BYKdb

Dataset for cluster orphancd of phylum all

[Download (right click)] [Alignment] [Repertoires]

6117 sequence(s)

>gnl|bykdb|A0A2S8SWL9 [Bacteria] Bacterial tyrosine kinase [Abditibacteriota][Abditibacterium utsteinense] (length=781 residues).
MKSKQNPDFTPQSFPAAAHQSFPNNDSSSNGFQGKNANGTSEAIDVSRALEGGTNPSALALPPGGAGGFSDYEDGTEQGG
FSRVLRAFLRRWYYALGLASLILAGGVYYAITAPPVFRATTIIEDTSSSHGPQFNSDLPVLNEMLGSSDKASIQTQVANL
SSSWVMQGAQKRLSAPVRHLMDNGSVVDTAVVPQTGTNLISVNVLAHHPKVASELATRICQEYIYQSLQRNREAMKGSLA
YAKNQLDTVQLRLSKAQEQLKDYKQNNGTMNLESESEQIVTRLADAQTRLQAIESESAANAVQRQKLRVLLAQTPESKVV
PTKIIVSPQLDDMRNKLNGLNLELSTLRSTYTDAYPQVGALKRQIADIEKRIATSRKTQVADWMRIENPVSQQISQKLTE
LEGEVEASKSRQISLRREVAQATARLQKLPQKELGMSRLMANVASLAAAQQNLDNQYQLLRISEEAKIADARIMQQAETP
LVPVAPNRKNVVLYALVLGLIAGLGLTVILDTLDNRIRDEDDAKRAINLPILGSVPLIKVTQENLLLSDDKPSILLEHYR
MLRTNISFSGIDSPIKSIVVTSSVPNEGKSTCAANLAAAAALSGEQVILVDCDLRRPTMHKLFGVSNVLGLSNVVMGNAT
LEEAMQETSIPGLRILTAGPSTPNLFKLISSSAMRSTLQKLADSEGFVVFDTPPALGLADARVISVVADATLLVVSCNEA
TRQAIVQTKDLLTQSGTYLIGILLNKVSVLGNNDYYRYYSSYLEREEEHFDKALEEPKSSK
>gnl|bykdb|A0A0B6X033 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Pyrinomonas methylaliphatogenes] (length=344 residues).
MGRVFDALRRAAELDSRKREHRARPSDAQARAEEIESLLQRSEIFSSQAREPQLFSASAEHADVATAIGSALPENGWASR
VAGATVDAERSARVASFPALDVSAARADQHLIAITQPQSPECEQFRSLRTHVLHAGEKRQVQAVVITSAGVLEGKTVTAI
NLAWLLAQTDGVRALLIDGDLRRPCALSYLGLDRRPGLSEVLAGEAELDATIVRLEPAGLYLLPGGSERNDVAEMLSGPR
FSSVLAEVRRMFDYIVIDAPPLGIFTDATVLINRADAALIVVRAGYTRYSLLDRLLEPLPRERLLGIVLNGVDETLDEHS
YYYRRYYRRAEEAKKKAVAEGVAV
>gnl|bykdb|A0A136K497 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium OLB17] (length=332 residues).
MSVLQALQRKNIENPTTSKPRVVAFDANGKRNAPPDILGTELTIGSPRSAFDGQPNSSLGTALPDVETGLTAGAKPNADT
LTRSARRPLPDCVSWTVDAERVEPRLVAITSPNSSYCEEYRSLRTHVLHKSQRQHLKSIVVASVNPSEGKSVTAVNLAWM
LAQTDGVCALIIDSDLRMPSLADYLGIETEKGLSDILTGDANFKDTIVKLEPSGLYLLAGGAARPDVAELISGPKFAEIL
AEAREMFDYVIIDAPPLAIFTDATVLINKADGALLVVRANRTKYGALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGY
YNYRRMAEDAAS
>gnl|bykdb|A0A143PNR5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Luteitalea pratensis] (length=316 residues).
MSRIDEALRRARGEQPEHRATDFEADAPWEFAEGTSARARSGRPDARPETPNALIPEESGVPDEVTLPPASSATGAIPEG
GLFVSLDGDERMVGAGLRQAVVEEYRKLASSLHQAQINHRLQVVLVASAVPGEGKSLTAANVALTLTTSYSRKVLLIDAD
LRRPSLHGLFRAPETSGLSEGLDAATASRVSAIQLSPLLALLPAGRPVENPVPLLTSERMGELVRDARQHFDWIVIDTPP
VALLTDANLLTKECDGALLVIHANRTPYALVQKAVQALGKPKIFGVVLNRLEDHITVHSGYGKYGGYYNDYGRGGQ
>gnl|bykdb|A0A143PXU3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Luteitalea pratensis] (length=303 residues).
MSRIDDALRRARGEQPEQAATDADIDMPWQFADSPAAPPRASHPPEQRPTSAPARVPEVARVDVKPLPEQVQRSVDDVPT
ARLVSAADANPVLIEQFRNLAAALNRLQTERTLKSLLVTSPAPGDGKSHVAVNLALTLSESYRRKVLLVDADMRRPTLHH
LFHVSGAHGLLDALRAEAEDVPAVVPVTGTLSLLPAGRPQANPVGDLSSGRMSRLIANAGSTYDWVIVDSPPAAGLADAR
IILETVDGAILVVRAAATRFAELQAATDALGPGRLLGVILNAVDPREIHREDYYGNYYGYGSK
>gnl|bykdb|A0A192WXK4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium Mor1] (length=269 residues).
MSNAVIEPSTESEESMPEDHSEPLAAGGAPRGELVPRSIKETPDVVMLTQRSSVAAERFRRLKTRLVNESKNDERVLSIT
SAAPDEGKSFVSLNLSMAFGAENPSTLLIDADLRRPSIQRWITPTPTIGLTELMTDQVELDHVLFPMQNSQTTILPAGGT
PSDPTALLSSSKFAKLVEELRNRFDWILIDTPPVVLFSDADAVSANCDGVLLVVRAGRTPKPMFKQAIGSLTSAPVVGTV
INDVTFNLPDRQSHYSGYYNWYYYEDRKK
>gnl|bykdb|A0A1E3Y5Q0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium SCN 69-37] (length=306 residues).
MRRAAEARQPISPDAGDAAGGPTVGWPAAPAPVEAFSSEGAERPRPRPVTTVPEILPSRPPASGAPSSPVGERIAADLAN
KIVVDSGMDAGSREQYRRMAATLHALQAESGLRVITVASAMPGEGKTLTAANLALTLSESYQRKVLLIDGDLRKPSQHAV
FGLPVSPGLTEGVVGTDAALSLHRVSPTLTVITAGEPTDDPMVTLAAERMQALITEAREQFDWIVIDTPPVGLLPDAGLI
SGLADGTVVVVRADATQYDFVQRSIAELGRERILGVVLNLATPPTDVRYGANYGRYAERTSPPGRR
>gnl|bykdb|A0A1F2R0X5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15] (length=762 residues).
MSESASGGAHRPSTTSASASHPTGTAGHSPASSYAPQSEVHLLDRLVVLYRYRWLCLTVFVLVSGAMIIQGYTTVRMYRA
QARLQIDDERSTAIPGLQSDQNTFYEDPEPYYQTQYRILRGRDLTRRVVQRLRLDTVPEFNGTAERAPTPISMLRDFERR
LVSLVRRAPAQPQEEPPKLDETTDESALVGAFIGRVGVEPVRGSRLVDVTFLSVEPKFAAEAANALAEEYVEQNLQVKLQ
TAQNMLDWLGKELATQQQKVEESERSLAEYREKENALSLDDKQNIVLARLNQLNDLVTKAKTQRIQREALYNQVKSIAGG
AAPDSIPIIAQNPNVQALKNKLSSLQQDKVRLLERYGDKHPQVIAVNASLQDTQRQLDQETARAVQSVRNEFETSVLEER
TLSQNLEAAKVEASDLNRKGIGYGVMEREAQSNRQVYEALLQREKELRVASNSRANNVRLVDRAEVPGSPVTPGGRRTWL
LSIVVGLVLAVGVAMGLDYMNDTIKTPEDVTKRLRLPFLGLVPSVRGAKQQPLLTSSHAPVDFSESFRSLRTTLLTRYSG
EGTKLMAVTSAQPLEGKTTAACNIAMALAYGGARVLLIDADMRRPGLHRTLRLANERGLSQVLVGQARVRDVIQRTVDPN
LLAITAGRPPSNPSELLSSERMKTLITNLRSGPFDWIVIDTPPVLAVTDAVILAPLVNGVTFVIGAEMTRRRLAERAIET
IMEARPRQVGVVLNKVDFARNKYYYTRYYGHQYKNYYAEKAS
>gnl|bykdb|A0A1F2R977 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15] (length=311 residues).
MALVMSRIDEALKRVTRAPSPSPRRAESAESRATSFGDSSLDHYPAEHHSVPWTGEGREGNVEPPAPVRPEPAGRRVQLG
PFDPSIAGKLVTGSMRPVSQEEYRRLAAVLHQMQAEHKVKTLMVTSALPREGKTLTVTNLALTLSEYFGRRVLLIDGDLR
HPSIHEILGLPNTTGLGDGLRSERVQIPFYELSPTLTVLPAGPLHASSVGGLASNRMKAVIDGAAPRFDWVLVDTPPIGL
LSDAQFLAGLVDGVLLVIGAAKTPYPLVQRAVAALGPDRLIGIVLNRVEEQTITADAYYRHYYPSSGAKDG
>gnl|bykdb|A0A1F2S3Q7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18] (length=239 residues).
MHSMATRDTLLVSLTAPASFAAEQYQGLRLAVERLARARDVRTIAVSSPAAGDGKTVTAINLAGTLARGSDDRVLLVDAD
LRRPSVASLLAIPGGGLGLADALGSGRGAADVVRTVDGCLLDVIPAGSPRAGISEILRSPRLDAFLQELRQRYAYIVLDT
PPLLPVFDAALIAKSVDGVLMVVSANRTPRKLLGEALNLLDASKVLGIVFNRDAHPLFGYYDAYCRQYFPGVSRIAGQA
>gnl|bykdb|A0A1F2T1R8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21] (length=239 residues).
MPTLDRHLVSLTEPASFAAEQYQGLRLTIERVARARDVKIIAITSPAAGDGKTVTAVNLAGALARGSDGRVLLIDADLRR
PSVATLLGIETTGPGLADVLSGNRDAAEVFRRIEPFNLSVLPAGATRAGVTEMLRSPRLEQLLQEARREYAYVVIDTPPL
LPIFDASVLAKLADGVLMIVAANQTPRKLLAEALNLLDPAKVLGIVFNQDDRPLFGYYNSYSRYYREYFTDPTQIASGA
>gnl|bykdb|A0A1F2U8T6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29] (length=738 residues).
MGRAGQARGPLSTHAVHKDVHILDLLAVIYRYRRMAFSVFILTTIALMIQGYSGVRLYQAKAQLLIEDERSTAMPGIATG
QYYEDPVPYYNTQHRILRSRELARRVVRRLQLGTHPEFNGTATPPVTLVTAVRAAAARALRGLTLLSAAVEEEAPTPDET
PAEAALVGNFLSRVVVTPVPDSKLVDVFFTAADPAVTALAATTLAEEYVAQNLELKQQSTQNMLEWLENEVAAQQTKVEQ
SERDLAEYREMENAMSLDDKNNIVVSRLNALNEASIRARTVRIEKESVNNQLKAIRDTRSVDAIPVITQNLQIQALRNQL
GDLQRQKANLTERYGDKHPEMVKVNAQLADGQRQLDVGTAKALESVRNEYERALIEERTLAAHLEEAKRDAQDLSRKSVG
YNVLEREAKSHRTVYESLLQRTNELRVSSNSRANNVRLVERGEVPGSPVTPSGRRTWGLSVVVGLFAAIAVAYGLDYMND
TVKTPEDVTRFLKMTFLGLVPSVRGDKHPLMASWDTPKHFGEAFRNLRTAIIALYPGDGPKTMAVTSAQPLEGKTTTACN
IALALAYGGMRVLLIDADLRRPGLHLSLRLTNERGLSHVLGGRARLRDVIQRTVDLNLFAITAGPTPSEPSELLASERMK
MLLSSLAQGPFDWIIIDTPPVLGVSDAVVLTPLVTGVTFVVGAEMTRRQVAEHAIETILSSRPKLLGVVLNKVDFARNKY
YYSRYYGRQYENHYAEAV
>gnl|bykdb|A0A1F2VH76 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b] (length=745 residues).
