensis] (length=380 residues).
MTMVERRKFRRRNRNPIDDGPEEPPIEPLESRDRRLERRRAEDKAALAEETAHAAEEAARRSAEEQARQRAAEEARLQEQ
REAEAREEARRQTTAKREEIRKRLRVHDGDKVTAPATASAPVEAETAPAQAPRSPARKPTPLWHRLQEFTVNPRHLERHR
IITAERQDPAHAAFDVLRTRLLQALAERGWTRVAITSPTKDCGKTFTAANLAISLSRQQNCRTMLIDCDLRRPSLHKVLG
VKNPGSMGDVLRGLVPPEDHLIRMGENEIHAGRNIAFGFNGTVEPYASELLQSPQSRTALRHIEDEFAPDVMLFDLPPAL
YYDDVMAFRGQFDGVILVIGGGITTEKEIRETQRRLGDDVPLLGTVLNKAEGSKIRQYTY
>gnl|bykdb|Q314L3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio alaskensis] (length=295 residues).
MSRIEQALARARKDKEHNAEDTPPRPAGGGGAPSGVPHTPAEDSGGPAGPLPAPRVAAARQVRLSPKLVTATAMQSGLSE
EYRKLKERLVKLTKRSGFQNMLMVTSALSREGKSLTSANLAISLAQEFDHTVLLIDADLRGPTCHELLGVARTPGLTDCL
LDGTDVGEALVPTGLGRLSFLPAGRAVPNPGELFASTMMQDLLLQMKHRYTDRYLIIDTPPVLPFSETRSLSRVVDGVVM
VVRENVATMEDLRESLEALEGATMLGVVYNNARSGGGRRGRYGYGYGYGGYGSGA
>gnl|bykdb|Q39U17 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter metallireducens] (length=283 residues).
MSRIESILEKAAKMRQDKTPGESRVLVEQREVPRAVIEPEVFQPDTRIAVDNPYLVTISEPRSPVTEEYRKLKSIILKLT
NSGQFKNTIMVTSAVSGEGKTITSINLAVALAQEFDHTVLLVDADLRRPGTSSYLGIRAEVGLSDCLYGKVDVKDALVKT
GIGKLVVLPAGSRVENPVELLSSGRMQSFIAEIKNRYPDRYIIIDTPPLLSFAETYSLANMVDGVVFVVKEGGATMSNVK
DALGHLKKEKVYGVVYNNVGINRFDENYRYRNYYAYYKDNGAQ
>gnl|bykdb|Q74BQ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sulfurreducens] (length=309 residues).
MSRIEQALEKAAMLRGTTDRGQAVAPRQMEDLQPLERAELPPLPAEPLEGIRHDNPLLATLNDPHSYVSEEYRKLKSAIV
AGTSVGEFRNTIMITSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAQYLGIPGERGLSEYLSVGAHLPELL
VRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLA
NIDEAISALNRKKILGIVFNEASAVGISSKYGYGYGYGGYGPSAEPAEARSTAEKTGKLSRILGKRGSK
>gnl|bykdb|S9QRP1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salipiger mucosus DSM 16094] (length=432 residues).
MAERRKFQRRKRRLSEDVAPETPIAEPRPEDRIDPAEPRRPEQDLRADVEPAHRERAQATMRRIADARRASEARLKAQQA
HEAEKARAAEAAKAAEEDAARAAEAAREAEAERKADAARTAAAEQAAEVARQKNAAREAEAAQEAARAAEQADQEAAVAH
DPEPDADGAAPAAPTQAEAPVAKNSARGTTTADPWDALRSISVDERQLDRNRVITAGRHDPAHTAFDVLRTRLLQALAEH
GWTRVAITSPTKDCGKTFTAANLAISLSRQENCRTLLLDCDLRRPSLHRVLGVEPPGAMGDMLRGVVPPEQHMLRMGPNT
IHAGHNIAFGFNTESEPYASELLQDPRTAATLDDLQTRFAPDVMLFDLPPALFYDDVIAFRPLFDGVLMVVGGGITTERE
VREVERRLGDSTPLLGTVLNRAEDTQIRKYSY
© 1998-2019