MNGPNTPANLQAGTHALTPLSQETHLLDRLSVLFKYRRAAMAVFVLVVAWNMVDSYTTIPQYQAQSRVLIDEDTAGLGTP
ADISQNFTLQDPEVYLQTQLRIIRGRELARRTAKKLELHTVPEFNGQGAKPTALAEAISTVKTYAYWPVRIVLGSTPAPS
PVATAESGDPEAYADALIGHLGVNQIRGSRLVDLLFTAADPAFAAKAANAYAEEYVAQNLELKAANLDKSLEWLTGEVGR
QEGLVKASERALADYRERQDAGGLAEGSGNIVVARLTQLNDEVTRARTNRLTKENVWNQVRSAGQDTETITTILQNPMVL
SLRNRVSEVERDRGRISERYGPRHPEYEKVTTQLADVKLQLEAEIKKAIQTAKSEYEAAVVQERTLTQALNEQKAAATDL
SRKGVDYTLILREAESNREIYNSLLTREKELRVVANSRTNNIRLVDRAQVPGSPSSPNHRQDWIYALAFGLVFALGAAFG
IDYLDDTVKTPEDITRRLKLRFLGLVPAVRGDRHPLLSGPVPHDFGEAFRTLRTALVSQLPGDGPKVMAVTSAQPLEGKT
TTAVNIAMALAVGGSRVLLIDADMRRPSVHKALRMTNDRGLSQLLAGQARMREVVQRTHDPNLLVITAGRTPANPSELLA
ADRMRALISGLENGPFDWVIIDTPPVLAVTDAVIIAPLVAGVTFVVGSEMTRWRLAERAVETLLSGNPRHLCAVLNKVDF
ARNKYYYSRYYGHQYKSYYAEAPAA
>gnl|bykdb|A0A1I6MMC5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella pectinivorans] (length=307 residues).
MSKIYEALLRAEIERLTTKDEVSQATTVPLPVRERDYAELSAGPGWPDVDVVASSVLNGLPSDPAKIAVKRWKPLLHQLP
ALGERGASVEQFRTLRSRVQEFRDLGVLKTVLVSSGLPGEGKSFVSANLAISLARRKQNRVLLIDGDMRRSSLHKLLGAP
CEPGLTDYLSGNASMFDVMQRAHASDGMPSALSSLTFIAGGGDADNAADLSSNNRFKELIVKASAFFDWIIVDSSPVNVI
ADGVNLAHACDGVLLVARGGVTKFETAQRALSQLKASNVLGIVLNAVSDPPVSGGYYGYDAPGKQTT
>gnl|bykdb|A0A1Q6Y875 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_57_17] (length=239 residues).
MRQRCAKPAWKLHKDSLVLFNEQSFDQCAEQFRILRARLYRLREKKPFRTLLVTSAQAGEGKSFVSLNLARAIVHQHERH
ALLIDADLRAPKLHVSLGAPSSPGLSDYLRGDADEFSIIQSGTGENLFFIPAGRPVSNPTELLGSTRTKSLFERLNTLFD
WVIVDTSPVLPVSDAAVLAPTCDGVILVVGAGRTSSDLARTACQELRESRLLGVVLNGVEDDALGSPYAYYGRSEHVRG
>gnl|bykdb|A0A1Q7CJC1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_2_57_6] (length=232 residues).
MRFSLFHRTDDDAKIGTERFRTLRSRLYQIAAAKQLRKVLVTSSVPNEGKTFVAANLAQSIVHQPDRRVLLIDADLRAPL
LHVTLGAPTSPGLTDYLRGEANEYDVIQHSSEVNLCFIPCGHPVSNPSELLSGDRMKKLLDLVTPVFDWVILDSPPSLAI
HDASILADLCDGVLFVVRAGETNHETAERAASEFRNKNLLGVVLNRVEQAAGYGDYYYGSLGEEEQPVLHAS
>gnl|bykdb|A0A1Q7FS15 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_56_16] (length=283 residues).
MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYR
GLRTRLMRAQAKTGLKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTSMLDHPSTPGLAEVLAGEV
TPDEAIVATNQKNLFVLPAGTVLSSPPELFTGTHWQEFIARCSELFKVILIDTPPILPLADFELISAACDGVLMVVRAHH
GQRETLQKTARALDPKKLLGLVFNATDVSRKDYYGYGYGSSKS
>gnl|bykdb|A0A1Q7HEZ8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_65_14] (length=226 residues).
MSLKAPASFAAEQYQGLRITIEQLKRLRDVRLIAVTSPSAGDGKTVTALNLAGVLACGSDARVLLIDADLRRPTVAARLG
IGAADPRGLVDAIADTNVWLDQVTRQVDGFNLSVIPAGVTRVPIHEILRSPRLERLLQEARQRYDFIVLDTPPLLPVFDA
ATISKLVDGLIVVVAANQTPRKLLAEALTLLDPATVLGLVFNRDVQPLFGYYNSSYRGYFGEARTA
>gnl|bykdb|A0A1Q7HTA7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_69_4] (length=207 residues).
MTSATSGEGKTTTAINLAAAMAQDAEARVLLVDADLRAPSVAPLLGLGDSLPGLAELALGSRAGLDDTVRWCPPSRLCVL
PAGRTPANPYEVLKSAGIGEVIQAARRRYDAVVVDTPPLLPVPDNRALAKWVDGFLLVVAAHRTPRHLLEEGLRVLEHAR
VAGIVFNGDDRPSSACYGYYYGYGRGRGGGAARGEHPAWRKAAAPWR
>gnl|bykdb|A0A1Q7JFB1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_65_8] (length=220 residues).
MVTERPEQSTIEQYRKLAATLHHAQTERQLKVVMVSSAVSGDGKTLTSTNLALTLSESYRRRVLLIDADLRRPSVHEVFQ
VKNVTGLTDSLKAENDRRLPLIQASAYLSLLLAGRPDSDPMSGLTSGRMRRLIGEAAATFDWVIIDTPPVVLLPDANLLA
AMVDAAILVIGAGKTPHKLIMRAIDALGRNRILGVVLNRVDPSCLAGGYGYGYYSYGERG
>gnl|bykdb|A0A1Q7JW36 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_65_8] (length=226 residues).
MSLKAPASFAAEQYQGLRITIEQLKRLRDVRLIAVTSPSAGDGKTVTALNLAGVLACGSDARVLLIDADLRRPTVAARLG
IGAADPRGLVDAIADTNVWLDQVTRQVDGFNLSVIPAGVTRVPIHEILRSPRLERLLQEARQRYDFIVLDTPPLLPVFDA
ATISKLVDGLIVVVAANQTPRKLLAEALTLLDPATVLGLVFNRDVQPLFGYYNSSYRGYFGEARTA
>gnl|bykdb|A0A1Q7K833 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_65_8] (length=727 residues).
MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAVPGMSPENFYQDPDLYYKT
QYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTMLRDFQQRVVHLIKPSALAETQEVPKVDETPDESSMVNAFIG
RVNVEPVTGSKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALADYRERQ
NALSLDERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIPVIAQNPDVGAAKAKVTAAQTDRARTAE
RYGEKHPNMQKVNADVAEAQRQYDLAVNRAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNR
DIFQALMTREKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTPEDVARRL
KLPFLGLVPSVRGDKHPVLASSHVPHDFGESFRALRTSLMSKYPGEGTKILVVTSAQPLEGKTTTAANIAMALAYGGSRV
LLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGRTPPNPSELLASERMKTLLTNLSHGPFD
WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAEMTRRRLAERAIETILQTRPKYTAVVLNKVDFARNKYYYSRYYGHQYKN
YYAEATV
>gnl|bykdb|A0A1Q7K9P1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_57_6] (length=283 residues).
MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYR
GLRTRLMRAQAKTGLKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTSMLDHPSTPGLAEVLAGEV
TPDEAIVATNQKNLFVLPAGTVLSSPPELFTGTHWQEFIARCSELFKVILIDTPPILPLADFELISAACDGVLMVVRAHH
GQRETLQKTARALDPKKLLGLVFNATDVSRKDYYGYGYGSSKS
>gnl|bykdb|A0A1Q7KX94 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=304 residues).
MSRIHEALKKAAEERSAQLAAGLETGVVEVTGELRRPITQGPGIAQPTAAPRVPTGDNQDVPFHYEELIKRCAQVEWRLD
PVSSVFLNSKPGEGGPERFRTLRSRLYKIASTRKLQKVLITSGVAAEGKTFVASNLAQSIVQQPELRVLLIDADLRSSRL
HVLFGAPSCPGLSDYLRGDADEYAVIQKGTKENLFLIPGGSLVSNPSELLLNERMKHLLNLVAPSFDWIIIDSPPTLPVH
DASILADLVDGVLFVIRAGSTDAAIAERTAAEFQGKNLLGVVLNQVERSDSYGDEYQNYYAERD
>gnl|bykdb|A0A1Q7L5B1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=305 residues).
MSRIHEALKQAAHGREPALFPGEAKPNHSVVAEAGHGNRHEWLNRRVPTSEERAAAVSDFLGLNDLWQRCRKPGWTLDPT
YSAFSNSKSFTSCAEQFSKLRTRLYEFRDNEPLHTLLVTSSLPAEGKSFVSLNLALAMMRQHNRYVLLVDGDLRAPKLAT
CLGVPGAPGLTEFLQGAADASSIIQTDTEGKLFFISAGSAVSNPTELLSTERLECFLRQMAALFDWVIIDAPPVLPVSDA
IVLAGRCDGVIVVVRAGSTGYDVVSTALQELRGKKILGVVLNRAEEKEATYGAYPYYGGNGMDKK
>gnl|bykdb|A0A1Q7LC46 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=501 residues).
MKKESLYEFAKAGDLDAVPQVQSNAALTDLLKKQRDSSAEYTDALAQYGPNFPKVQRLKTELKDIEDSIEKEKRKVLEVL
ESDYREARQRETLLSEALDQAKVEANQMSEKLVEYNILKREAEANKALYEGLMTKMKETAISAGLRSSNIRIVDPAMVPT
SPARPAKARNIMLAFLVGLIGGIGLALMREYLDNTVKTPDDIESLARLPSLAVVPQFTGLNGSKGRGVLPGLSSNGHERR
IELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRL
LNLGTGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLPPNPADLLSSHRLADAIAELRTKFKFIVIDSPPIMAAT
DAVILSVLADGVLLIVRSGETPKAAFTRTRDLLNSVKSRILGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQEAGEPAQGD
DASESVTEALSRHHDDDSQAL
>gnl|bykdb|A0A1Q7LG57 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_4_58_4] (length=339 residues).
MRDSNVLVVDRAKPPLLPYRPSFPMNSAIGLFSGLFLGFGFVILRDRLDRRITAPGDAQAYLDLPELGVIPFDQGGLAGQ
IAGRLHSHRPTRTLTSDTAPDSSANWPELATWKRKPSFLAECARTTLTSILLPSQNGDCPGVVVLTSPSSGDGKTTVACN
LAIAMAEIGRKVLLIDGDLRRPRLHKVFGAPNNWGLSDVLWGDTPLETLPISHLVRETEVAGLSLLPGGSCGITPTNLFY
SPRMARFLKRMRKEFEMVMIDAPPMIHLADARVLGRHADGVILVMRAGQTTTESALYASQRFAEDGTRVLGTVLNSWDPK
NSHRYGYGSYADYEEYVGQ
>gnl|bykdb|A0A1Q7MUR4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_65_5] (length=226 residues).
MSLKAPASFAAEQYQGLRITIEQLKRLRDVRLIAVTSPSAGDGKTVTALNLAGVLACGSDARVLLIDADLRRPTVAARLG
IGAADPRGLVDAIADTNVWLDQVTRQVDGFNLSVIPAGVTRVPIHEILRSPRLERLLQEARQRYDFIVLDTPPLLPVFDA
ATISKLVDGLIVVVAANQTPRKLLAEALTLLDPATVLGLVFNRDVQPLFGYYNSSYRGYFGEARTA
>gnl|bykdb|A0A1Q7N989 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_56_11] (length=283 residues).
MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNECRQVHVGNGNGARLVLHQGEASRAALEAYR
GLRTRLMRAQAKTGLKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTSMLDHPSTPGLAEVLAGEV
TPDEAIVATNQKNLFVLPAGTVLSSPPELFTGTHWQEFIARCSELFKVILIDTPPILPLADFELISAACDGVLMVVRAHH
GQRETLQKTARALDPKKLLGLVFNATDVSRKDYYGYGYGSSKS
>gnl|bykdb|A0A1Q7NGT0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_55_6] (length=356 residues).
MGRIYDALKRAESAPRTPKPSVNRPGNPDNIAYFVPKHVHPWERQSFTGMPQGYDSASTAHTEEATGGPALPGGPASRDA
GATLGAVGSARAAEFSSREVLAARVEPHLLAITEPRSAECEQYRSLRTRLLQAGERQRMRAFVITSAGVGEGKTLTALNL
AWLLAQTDGVRALVIDADLRQPCAADYLGIETDCGLSEVLTGETKLLEAIVKLQPSGLHLLPGGAAREDVAELLSGPRFG
HLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIEPDETAYY
YQPRHQRMMAAPVEGTEYDQGGANPEMIYLEEEMVS
>gnl|bykdb|A0A1Q7QYI4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_64_6] (length=283 residues).
MSRLEAALRRAQALNDQSDAPEADPKAERMSRALAALADTPPPVSTASSPTNVRTAGFYAEKLVVTERPEQSTIEQYRKL
AATLHHAQTERQLKVVMVSSAVSGDGKTLTSTNLALTLSESYRRRVLLIDADLRRPSVHEVFQVKNVTGLTDSLKAENDR
RLPLIQASAYLSLLLAGRPDSDPMSGLTSGRMRRLIGEAAATFDWVIIDTPPVVLLPDANLLAAMVDAAILVIGAGKTPH
KLIMRAIDALGRNRILGVVLNRVDPSCLAGGYGYGYYSYGERG
>gnl|bykdb|A0A1Q7RB73 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_60_7] (length=237 residues).
MERCSQSLWNPARNMMLFFDRRNPVVGVEEFRTLRSHLTLIRERQPLQSLLVTSPLPSEGKTVVAANLAQVLVQQREQRV
LLVDSDLRYSRMHLSLGASRSPGLSDYLSGAKDELAILQRGPLENLFFIAGGKAASNPTELIGNGRLRLLLRRLCPAFDW
IIMDSPPVIPVSDAKLLAEYLDGVLIVVQSDATPHDLARKACQEFASKKIVGVVLNRVKPEYSYGSQYYATTPETKK
>gnl|bykdb|A0A1Q7RGF1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_60_7] (length=293 residues).
MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGASGDLGESRLGQCRKMKIPAVGKLLGQFGSGPALEA
AEESYRALRTRLLRARSAQGLRSVVVTSATPGEGKTLTSLNLSLCCAQLHDLRVLLIDADIRTSGLSRTLGFPPGPGLVD
VLSGKCEPRNAILATDIPNLYTLGSGSHTTQPAELFASSHWQEFISWCSESFKLVLIDSPPVLNLTDVDLIAAACDGVVM
VVRAQHAKREVLQKCAGQIDPKKLLGVVYNAVESGAHDHYSYGGYTAARKEST
>gnl|bykdb|A0A1Q7RML7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_68_5] (length=274 residues).
MSAFSGGDRDHTSDRSERACPAPSAGGLRGLDRHLVSLVAPASFEAEHYRMLRARLESRQEGKALQVIAVTSATIGDGKT
TTAINLAGALAQAREARVLLVDADLRRPSVALQLGLDDPRGAGLADAILDPERSLESVILRRLPLNLGVLTAGRLPPAPY
EALKSPRLGALFEQARRLFDYIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTPRKLVEEGLNLVDPAKAIGVVFNGER
RSRSGYYGYYHAYGRPPGRARRSGARSPAHDTLR
>gnl|bykdb|A0A1Q7V300 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_4_56_7] (length=301 residues).
MSRIHEALKKAEQERATSESIPQMVADQVVLEAIASSENVVPARSAISASAAVAATTSDILVARSRRTEWRPNPKTMLFF
SGEEHLYGMEEFRTLRSRLYQAREKHPLSKVLVTSPLPKEGKSFVTANLGQVLVRQQGKRVLLIDADLRNPHLHSTLGAE
SGPGLSEFLKGEMDEFTIIQSGPMENLFLIPAGTRNENPAELVASGRMSTLLHRLEPLFDWIIVDSPPAVAVSDAALLAK
YCDGVIMVVRSNATPFDIAQRARQEFGDNLVGVVLNGIDTLPEYSQYYYTAYGNPNGKDPA
>gnl|bykdb|A0A1Q7Y646 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=347 residues).
MGRVYDALKRASATQGGVTKRSNEQKRRNGNSNAARQNGNGNHAFEDSPLFAPLGAAHNSASTAHTEEGVGSALSDVIAS
RAAGATLDAAGSARAIEFVSRQISTARVEPHLVAITQPRSPYCEQFRSLRTRLLQASERRKMQAFVVTSAGVGEGKTLTA
LNLAWLLAQTDGVRALLIDSDLRQPCATEYLGIDEPTGLSEVLAGTATLEESIIRLEPAGLYLLPGGEPRDDVAELLSGP
KFDKVLAEARRMFDYIIIDAPPMGIFTDANLLINSADGAMLVVRAGKTRYATVERLLEQLPRERMLGVVLNRSEETMEDS
SAYYYRRYYRRDDAVEDKTEKEVDEKA
>gnl|bykdb|A0A1Q7ZIQ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_68_7] (length=274 residues).
MSAFSGGDRDHTSDRSERACPAPSAGGLRGLDRHLVSLVAPASFEAEHYRMLRARLESRQEGKALQVIAVTSATIGDGKT
TTAINLAGALAQAREARVLLVDADLRRPSVALQLGLDDPRGAGLADAILDPERSLESVILRRLPLNLGVLTAGRLPPAPY
EALKSPRLGALFEQARRLFDYIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTPRKLVEEGLNLVDPAKAIGVVFNGER
RSRSGYYGYYHAYGRPPGRARRSGARSPAHDTLR
>gnl|bykdb|A0A1Q8AMY4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_65_9] (length=727 residues).
MYSPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAVPGMSPENFYQDPDLYYKT
QYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTMLRDFQQRVVHLIKPSALAETQEVPKVDETPDESSMVNAFIG
RVNVEPVTGSKLVDVTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALADYRERQ
NALSLDERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIPVIAQNPDVGAAKAKVTAAQTDRARTAE
RYGEKHPNMQKVNADVAEAQRQYDLAVNRAASAIKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNR
DIFQALMTREKELRVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTPEDVARRL
KLPFLGLVPSVRGDKHPVLASSHVPHDFGESFRALRTSLMSKYPGEGTKILVVTSAQPLEGKTTTAANIAMALAYGGSRV
LLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGRTPPNPSELLASERMKTLLTNLSHGPFD
WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAEMTRRRLAERAIETILQTRPKYTAVVLNKVDFARNKYYYSRYYGHQYKN
YYAEATV
>gnl|bykdb|A0A1Q8AX10 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_60_10] (length=305 residues).
MSRIHEALKRAEQERAPIQSANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESPNSHHLRLDELRRRCATPGWKLN
PDYAVFCKQSLAVCAEQFRTLRSRLYRLRDKQPVRTLLVTSAVPGEGKTFVSLNLALAIARQHERRALLIDGDLRASRLH
VRMGAPSAPGLTEYLRGEADEFSIIQADSKDDLFFIPAGRSVLNPAELLADNRMKVLIDRMAPVFDWVIVDAPPVHPVGD
AGVLAGLCDGVIVVVRAKLTAYDLVQTTLQEFRGKNLLGVVLNGADEEATYGAYSYYAGYGMDRK
>gnl|bykdb|A0A1Q8BDC5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_55_15] (length=496 residues).
MLANPVLSEIRELHQKKQSGILVLTGGAGERVEVFFREGMIDAASSNMDARRLGDYLAKQEYLHARDLDAAHSEAQRHQI
LIGEAVVRKRLLGQAEVIVAVRQQATEVLEHVFKNNFAVDSFRNSLKSYYAPARIAYPQVLLEVCRSKNEPFECKEGTRI
VLSNGTDLSVFPWYPEELSLLSEIKVPSTVQELAKTTGMKETNIRKVLGVFQTLGIIETFADAEAPIPGALTRRDALVRT
SEFPLEELVPVVSNATLAEKLQIARSEMSFTSEQFKNLKVQLRDAASKASLKVLTVSSPDPRDGKSLISSALAFSFSMDP
GRRVIIVDCDLRNPSLDGYLGVTPEPGLLQYLASTNMSPYCYVRRIESLYFLTVGGVATNSIEILSLRKMKELIESLRKD
FDTIILDAPPFAPIADARIVTGLSDGLIMVLRRGKTSYADTDRAFQAIDRNKLLGVVFNDVQRLFKTYSHYGQYYYGPPA
DAKKVKGPKSKNYLQS
>gnl|bykdb|A0A2G6HNT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=294 residues).
MEKFSKIMEKAGVETSYKLHNKEKESFRPKKRVQPKPVASVAREKKRPRPVHHPELKESIEEDWEKRLYNANYSVDSLTE
IFKTLRARILLSKEKNTSAGTIMVTSAMPGEGKSFVAANLSLAFASGLDQYVLLVDGDLRRPSIQTLFGRKENFGLVDYL
QQQGSLPELIVRSRKPKLSLLLAGDTPPNPSELLSSVLMKDLIKELSSRYTDRTIIFDAPPVLLTAEARILAHHVDGVVM
VVRQGVVGKAKVEETINAIGPERILGIVFNDHHGAYFSKSSKYGYGYGYGSKYE
>gnl|bykdb|A0A2G6HQA4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=319 residues).
MDKFSKIMEKAGVDTSYNLHSKKRKNSLPGKKRRSVTSFNPPPVHDREPEKREDSLPGKKRRPEPSFSTRRNSSPVHQRK
PEKTIEEDWEERFYSANHSVDSLTEIFKTLRARILLTKKRNTSAGTIMVTSAMPGEGKSFVAANLSLAFASGLDQYVLLV
DGDLRRPSIKKLFGRDEDFGLVNYLEHQTALPKLIVRSRKPKLSLLLAGKPPSNPSELLGSILMKDLIAELSSRYTDRTI
IFDAPPVLLTAEARTLAHHVDGVVMVVRQGIVGKAKIEETINAIGPERILGIVFNDHHGAYFSKSSKYGYGYGYNYRYE
>gnl|bykdb|A0A2U3LF12 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfopaludibacter sp. SbA4] (length=248 residues).
MRPETPKLKDDGITPEERRHFQEHRLTVLSDPQSIASQQYGILTLKIQRWREQTGGRVLVVTSAAGGEGKSLTALNLSMA
LASSVEGRVLLVDCDLRRPQVHERLGLKDPSGFSDLLALTDREVSPFVSKAGNLHVMPGGTQLSDPVELLSSRRTREILA
RLRQEYQLIVLDSPPIVPIADSHFLAGLADGVILVIRARQTRRELLQRAVESLGATNIVGVVLNDVEYGDTRYAYAYRYY
QRHYVGRR
>gnl|bykdb|A0A2V2R8T6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=263 residues).
AGAARAGGFVSFEISPARVEPHLVAIRQPQSAYAEQFRSLRTRILQAGERLQMRAFVITSAGIGEGKTLTALNLAWLLAQ
AEGVRALIIDSDLRHPCAADYLGIDAPVGLAEVLGGQARFEDAIVRLDPAGLYLLPGGGVRNDVAELLGGPTYARLLTDA
RRMFDYVIIDAPPLGVFTDASVLISRADGALLVVSAGKTRYSVVDKLLDQLPRDRVLGVVLNRTDEALEPSTYYQYRYYN
QRSLPPGDPNELVNQQQEVVTVN
>gnl|bykdb|A0A2V2RJF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=265 residues).
DSDSDNGSSRQKHLAKQENPPASPTEAIDLLTHYNPTSVASEAFKTVRTSLLLSFPETPPHTILITSSRPGEGKTFVACN
LAISLAQLDKRVVLIDGDMRNPRVHRVWGIRNDTGLSRFLTSDVKAGEVIRPSKVKGLSLITSGSKTPRPAELLSSHRLT
QLLEQLKAEFDHVIVDSPPLMPVTDAVILAAKSNCVVMVVHGGVTPRDVVQMAKQKLVKSDATMAGVVLNYIDLTDPYYY
YSYYSRYYAYRYGEQPKALPPKFIQ
>gnl|bykdb|A0A2V7TQY5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=297 residues).
MRARRGRGPPGARRRHRRIEAPGRRQLPAGRRAGGRWVVTAPRIDQHLISLLQPRSFEAEQYRVLRHVIEEGKDGGLNVI
AVSSATVGDGKTTTSINLAGTLAQNTTARVLLIDVDLRRGSVAAGLRLRAPEANGLVDAILTPGLDLSAVVRELPEFRLS
VVPSGRCPAAPYEMLKSPRLGQLIGQARDRYEYVVIDTPPLVPVPDARVVEKWVDGFVIVVRAHRTPQRLLEDALNMVSP
EKLIGLVFNGDQRPTSRHYGYYSSYYHEPTNGQGTLWTRIADTAKRPFRSRVSGTAV
>gnl|bykdb|A0A2V7TTM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=302 residues).
MYRVGNPLLKSRSLVPASEDDDVTREAPAGRPRPSVGPSPENSKIAAAALRVDERLVSLRSPNSFEADQYRVLRHFLEAA
GAGNSAQVLAVSSAAAGEGKTTTAINLAATLAQSPDMRVLLMDTDLRRPSVASNLALGSSAGTGLAGAVLDPRVELATVV
RPTPFGFSILPAGTSPSNAYQILESPRIGQLLQEARRSYDRVVLDTPPLLLVPDCRLLSQWVDAFVIVVAARRTPRKLLA
ETLGSVDAGKLAGIVFNGDDRPLGGYYKGYYMGYDGDRAGAGSKGRWSSWWRRRRSGRKPWR
>gnl|bykdb|A0A2V7TU87 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MSRHRMATLDERLVSLVAPHSYEAEQYRGLRHLVEQAHRTSALSVLAVSSATVGDGKTTTAINLAGALAQAADARVLLMD
VDLRRPAIAERLGLEEGRHGLVDAILSHDLKLADVARPCGPLNLAVVTAGVFSDIPYELLRSSRLGDLLDQARRDYDYVV
LDTPPLVPIPDARVISKWVDSFLLVVRANTTPRSLLEESLNLMEPQKVLGLVFNNDERPRTTYNDYYAGSGRHDKGGAPT
WWRPFAKIRSVFDPDAAGRRRPERRREIR
>gnl|bykdb|A0A2V7U4P9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=275 residues).
MSIKPPEEMLSSAVPAGEKGGPVSETPRRGPGGGSAVRSTPADHLVSLVAPTSFEAEQYRILRHAIERRHTDGVATTTAV
TSPSGGEGKTTTAINLAGALAQAADQRVLLVDADLRRPGVAAQLRIASTAPGLAEAVADGARPLDELCQQVAGFNLWVLP
AGHAVMAPYEILRSPRVAELLAEAHSLYDYVIIDTPPVIPCPDYRLLEPFIDGVMLVVAADKTAREMMDTALDLLDKPKT
LGVIFNGETPQADRSSYYYSAARPEPSRWSWFKRK
>gnl|bykdb|A0A2V7U8G5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=285 residues).
MPMARSRGPRPVSLDFELHRLSTPPTSGEVVPALEVEDHLACLLSPQSFEADQYRVLRQFLTEARGARPLRILAVTSPAA
GDGKTTTSINLAATLAQTPGSRVLLVDTDLRRPFVATNLGLSPDRPGLAEAAIDEGLQLSDVVQSTPYNLAVLPAGAPPA
NPYQALESPRIGQLLEQARDAYEYVVLDTPPVLLVPDCKLMSQWIDGFLLVVAAHRTPRKLLGEALSALDESKMLGIVFN
GDDRPMGGYYGKYYGGYYHDRSRRETGGGRSSRQRDQKPRRSSWR
>gnl|bykdb|A0A2V7UMX0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=339 residues).
MLRSTVGEWRCGLLSQVKGFRLPEAKPGAQPGKSARTKAGLPDQEVHGPQALGSREPAGRERSTDPAVPQARVAEIPWKK
IDGRLVSLTAPTSPEAHQYRVLGHQLERLRREGGLRLVAVTSPFAGDGKTTTSINVAATLAQAPGSRTLLVDCDLRLPAV
AKYLRVEGVDAPGLSEAVQARLGLDAVMQRCPPRVDLWLLTAGRPPEDPYDVIRSPHFADLLEEARRRFDFVVIDTPPIL
PVPDGREIARWVDGFLVVVAAHRTPRPLLAEALGVLEPDKVVGLVLNGDDSFSSEYYRYYRGYGTAARQSSDLTPGEAAD
GASRAPDSPPSSHPSTIQE
>gnl|bykdb|A0A2V7UNP9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MRTNSRPVSMSQYLELERRSPGDARGEPLIADSAESRPGRDSREAAPVPEVEEHLASLLSPYSFEADQYRLLRQSVEQLA
AKERKVIAITSPAAGDGKTTTAINLAATLAQSSRSRVLLVDTDLRRPFVAANLGLDMDAPGLADAVRDEQIDLAAVVQAT
PYTLAVVPAGAAPADAYRVLESARVGQLLDTARGSYDCVILDMPPVLLVPDCRLMSQWIDGFLLVVAAHRTPRKLLGEAL
SAMDEAKVLGIVFNGDDRPLSGYYGGDYRSYYHHPSAPRRGGWWRSWRGQAKTKRGQKARPQPWR
>gnl|bykdb|A0A2V7VK33 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MLSISPTRDPEAPPSAPTRGRGSNEPPRTAPLLEERLVSLGQPWSLEADQYRMLRCEIEYLRRSRSLSIIAVTSPDVGDG
KTTTSVNLAGTLSQDPGTRVLLVDADLRRPSAAPLLGFGDRGDGPGLAGAILDSHRSLASVVRARPPFNLSVLPAGRFHD
LPFELLRSPRLADLLAEARQQYDYVVVDTPPLLLLPDCRAVAQQVDGFLLVGAVAAALDALEEEKTIGIVFNNENRPPSS
YYKRYYGAPPGPRATRNRVTAGRGWRFWR
>gnl|bykdb|A0A2V7VLD7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=296 residues).
MRTNSRPVSMSQYLELERRSPGDARGEPLIADSAESRPGRDSREAAPVPEVEEHLASLLSPYSFEADQYRLLRQSVEQLA
AKERKVIAITSPAAGDGKTTTAINLAATLAQSSRSRVLLVDTDLRRPFVAANLGLDMDAPGLADAVRDEQIDLAAVVQAT
PYNLAVVPAGAAPADAYRVLESARVGQLLDTARGSYDCVILDMPPVLLVPDCRLMSQWIDGFLLVVAAHRTPRKLLGEAL
SAMDEAKVLGIVFNGDDRPLSGYYGGDYRSYYHWWRSWRGQAKTKRGQKARPQPWR
>gnl|bykdb|A0A2V7X0V9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIHEALKKAEEERAASQGGAQLEPTPVGAESPVMPDMASHRVPDPVAVAAMMPAFGSPFSVDTMLARCPQMEWKPDLG
TMLFMNGDDSKRGTEEFRTLRSRLYHMREKMTLKKLLVTSALPKEGKSFTSSNLAQVLVRQHGRRVLLIDADLRGPRLHL
MLGTTAGPGLSEYLQGKNDEFSIMQRGPLENLFFIPSGTGIEDPAELVGNGKLKTFLQRVEPLFDWIIVDSPPAIPVSDA
SVLAKACDGVLMVVRSNATPCDVARKAREEFPDQSLIGVVLNGTSDDAASYARYYYEAYEKRQPTTV
>gnl|bykdb|A0A2V7XGA3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MTTPTTLGDPASLSAVRTSEPSPRAQAETARTARAAILTEVDDHLVAVHSPQSFEADQYRILRHFLDQDSGGAKRQVLAV
TSPTAGDGKTTTAVNLAVTLAQSPGARVVLIDADLRRPFVATSLGLDDRRGPGLAATALDPKLELEQLVRPTPFNVDVVP
AGPSTPSAYRLFDSARVGQLLDQARRRYDHVLVDTPPVLLVPDCRLMSQWVDGFIVVVAAHRTPRKLLVDGLGALEEGKV
LGVVFNADDRPLSGYFGRYEGYYGYHQPH
>gnl|bykdb|A0A2V7YAG6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
MAWLPPWRQAGPDMSMPTTLDPAPMGAARAPEDSRRSNGGTGTTVGGAVSRDLDEHLVSLLNPQSFEADQYRILRHFVDQ
AKGAVPRQVLAVTSPTAGDGKTTTAVNLAATLSQLPGARVLLMDTDLRRPFVAAGLGLEDGSAPGLATMALDPDLELDQM
VRRTPYNFDIVPAGPAAPNAYRVFDSPRVGELLEQARRTYDYVVLDTPPVLLVPDCRLMSQWVDGFLIVVAAHRTPRKLL
AESLGAIHQDKVLGIVFNADDRPLSGYFTRYQGYYGYGQPANGGRSWWRFPWRRAAQGRFRPWR
>gnl|bykdb|A0A2V7YV88 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
DYLDQSIKSDEELTERLGLMTLAHIGFAPAGKGKRAELVALDGQSPASEAYKALRTNLLFSTIDHELKTIVLTSAAPGEG
KSRTASNLAIALAHAGQRTLLIDADFRRPSLHRIFGRIRNVGLSNLTVQDADEREAITAVEEVPNLWLMTSGPIPPNPSE
LLGSGRMKELIAQMLSHFTHVIFDTPPINAVTDAVILAASADGTIVVVEQGRTTFPTLRHAKQMLDRVGGHTLGVVMNKV
RASGGSSYSYAYGYGNYGSKSNQGTTTVRSADPSAFQPRITHRERLARIALRLFWRLRSDLDRS
>gnl|bykdb|A0A2V7YWD4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=253 residues).
MDVVRTKSMTATLVTDSEAATDREDLDPRLVSFLKPESFEADQYRMLRYAMERACPSDGSRVIAITSPISGDGKTLTAVN
LAGTIARGGQSRVLMVDADLRRPSLAKVLGHSNVHRGWGLVDAILDRRLSLEQIAWPLQPFNLSVVTSRRPQADTYELLA
SGRFGELLRDARQRYDCVVVDTPPVLPAPDSRLLAEWIDGYVIVVAADKTPRKLLEETFALLGPAKILGLVFNRESYKGS
RYGRYYYAYSSRS
>gnl|bykdb|A0A2V7ZTY7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MSRLEAALWRAETLNDEPAAPPTVSGGQGSRDCATGGQRPPDRTSAGQRPPDSAKAKRVEQALAAITAPAPDAAPARVTP
DGVVAERLVTTDGLDFSTVEQYRKLAATLHHAQVERDLKVVMVSSAVSGDGKTLTSTNLALTLSESYHRRVLLIDADLRR
PSVHRVFQLKNAGGLSECLTAEIERRLPLVQATPYLSLMLAGRPDSDPMSGLTSNRMRRLVGEAAATFDWVIIDTPPIVL
MPDANLLAAMADAAILVIGAGKTPYKLITRAVDTLGRAKIIGVVLNRVDRRHVAGGYTYGYYGER
>gnl|bykdb|A0A2V7ZVL9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MSRLEAALWRAETLNDEPAAPPTVSGGQGSRDCATGGKRPPDRTSAGQRPPDSAKAKRVEQALAAIMAPAPDAAPARVTP
DGVVAERLVTTDRLDFSTVEQYRKLAATLHHAQVERDLKVVMVSSAVSGDGKTLTSTNLALTLSESYHRRVLLIDADLRR
PSVHRVFQLKNAGGLSECLTAETERRLPLVQATPYLSLMLAGRPDSDPMSGLTSNRMRRLVGEAAATFDWVIIDTPPVVL
MPDANLLAAMADAAILVIGAGKTPYKLITRAVDTLGRGKIIGVVLNRVDRRNVAGGYTYGYYGER
>gnl|bykdb|A0A2V8B278 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MAEPKAPHPLRPATTADHPAAAAPTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSTQMYRAQARLLI
EDERATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAEKPSTPATLLHDLKQKIVGLVR
PAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVDVTFDSMDRRFAATAANTLVDEFVDQNLQVKLQSTENMI
DWLDKELDKQQQKVQDSERGLAEYRERQNALSLDDKQNIVLARLNKLNDDVMMARSRRIQKETLFNQIKSVSTQAPDTIP
AIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARASIKNDYESALIEEQTMARGLE
NAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTRERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGL
TLAIAVAYGLDYMNDTIKTPEEVTRRLRLPFLGLVPSVRGDKHPLLASSHVPHDFGESFRALRTALVSKYPSAGTKIVVV
TSAQPLEGKTTTAANIAMALAYGGSRVLLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGR
TPPNPSELLSSERMKTLLTNLAHGPFDWIIVDTPPVLAVTDAVILAPLVSGVTFVVGAEMTRRRLAERAIETVMQTHPKY
AAVVLNKVDFARNKYYYHRYYGHQYKNYYAEAAI
>gnl|bykdb|A0A2V8BDI4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=552 residues).
MDLPRMSGRSDATSSWRSAATSIWGRKPRPRHRRCARRRPRPSWRSPRERQWRSTRRPDRAIVARSRGRCSAASTARDGS
CFSEDTSMSRLEDALRRAELANRQAKMKTEAEAAVKTPAVAAWSEPESAAALPAVAAWSEPETVTAPFAVAGWSEPESAA
APPVVAAWSEPETVTAPLAVAAWSEPESAAAPPVVAGWSEPETVTAPFAVAGWSEPESATAPPAVAAWSEAVTAPFAVVA
SSEKETVTAPFVVAAPSGPENVQPPLPPLPTWDFDGSVAAAELVEAPDEPKVVTPSDWKTYRFGAVASRKTIVDPDVESS
LVEQYRRLAASLHHAQLQRNVRTVMITSAVAAEGKTLTATNLALTLSHSYKRRVLLIDADLRRPTVHEAFRIANDTGLVD
VLRKTETRRLPLCRASETLWILTAGMPTSDPMSALASEEMKLLLGEAIEHFDWVIVDSPPVALLSDANLVAAMVDATILV
IGAATTPYPLVRRAVESVGASRIIGTVLNRIERGQMVGGYGFYDYYGYGTRDDGARKAGKADAAREAAMDAA
>gnl|bykdb|A0A2V8BM40 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MPDHRQRTSSGTGSNPPAPAPLAYAADNDVHILDRLAVIYRYRYIATAVFVLATSAIMIQSYTSLELFRAQARLLIEDER
STAVPGVSADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNMAAIPEFNGTAEPPVTPLTIAHDLEKRIVAFVRPAASE
ATDTRKIDEAPSESGLVNAFIGQVTVEPVPGSKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKE
LEKQQQKVGESERGLADYRERQNAMSLDEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEPVDTIQVIATS
PEVSAAKGKVFAIQSEKARIAERYGDKHPTMQKAMADLTEAQRQYDTAVTRAAQAIKNDYETAVLEEQTFSRGLDSAKSA
AQDLSRKSVDYNVMERDAKTNREIYSTLLTRERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIG
LAYGLDYMNDTIKTPEDIARRLRLPFLGLVPSVRGDAHPVLASSNVPHNFGESFRALRTSLTSKYPTDGTKIIAVTSAQP
LEGKTTTAANMALALAYGGSRVLLIDADMRRPGLHRPLRLTNERGLCQVLMGQARVRDVIQRTVDPNLLAITAGSTPPNP
SELLASERMKTLLTNLSHGPFDWILIDTPPVLAVTDAVVLAPMMSGVTFVIGAEMTRRRLAERAVETVMQARPKYAAVVL
NKVDFARNKYYYSRYYGHQYKNYYAEAVS
>gnl|bykdb|A0A2V8BV42 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=753 residues).
MADLPPNARADSSPGVFAPPPAGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIED
ERSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMINDFQTRLMGLLRKP
AAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNW
LAKELDKQQQKVRESEQALAEYRDKQNAMSLDDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIPV
IAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQSVKNDFETAVLEERVLAQNLDA
AKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLV
LAIGVAFGLDYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDKHPLLTSAHVPHDFGEAFRALRTSLISKYPATGTKTLLVT
SAQPLEGKTTTAANIAMALAYGGSRVLLIDGDMRRPGLHRPLRLTNDRGLSQVLIGQARVRDVIQRTVDPNLLAITAGKM
PPNPSELLASERMRTLLTNLAHGPFDWIIIDTPPVLAVTDAVILAPMVSGVTFVVGAEMTRRRLAERALETIMSSRPRYA
AIILNRVDFARNKYYYSRYYGHQYKNYYAEATG
>gnl|bykdb|A0A2V8CEF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MAELKAPHSLRPATTADHPAAAAPTSTYTPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSIQMYRAQARLLI
EDERATAVPGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAQKPSTPATLLHDLKQKIVGLVR
PAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVDVTFDSMDPRFAATAANTLVDEFVEQNLQVKLQSTENMI
DWLDKELDKQQHKVQDSERALAEYRERQNALSLDDKQNLVLARLNKLNDDVMMARSRRIQKETLFNQIKSASTQAPDTIP
AIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARASIKNDYESALIEEQTMARGLE
NAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTRERELRVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGL
TLAIAVAYGLDYMNDTIKTPEEVTRRLRLPFLGLVPSVRGDKHPLLASSHVPHDFGESFRALRTALISKYPSAGTKIVVV
TSAQPLEGKTTTAANIAMALAYGGSRVLLVDADMRRPGLHRPLRLTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGR
TPPNPSELLSSERMKTLLTNLAHGPFDWIIVDTPPVLAVTDAVILAPLVSGVTFVVGAEMTRRRLAERAIETVMQTHPKY
AAVVLNKVDFARNKYYYHRYYGHQYKNYYAEAAV
>gnl|bykdb|A0A2V8CN98 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=477 residues).
MSEFLTRRVQEDQLRRDQDALAQLLAQGPDSLGFSERLAAIGAVQGSADLTRALSELTTKRADRRALLYRYTDDHPAVRR
VTTDIDELEHQTIPGLIRGLLAELGTQRRGLASQLETGGRELQGIPQRAIEDARLRRDVSIAENLFTSVQQRYSEARLAE
ASSIADVRVLDAAVAPETPVKNTAVRLLIMGLFAGLGFGVVGAVVIDRFDPRVRYPAQVTTDMGLRILGALPHVKKRAGA
SDDESGALVIETMRGVRLSLIHAYGTAGPLVVTITSPGPGDGKSFVSANLALACAQAGQRTLLIDGDTRRGALHRVLGAV
RRPGLTDFLAGHVSFEGLIQTLKFGSLQFIGGGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGT
MTGAMMLVLRTGATNLDLARTKVAMLENLPIRVVGAVLNDVRLGQMYGEYYGYMAGYGTTTEDGGTRIARRRLQGAL
>gnl|bykdb|A0A2V8CRT6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=685 residues).
LELFRAQARLLIEDERSTAVPGVSADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNVAAIPEFNGTAEPPVTPLTIAH
DLEKRIVAFVRPAASEATDTRKIDEAPSESGLVDAFIGQVTVEPVPGSKLVDVLFDSRDPKFAQAAANALVDEYVEQNLQ
VKLQSTQNMIEWLDKELEKQQQKVGESERGLADYRERQNAMSLDEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRS
IGAGEPVDTIQVIATSPEVAAAKGKVFAIQSEKARIAERYGDKHPTMQKAIADLTEAQRQYDTAVTRAAQAIKNDYETAV
LEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLTRERELRVSSNSRQNNVRVIDHAEAPGGAMSPSGR
RTWLLALGIGLALGIGLAYGLDYMNDTIKTPEDIARRLRLPFLGLVPSVRGDAHPVLASSNVPHNFGESFRALRTSLTSK
YPTDGTKIIAVTSAQPLEGKTTTAANMALALAYGGSRVLLIDADMRRPGLHRPLRLTNERGLCQVLMGQARVRDVIQRTV
DPNLLAITAGSTPPNPSELLASERMKTLLTNLSHGPFDWILIDTPPVLAVTDAVVLAPMMSGVTFVIGAEMTRRRLAERA
VETVMQARPKYAAVVLNKVDFARNKYYYSRYYGHQYKNYYAEATS
>gnl|bykdb|A0A2V8CU57 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=524 residues).
MSRLEDALRRAELANRQAKMKTEAEAAVKTPAVAAWSEPEAVTAPFAAAGSEPESAAAPPVVAAWSEPETVTAPLAAAAW
SEPETVTAPFAVAGWSEPESAAAPPVVAAWSEPETVTAPFAVAGWSEPESAAAPPVVAAWSEPETVTAPLAVAAWSEPES
AAAPPVVAGWSEPETVTAPFAVAGWSEPESATAPPAVAAWSEAVTAPFAVVASSEPETVTAPFVVVAPSGPENVQPPLPP
LPTWDFDGSVAAAELVEAPDEPKVVTPSDWKTYRFGAVASRKTIVDPDVESSLVEQYRRLAASLHHAQLQRNVRTVMITS
AVAAEGKTLTATNLALTLSHSYKRRVLLIDADLRRPTVHEAFRIANDTGLVDVLRKTETRRLPLCRASETLWILTAGMPT
SDPMSALASEEMKLLLGEAIEHFDWVIVDSPPVALLSDANLVAAMVDATILVIGAATTPYPLVRRAVESVGASRIIGTVL
NRIERGQMVGGYGFYDYYGYGTRDDGARKAGKADAAREAAMDAA
>gnl|bykdb|A0A2V8D468 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=293 residues).
IPFSPNKTLTLELTFVVGLMFAVGLALFVEYLDDRIKTPDEIWMHLGLKTLGLVPRVTPELVGTHSLINNGAPPNLAEAF
RALRTSVMFSSAGGRAPTILVTSTGPGEGKTMTSCNLAVSIAQTRQRVLLIDADMRRPRVHEVFDVEQEPGLSNLMVGTA
QSREAMHPSGVKDLWILPAGHIPPNSAELLTSQQFKDLLSALGGHFDWIVLDSPPVSAVTDAVQLSHDVSGVLFVVGAGK
TGRRIAQWALDQLGLAQATMFGAILNGINVDRHPYYYSGYYRKEYTNQYTRTL
>gnl|bykdb|A0A2V8D8B1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=470 residues).
MPCPLKSARTSSCRSWPISTGPGQSDRTALDTVPAILANQFVQQQKSELAELQRQQAQLSDKLGDKHPDMVKNRHAIQTA
EAKIQGEIAKVVESMKHDYQTALTQEQSLMHALDQQKADALALNRKGIGYGALQRDAASNRQIFEALMQRTKETGISGAL
KTSNIRVVDNAETPRVPASPNKLANMMLAFIGGSVLAVALVFFFEYADNRIKSPNEIKAHLGLPFLGMIPSLTDQVEGTP
LLDNGVNAGFAEAFRMVRTNLVFSTVDNGTQSICITSSGPGEGKTLVGSNLAVALGQTGQRVLLIDADMRRPRVHEVFEM
AQEPGLSNLLVGDTKTAEAVKQTRSKGLWVLPAGRIPPNPAELLGSTRFKDFVTTVGQHFDWVVIDSPPVMAVADAAVIA
NIASGVVFVVGAEMTSRTVARTAVEQLANARGRVIGAVLNRVDLDNNAYYYSQYYRRQYGEYYTSTSASA
>gnl|bykdb|A0A2V8D8G9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIDQALRIREVASGAAAPETGTNQSRGSSSLNQYPNEEPDRHPLEEPASPDSFESAQPFRPASTSRRTATRRAKLPNS
ADIQARLVTGALSTVSLEQYRRLAAVLHEDQVQRQLKTVMITSALPQEGKTLTLVNLALTLSESYARRVLVIDADLRWPG
LHTVLDIPNDRGLSEALRDGRHELPFVEVSSRLSVLTAGKPGPTPLAGLTSSRMGEVIEECAARFDWVLIDTSPVGVLPD
AQVLARLVGAVILVIGAGSTPAAAVERAVAELGGPDSIIGTVLNRVEEGRIPDADYYGQYGSSRDGR
>gnl|bykdb|A0A2V8DMJ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=323 residues).
MADGARRGNRCRRCRVDRRGQSSPGAWKRTDRSADGARTSMMRAQGRMLTDVESLIEAPHGLGLSQRPALCDVTADRARI
SEKLVSLVARDSCAADQYRALRQTVERLRRERGFQVIGVTSPCPGDGKTVTTLNLAGALAQSPDSRVLVVDADLRRPSVA
EYLALPRTSFPGLAEAILDPAYDLAAVVRCLDTFNLSVLPAGTPQVTPYELLNSPRLEGLLRDARRTYDCVLIDTPPAVA
LPDCRLIERFVDAFLVVVAAHKTPRTLVAEALNVLDPAKIAGVVFNADDRSRPSEYGYGYYGYPERVTWWQRLFGTVRSA
RVR
>gnl|bykdb|A0A2V8DZN4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=311 residues).
MRSPAAALTGASAPAAPGLSVAHRVELISFRQKTSLLAESFRTTLTSILFSQRNGAYPRVLVLTSASPKEGKTTVVSNLA
ITVAEIRRRVLVIDADMRRPRLHKVFSVDNDHGLSNLLMEPEPLDAAALEGGCVPTQVPNLFLLPSGTSRTHASSLVHTE
RLAEIVVLAREHFDMVIIDTPPMVNIADARVLARHSDALILVVRSGQTTRDAARWAQARFAEDGTAVLGTILNFWNPKTP
GYAYYKHYYAGYYHYYGDGSGKGGGNSVGPQDGEEPVAVERAAGASRWVADVDVHPDEGSRRRPRYARSEA
>gnl|bykdb|A0A2V8EGM3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=237 residues).
MARSMNHPRPDSTSSGRRCSPASEQFRRLAATLLQNQRGENIRSVMITSAVPADGKTLTALNLSLILSESYKRRVLLIDG
DLRRPTISAATNLAKAEGLSEIIAAADERRVPLVQLTETLTLLPGGRPNPDPLSGISSLRMQQLLREAVERFDWVILDTP
PVGVAADAGLLCPMVDGTLLVVRAGKTPYKAIEHALEAIGRDRLLGVVLNGVQEHDRAEAYESGYYYSSQASDNVTS
>gnl|bykdb|A0A2V8EPD9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=437 residues).
MTRLADALLRANRQNQLAASAAATALATPESEPAQDAAAPSVAPVGPVARAASPAPVVVAPAAPVVLAPVVVPIAPVAPV
AAAPAPAAPVALAAAAPVPAAAAAPVARVAPAVHVAVPPAAKPTAPAAPAAVPKPPIAPARPVAASASNAPAASAAPRPA
GAKRAPAWSREASIEKPIVHAAPTGSSLIAVPASADQLTLWRSDPETAGKLVGTDGFLPSAMEQYRKLAAILHHAQMERG
LKVIMTSSAMPGEGKSLTSVNLALTLSDSYRKRVLLIDVDLRRPTVQRIFGLPPVGGLTEALTADEDRQIVLTRVSDSLF
VLPAGRPESDPMSGLTSDRMKRVLAQAASHFDWVLVDSPPVGLLPDASLLATLVDGVLLVIRSGKAPFPLVKRAVEIITH
QRILGVVMNAIDFKHDRNAGGYYEYYGAGYYGAPSTK
>gnl|bykdb|A0A2V8ESQ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIDQALRMREVASGAAAPETGTNQSRGSSSLNQYPNEEPDRHPLEEPASPDSFESAQPFRPASTSRRTATRRAKLPNS
ADIQARLVTGALSTVSLEQYRRLAAVLHEDQVQRQLKTVMITSALPQEGKTLTLVNLALTLSESYARRVLVIDADLRWPG
LHTVLDIPNDRGLSEALRDGRHELPFVEVSSRLSVLTAGKPGPTPLAGLTSSRMGEVIEECAARFDWVLIDTSPVGVLPD
AQVLARLVGAVILVIGAGSTPAAAVERAVAELGGPDSIIGTVLNRVEEGRIPDADYYGQYGSSRDGR
>gnl|bykdb|A0A2V8F8T3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=656 residues).
MDLPRMSGRSDATSSWRSAATSIWGRKPRPRHRRCARRRPRPSWRSPRERQWRSTRRPDRAIVARSRGRCSAASTARDGS
CFSEDTSMSRLEDALRRAELANRQAKMKTEAEAAVKTPAVAAWSEPEAVTAPFAAAWSEPESAAPLPAVAAWSEPETVTA
PLAAAAWSEPESAAVLPAVAAWSEPETVTAPLAAAAWSEPESTAVLPAVAAWSEPETVTAPFAVAGWSEPESAAAPPVVA
AWSEPETVTAPFAVAGWSEPESAAAPPVVAAWSEPETVTAPLAVAAWSEPESAAAPPVVAGWSEPETVTAPFAVAGWSEP
ESATAPPAVAAWSEAVTAPFAVVASSEPETVTAPFVVAAPSGPENVQPPLPPLPTWDFDGSVAAAELVEAPDEPKVVTPS
DWKTYRFGAVASRKTIVDPDVESSLVEQYRRLAASLHHAQLQRNVRTVMITSAVAAEGKTLTATNLALTLSHSYKRRVLL
IDADLRRPTVHEAFRIANDTGLVDVLRKTETRRLPLCRASETLWILTAGMPTSDPMSALASEEMKLLLGEAIEHFDWVIV
DSPPVALLSDANLVAAMVDTTILVIGAATTPYPLVRRAVESVGASRIIGTVLNRIERGQMVGGYGFYDYYGYGTRDDGAR
KAGKADAAREAAMDAA
>gnl|bykdb|A0A2V8F916 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=753 residues).
MADLPPNARADSAPGVFAPPPAGAPYAPDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIED
ERSTAVPGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMINDFQTRLMGLLRKP
AAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVDVTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNW
LAKELDKQQQKVRESEQALAEYRDKQNAMSLDDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIPV
IAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQSVKNDFETAVLEERVLAQNLDA
AKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKELRVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLV
LAIGVAFGLDYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDKHPLLTSAHVPHDFGEAFRALRTSLISKYPATGTKTLLVT
SAQPLEGKTTTAANIAMALAYGGSRVLLIDGDMRRPGLHRPLRLTNDRGLSQVLIGQARVRDVIQRTVDPNLLAITAGKM
PPNPSELLASERMRTLLTNLAHGPFDWIIIDTPPVLAVTDAVILAPMVSGVTFVVGAEMTRRRLAERALETIMSSRPRYA
AIILNRVDFARNKYYYSRYYGHQYKNYYAEATG
>gnl|bykdb|A0A2V8FGH1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MGRIDEALRRSTAKKDTQVKAVEVPPDDMFVSPWNFAGPPEPVAQGPVRDGALDEPSSTGLHVIWPSLLARFKNEWRDRL
AIGIDVEPGLAEQFRRLAATLLQNQRGENIRSVMITSAVPADGKTLTALNLSLILSESYKRRVLLIDGDLRRPTISAATN
LAKAEGLSEIIAAADERRVPLVQLTETLTLLPGGRPNPDPLSGISSLRMQQLLREAVERFDWVILDTPPVGVAADAGLLC
PMVDGTLLVVRAGKTPYKAIEHALEAIGRDRLLGVVLNGVQEHDRAEAYESGYYYSSQASDNVTS
>gnl|bykdb|A0A2V8FSM8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=825 residues).
MSQELQSLARHSYPTSTQPLSTIDLPPTAVSIEPPGPGLKRDYSGPVEYWQIVRRHKGAVLLATVAGALLGFAMTLSEPR
IYQAKTTLEYQGINEEFLDMKKVNPVVDTSYLDSDISTQVKILESRALISRVREKMATRPQPERLQPPDRLGMWRTALRL
NAPTADGLWKQALGSAADGVRVRSSGTNRIIDMSCDSTNGQIAADFCNTLAQEYIDQSLEARWKTTEYTGQWLTKQLDDL
KIKLEKQEEGLQAYANATGLIMTSEKNNVQEAQLGDLEKELSVARADRIAKQSKYEMSSSSPPAALPEILDDPSQRTSQT
TLYDLRAKLALLRVTYTTSYAEVRKVMAQIAAIESSLEGTRENVATRIRKEYEGALRREKLLETAYAEKVHQLASKAEET
AHYNLLKRDVDGTRKMYESLTQRLKEASMASALRANNVRVVDPAEEPEAPYKPDVVRRITFGLIFGAMFGVAFSVLRERA
DRTLQDPGDVSYYLGVPELGVVPVGEPIDLPRSGVRSPAAALTGASAPAAPGLSVAHRVELISFRQKTSLLAESFRTTLT
SILFSQRNGAYPRVLVLTSASPKEGKTTVVSNLAITVAEIRRRVLVIDADMRRPRLHKVFSVDNDHGLSNLLMEPEPLDA
AALEGGCVPTQVPNLFLLPSGTSRTHASSLVHTERLAEIVVLAREHFDMVIIDTPPMVNIADARVLARHSDALILVVRSG
QTTRDAARWAQARFAEDGTAVLGTILNFWNPKTPGYAYYKHYYAGYYHYYGDGSGKGGGNSVGPQDGEEPVAAERAAGAS
RWVADVDVHPDEGSRRRPRYARSEA
>gnl|bykdb|A0A2V8G9Y9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MTRLAEALRRAEDHSGAEAPTSDSRVLSQPAGEPLTRVPDTLSVQRADQDWVAELEIQKHRTLGVFHGFGANAVDKLIVT
PTVPHAAVEQYRKLAASLHHAQLERQIKVVMITSAAPGEGKTLTSTNLALTLSQSYRRNVLLIDGDLRRPSVHSVFDVPN
VLGLSDGLKSEVEHKLSLIQISEHLTVLPAGRPDSDPMSGLTSDRMRRLVAEAAARFDWVLIDTPPVGFLSDANLLAAMA
DVTLFVVRAGRSPFRLIQRALDAVGRNRIIGVVLNAVKESDDVVGFGYYGYYGHYGPQRKRGARRA
>gnl|bykdb|A0A2V8GAF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=384 residues).
MFALDCAGCRGGAGDGSARYVIPRHRGPAGLPPRPDDAVQHSAAYDRGAHATSVASNRVDGGVGHDRLGLDCRWRSPCRH
RKRANRPVGGWPARVTREDVSTQLDQTATSSESARRADAAARLREFVRANGERFQIAEQLVSLIAPGSFAADQYRALRHN
LERLRRESGLQVLAVTSPGPGDGKSVTALNVAGALAQSPHAQILIVDADLRRPTVAEYLGLGSQRSPGLVEAILDPQYTL
QRVVRRLEGFNLSVLPAGTPQSTPYELLNSRRLEGLLSEARRLYDFVLIDTPPLVPFPDCRLLGRWADGFVLIVGANKTP
RKLLAQALNLLDPAKLIGVVLNGEDRPLSSHYGYYYDTHARDRHAGWWRRVWNARHSQGPQHLR
>gnl|bykdb|A0A2V8GEZ2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=262 residues).
MHDFASSVEQPFRIAPVDRGNGVRATIDRLPGKVVLSPDTPSAVVEQYRRLAATLHHAQRDRQAKVLMISSAMPGEGKTL
TATNLALTLTESFRRRVLVIDADLRRPSMHHTFGLPNNTGLNDALLGRDNMPTAFEMSSRLTVLPAGCPNPDPIGVLTSP
AMRQLVKFARDGYDWVLIDTPPVGLLTDAHLVAQMVDAVVMVVSAGAVPYRVVQRSADALGRDRIIGVVLNRAAAAPFER
AYGYGGYGGYYGAHSHEDQEQA
>gnl|bykdb|A0A2V8GGF6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=320 residues).
MGTVRARGHHDRHWSDVHRRRVALHRERQRAHRPADGAWTGVMASEGRALTDPGEIPAAPPMERDAVLFSRAFRHGSGRE
AIDEEIVSLVDPASFAADQYRSLRHSIERLRTDASSRVLAITSPGPGDGKTLTTLNLAGALAQCRDLRVLVIDADLRRPA
VSEYLGLEARRSPGLADLLRDPDYEIDQVTHRLERFNLSVVPAGSPQPAAYELLNSTRLESSIETARRRYDYVLIDTPPL
VPLPDCRLLAKCVDGFLLIVAAHRTPRKSLARALDMLDPSKLIGIVFNGDDASGSHQNSYYAYYTPQGRDRQRRRWWRRG
>gnl|bykdb|A0A2V8GVG4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=239 residues).
MAKKAQLDQHLVTLTSPGSFAAEQYQGLRLTIERLRRGRTLQVIAVTSPAAGEGKTLTAINLAGALARGADDARVLLIDA
DLRRPAVAKQLAIDELSQGLTEVVENAQTSLGAVTQKLKPFNLSIVTAGTRKGAVHQVLRSPRLDAVLAEARGRYDFVVL
DTPPLLPVFDSALLANAVDGVLMVVAANQTPRKLLGEALNMLDPGKVLGIVFNRDAKPMFGYYDAYYKDYFPEQAVTRA
>gnl|bykdb|A0A2V8H566 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=280 residues).
MSPEDRSTALEAVVRDGRIAAVTSPFVRVEPPPGSARFRHAGAGAAGRLREKLVVARNINQGVLEQYRKLAASLHYAQSQ
HGTRVLMMTSTLASEGKTLTATNLALTLSESYRRRVLLIDADLRRPTIHDMFDLPNVSGLNDVLYARDAALRCELFTMTA
QLCVLTAGRPNPDPIGGLTSERMRQLVAAGTAEFDWVVIDTPPVGLLTDARLMSSMVDAVIFVISAGRTPYRLVHRAVEA
VGRDRIFGVVLNKVAVQDLWRDYGSYSYSYYGYGSPRTKD
>gnl|bykdb|A0A2V8HKU7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=320 residues).
MGTVRARGRHDRHWSDVHRRRVALHRERQRAHRPADGAWTGVMTSEGRALTDPGEIPAAPPMERDAVLFSRAFRHGSGRE
AIDEEIVSLVDPASFAADQYRSLRHSIERLRTDASSRVLAITSPGPGDGKTLTTLNLAGALAQCRDLRVLVIDADLRRPA
VSEYLGLEARRSPGLADLLRDPDYEIDQVTHRLERFNLSVVPAGSPQPAAYELLNSARLESSIEEARRRYDYVLIDTPPL
VPLPDCRLLAKCVDGFLLIVAAHRTPRKSLARALDMLDPSKLIGIVFNGDDASGSHQNSYYAYYTPQGRDRQRRRWWRRG
>gnl|bykdb|A0A2V8I604 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=296 residues).
MSRIQDILNKAERDGAVRRTRPLGSETSAAAALAAPAPMARPIVEPPAPPPPIEPPAAPGWSAAAAVAPPVVQIDRRLAA
ALAPQSLAAEQYRSVRTRIRQAENGRPLRAILVTSPGKGDGKSLTAANLALTMAQEFQQRVLLVDSDLRRPTVHRLFGLQ
QSPGLVDILMGGSTLEESLVSIAEHHLTILPSGPVPTRPAELLGSSAMRRLLDTVRTQFDRVLLDMPPVAPLADVSIVAS
MIDGVLMIVRAGATTKPAIERALSGLDASKVLGIVLNEAGSDGAGYAYDGYGYIGG
>gnl|bykdb|A0A2V8J066 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIQDILNKAEREGSARRTRSIGTDAPVGTPPSPVAAPPPTPVHRPIVEPTPIAERREARARLAEQASPHREVNLDRHL
VAALAPQSLAAEQYRSLRTRISRMENGRAVRVLIVTSPAKGDGKSLTAANLALAMAEEFSQRVLLIDADLRRPSVHHLFD
LPEAPGLTDVLMGGATLDDALVTLADHHLTVLPSGVPPSHPAELLGSAAMRRTIDTLRTRFDRLILDMPPVAPLADVNIA
AAVADGILLIVRAGMTQKPAIERALGGLDTTKVLGLVLNEVGAEATYQDYAGYKYVAG
>gnl|bykdb|A0A2V8JLJ1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=485 residues).
MEGLVRQFKAAAEAAKAAAAATATAEAAKAASIQVQAAKEPKPEEKPRPFLPEFNLSLDTVPAEVQLQIDQLDRDVSKLK
QGREPLQARIAAYQNRLNPPAPVAEELARLTRNYDEARQHYNVLAEKRSNSKMAATADSSDNNEMFKVIDAAFLPRQAIG
PNRRLIAALGGAAGLVLGLAIAFLREFTDSSLHTEDELAAAIKLPILASIPTVDEKRTRKRKSASVLRLQEHKGGSGPSP
LRHVDNKITDAILNPSCSAREHYRFLHSQLLAMQRKKHLKTILISSSGAGEGKTFSACCIAGMLAQEPGKQVLLIDADLR
RSTATTVLGTPSREGKNLGAILRGRSKVEESLERCEDLNLYFLSSGPMSSNPGELLSSAHIELVLRECAESFDWVIVDTP
PILGAADVNLMAPFCDAILLVVQSGKTPLKVIKDSIKRVGREQICGVILNRVKVARYGSYYDAYYRQPLNESSQRNSNLQ
LREGI
>gnl|bykdb|A0A2V8JXG1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=422 residues).
MAAIRDQIAASRGLLEDKLKADYERVVRDENALKAALAEAKAGAAQENQRAIQYSLLKQDVDTAKSLYTEFLQKTNQAYL
EVAQQQSNIRVISPARMPKGPVSPNRQRTILIGLLLSLSGGIGLAWLLERFDDSIRSVDDVNRYTQLPALAVIPAIGANN
SLLNGRRRKDNAGELLALDSGDKPTAKMQRARLMEFDGRSPASEAYRALRTALLLSAAGNPPKTILVTSVRMEEGKTTTA
TNTAIALAQLGASVLLIDCDMRKPSVHDVFGTSRTLGLSTYLARNVEIDELIQDLPGENLRMISSGPIPPNPAELLSSDR
MKRLLAQLSERYDHIVLDSPPLGSVTDAVILSTMVNGVILVVHGGRNSRQAVQRACHELSAVGARVFGIVLNNVDLRREG
HDDYYYYSYQYSYSADGKRTKT
>gnl|bykdb|A0A2V8KZ20 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=791 residues).
MKNFENLTISDYIDIARRRIWYVVTTTTLVAAGTVLFALRLPAIYKSETTIAISSRFLPENYMPTIDRQTITDRMDFARQ
QLQSRTFLEGIVEEFHLAGPDGVEKAAEVIRNKIEITVLTANTFKLGFPAADPFSAQAVTKRLTERIIQLNDSFRKEKVQ
VADQFLEEQLEQAGNELSEAERKLLQLRNGAFPGVTTDVVTPDVVRDLQAQLAKLDAQVESANDQRKVLQRRLEEHRQLK
IALNASSPPPPPAAHTESTTAAAIETPPPSPLETELANRQAQLAAASVRYTPRHPEVVRLTQEVRELEGLVRQFKAAAEA
AKAAAAATATAEAAKAASIQVQAAKEPKPEEKPRPFLSEFNLSLDTVPAEVQLQIDQLDRDVSKLKQGREPLQARIAAYQ
NRLNPPAPVAEELARLTRNYDEARQHYNVLAEKRSNSKMAATADSSDNNEMFKVIDAAFLPRQAIGPNRRLIAALGGAAG
LVLGFGIAFLREFTDSSLHTEDELAAAIKLPILASIPTVDEKRTRKRKSASVLRLQEHKGGSGHSPLRHVDNKITDAILN
PSCSAREHYRFLHSQLLAMQRKKHLKTILISSSGAGEGKTFSACCIAGMLAQEPGKQVLLIDADLRRSTATTVLGTPSRE
GKNLGAILRGRSKVEESLERCEDLNLYFLSSGPMSSNPGELLSSAHIELVLRECAESFDWVIVDTPPILGAADVNLMAPF
CDAILLVVQSGKTPLKVIKDSIKRVGREQICGVILNRVKVARYGSYYDAYYRQPLNESSQRNSNLQLREGI
>gnl|bykdb|A0A2V8KZG2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=185 residues).
GKTTTASNIAISLAQLGGSVLLIDCDLRKPSIHTAFGISPMPGLSTYLAQNGKIDDLIHHASENLYLMPAGPTPPNPAEL
LSSGKMKRLIEIMAERYDHVVIDTPPLGSVTDPVILSTMVDGVVLVVHAGRNKRNAVQRACRELSAVGARIFGVVLNNVN
MKREGYADYQYYYYGYSSKEEVSEN
>gnl|bykdb|A0A2V8LBV1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=384 residues).
MKREVETSRQLYEAMMQKVKEYSIASAITANNVRVVDPATPPGAPYKPDIYMYTMLGLATGVFLSILLIVRQARVDRTIQ
SPGEAPTYLKVRELGVILSAEADSTLGRPGRSKHIPSLQSLIQLGKPAGNGSFSKAVRKYAGENRAPKRVELMTWEKRSS
LFAECFRTTAASLLFSEPNGAPPHVLVITSTSPRDGKSTIASNLAVALAETKRRILLIDADLRRPHLHTVFEMDNRWGLT
DILQADIEIQEYPLEMLVQQTVVPNVYITGSGSGRESSVHLLHSKRLPDLLRRVRKEFDVVLIDAPPVSQIADARVLARL
SDGVIFVVRSAETTRDMAMAACRQFSEDRSRVLGTILNMWDPREHNQGHYSHYYDGYYTYYAKK
>gnl|bykdb|A0A2V8LCU0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=369 residues).
MGRIYDALKRAESNQRDFTSTNKSSVSRNGNPDNVSYFVQKNGHEHPWEKAPFTGMPSAFSSASTAHTAEATGGPALPGG
PAFRDAGATLGAVGSARAAEFSSREISAARVEPHLVAVTSPHSPECEQFRALRTRLLQAGERQGKRAFVITSAGMGEGKT
LTALNLAWLLAQTDGVSALVIDADLRQPCAAEYLGIETEVGLSEVLTGETKLTEAIVKLKPSGLHLLPGGAAREDVAELL
SGPRFGRLLEEARRLFDYIIIDAPPLGVFTDANLLMNRADAALLVVRASATRYSVVDRLLEQLPRERILGVVLNRAEAKP
EDTAYYYQPRHVRSVAVPDAPSKVKASEERYESTPGEPEMIYIEEEGVS
>gnl|bykdb|A0A2V8MBH9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=531 residues).
EEKLVSYAKNNQILSLDASQNTVVERLAGLNKQLLEAENDRKMAEAEYNAAKAPGAATALAEGAKDINESESKLADLKQK
RAQLLVDATEEAPEVKEVDQQIAELQKHLHESRARNTNTLLTNLETKYRQSLAREESLRKSFNQQKGETVTQNEAAINYR
ILQQEIETNKGLLDNLLQRSKENDVVLAGRPNNISIVDYAITPDFPVGPARMRSVMLAFVLALALGVGLALFLEYLDDSI
HSTDDVEKFLRLPALAVIPSMSGGVARRRRLLSSATALQKRNGNTSGTPELLLNVNGRSALAESYRQLRTSVLLSTAGRA
PKTLLITSSLPGEGKTTTAVNTAITLAQTGASVVIIDADMRRPRLRSIFDLPEREGLSSILSSEIKPEDMLHAIHRDEAT
GLNVLASGPIPPNPAELLGSEQMRKLIAVLSGAFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQL
LTDVGAKIFGVVLNNVSARSHDYYYYYQRYYHQSYYSHDVESDGADERASA
>gnl|bykdb|A0A2V8MKQ7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=241 residues).
MVGDARSPVAESYRHLRTSLLLSSAGTPPRTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDGDLRRPRLHAHFNIP
NVRGLTNCLSGESRDLDALIQTSEKQPNLKLLPLGPIPPNPAELLGSDEMRRLLASLSEKFTHIVVDSPPAISFTDASIL
STVVDGVILVVHGGRSSRAVVRRTKQQLMDVGANIFGVVLNNVKVESHDYYYQGYYSGYYQAADYQEDTAPNPADSRAAS
S
>gnl|bykdb|A0A2V8MLP9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=355 residues).
MGRIYDALKRAESAQRTPKPSVNRNGNPDNVAYFVPKHVHPWERRPFTGMPAGIDSASTAHTEEATGGPALPGGPASRDA
GATLGAVGSARAAEFSSREVLVARVEPHLLAITEPRSPECEQYRSLRTRLLQAGERQRMRAFVITSAGIGEGKTLTALNL
AWLLAQTDGVKALVIDADLRQPCAADYLGIETDCGLSEVLTGETKLLEAIVRLRPSGLHLLPGGAAREDVAELLSGPRFG
HLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIGPDETAYY
YQPRHQRVMAVPLEETEDDHGANPEMIYLEEDMVS
>gnl|bykdb|A0A2V8MUA1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=602 residues).
MQATNEVAQSDNKIREFYQKHFPGLPEDQAAILQTLNDLGRERVTVENSIESITTETKLLEQRRQEQQKFKIAMSSRAPA
GPSRAEGQARQPSRAEQLIAAKRDQLAAERLKHTDDWPDIRALKRDIKQLEEQVATDRAAETSAEKNAEETTEKRELGET
PGPAPADEVAASTLLPQLDFSIDFSDFEIQLRLEKLARDLKQRQEAEEEIVRKINQYRSRVNAPPEVLDELAGLQRQRQV
ANQRYELLSGKKFSSDLAGRVDTDINNQTFKVIDPANLPIRPFGPNRERMIMIGCLASFALGLALVFARELLDSTLSDED
TAASELKLPVLACVPNIPAGRKKRRERTNSKAGMVAVSVGHDSINKFSLDYADIRIKKVVLDPLTVSGEQFRVVRAQLSA
LQKKRNLSRILIASAIPNEGKTFSACCLAGILAQEPRKRVLLIDADVRTGSISHTLGIIDAGRGKGLADVLRGSATLEES
LVECSDLNFSLLPSGTIVQNPTEVLSSPEFERVMKDLAQFFDWIVVDSPPSLAMADADLLLRQCDAALLVVNADKTPLKL
IRDAVERMGRDRICGVLMNRVRNLSSSHYYSRYYRQVSLSSK
>gnl|bykdb|A0A2V8N1U8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=362 residues).
MGRVYDALKRADAQRQFKPSTPSVRRHGNSDNVAYFVPKNGHEHPWETAPTIGAPAAIDSASTAHTAEATGGPALPGGPA
SRDAGATLGAVSSTRAAEFQSQDISAARVEPHLVAITSPRSPECEQFRSLRTRLLQASERERKRAFVVTSAGIGEGKTLT
TLNLAWLLAQTDGVTALVIDADLRQPCAADYLGIETERGLSEVLTGETRLAEAIVRLNPAGLHVLPGGAAREDVAELLSG
PRFGRLLDEARKMFDFVIIDAPPLGVFTDANLLINRADAAILVVRASKTRYSIVDGLLEQIPRERLLGVVLNRAQAATDE
TAYYYQPRHQRAATEFVEDTVAREHEDTDQLEMIYLEEDMVS
>gnl|bykdb|A0A2V8N2J7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=700 residues).
MASTAGNSLSVFSILDALRRRKFILMISKILLTAGFAIFAHLQPDRFRATALIAAAQTTPPEYLRHVAPPPLNIEDHLWT
VREVLYSEPVLKAAARESKRYRSNKGDLSPQQLDEFKQAIGIKVDSEHSFQLTYEAGDRYDAMNVTNKLAELFVQNASAK
REQKTSEAANVINEQVDDLKNRLQRQNDQIQNYKTKAVHALPDHIDNTIKAIDSLKEQIQDRETKIAEEQAKRASIEREL
QDLESKGVLEQPMVHEKTPDEAKLDELRIQLAELQTRYTAQHPVVVAKKREISDLERTIASQPKKGRSEPSPTYLRYSQL
KSELEGIQQRIAAYQRDQENLSAQMDTYSRRLESTPQHEKVIDDMERELKVGEMQFHALLDKQLDTKLAKGFEQSEGGIA
FAVVEPAGLPRAPFSPQRVRLVALGVVAGLGLGLALIFVLEQNDTTFGNVDDFESFSTLPVAGIVPNIQNRNKKRTQPSV
VTVEEPDSIAAEQYRILAMRVQQQCDAAQAKTVIVTSAAGGEGKSLTAINVAMALAAATDGRVLLMDADMRKPRIGEYLK
LSVPTDKGFHNLLVHSDGNPDRYVMQFKQLYVIPGGVSQANPVAALSSAKARAVFEQLKQKFAYIIVDAPPVLPIADSQI
LAGIVDKVLFVIRARQTPRELFQHAIEGFEAANLLGAVLNDVDYQRSRYAYAYEYYKKLA
>gnl|bykdb|A0A2V8NJB5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=491 residues).
MNLVLDEIRQLGENRENGFLTLSRNGHRVVMFYREGMIQAVSSNLTSHRLGDYLVKAGYLTARDIQSVLKSAQRKHALFG
EAAVRERHLEPVELAEVVRRQSLELLQHVLTNDFSIDDFTNSVRSFYTPANITFAGLFLELCRNNAKSFEASGTRTVVLR
SGQDLSELPWYPEELGVLRELTHPTTVAGLVASTGMKETPLRRILGVFDQLGIIELKSENEFLSEHVAIVKRSGFPFDGL
IPVISNAVVSDKLEVLKNSSSFISEQFRNLKVRINESDNPAQVMIVSSPENGDGKSLVSANLALSYSLEVARRVIIVDCD
LRNPSLHRYLGVTEGPGLLQYLSNGRLAPHCYVRRLENLFFLTSGGIAENPIELLSLRRMKDLIEYLKNDFDTIILDAPP
LSPIADARIVTALSDGCIMVIRRGKTSYRSIEGAFRVIDQAKLLGIVFNDVKPMLFHTYYKRGYYDYGRDSQYMYSRGRK
RLEKPKNYLES
>gnl|bykdb|A0A2V8NMG8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=219 residues).
MLSTAGRPPQTLLITSSVPSEGKTTTSINTAISLAQTGANVLIIDADMRRPRLHSIFDVENRNGLSTILSSEMKEAEVLA
LIQQHEESGLHLMTSGPIPPNPAELIGSEQMRRLITTLQSTFTHIIIDSPPIASFTDGVLIASMVDGVVLVIHGGETSRS
LVRRSKQQLQDIGAKIFGVVLNNVDLHRHDYYYYHRYYSSSYYKAEADDTEQVASSAHG
>gnl|bykdb|A0A2V8NRW2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=362 residues).
MGRVYDALKRASTAKDENGAGRKKEDQKRRNGTAAGRKLSAVLPVVNGDEHPWDSSPLFSRAAHESASTAHTEERAGSAL
SGVTASRAAGATLDAAGTARALPEFMSLDISAARVEPHLIAVTQPRSAYCEQFRSLRTRVLQASERKKMQAFVVTSAGVA
EGKTLTALNLAWLLAQTDGVRALIIDSDLRNPCAADYLGIEDAIGLSDVLSGEATLEEAILHLNPSGLYMMPGGEARDDV
AEILSGPKFGQLLAELRRMFDYIIIDAPPLGIFTDATVLINRADAALLVVRSGKTRYAALDRIIEQLPRERLLGVILNRS
DEQLDETSYYYQRRYYRREDKGITKSATQAEMKNAEEVIVAG
>gnl|bykdb|A0A2V8PJQ0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=289 residues).
LDDTVKSLDDVDRYIHLPTLALIPAARSEKRLREGEAPTAGASTALAMVEDVRSHVAESYRHLRTSLLLSSAGQAPKTIL
VTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSNFNISNVRGLTNFLSGELPLDEVIQPFEKLPNLKLLPS
GPIPPNPAELLGSEQMRRLLTLLGEKFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVRRAKQQLLDVGAH
IFGIVLNNVKLDTHGYYYGGYYGRYYYKYGYYYSDYSDDDGKKAQTASG
>gnl|bykdb|A0A2V8PQZ0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=356 residues).
MGRIYDALKRAESAQRTPKPSVNRNGNPDNVAYFVPKHVHPWERRPFTGMPAGIDSASTAHTEEATGGPALPGGPASRDA
GATLGAVGSARAAEFSSREVLVARVEPHLLAITEPRSPECEQYRSLRTRLLQAGERQRMRAFVITSAGIGEGKTLTALNL
AWLLAQTDGVKALVIDADLRQPCAADYLGIQTDCGLSEVLTGETKLLEAIVRLRPSGLHLLPGGAAREDVAELLSGPRFG
HLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIGPDETAYY
YQPRHQRVMAVPLEETEDDHGAANPEMIYLEEDMVS
>gnl|bykdb|A0A2V8PQZ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=439 residues).
MKSEKDLRASSTLPAAPNFGQRGTAIPATAMAATATFQPTRTLSARASLNLRSSSTSTRAHSLQPPLRNSDRLSTLRAWG
EETMGRIYDALKRAESAPRTPKPSVNRNGNPDNIAYFVPKHVHPWERQSFTGMPQGYDSASTAHTEEATGGPALPDGPAS
RDAGATLGAVGSARAAEFSSREVLAARVEPHLLAITEPRSAECEQYRSLRTCLLQAGERQRMRAFVITSAGVGEGKTLTA
LNLAWLLAQTDGVRALVIDADLRQPCAADYLGIETDCGLSEVLTGETKLLEAIVKLQPSGLHLLPGGAAREDVAELLSGP
RFGHLLDDARKMFDYIIIDAPPLGVFTDANLLINRADAALLVLRAAKTRYSVVDRLLEQLPRERMLGVVLNRAEIEPDET
AYYYQPRHQRMMAAPVEGTEYDQGAANPEMIYLEEDMVS
>gnl|bykdb|A0A2V8QJ59 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=209 residues).
LVTSSQPSEGKTTTAINTAFILAQTGAEILLIDCDLRRPRLHVHFNISNARGLTNCLSGEASEIDSVIQSYAQLPNLKVL
PSGPMPPNPAELLGSEEMRKLLIALSKKFTHVIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVRRAKQQLLDIG
AHIFGVVLNNVKIEKTHDYYYGGYYGYYKSNYYTAEEDPEADQGSTAST
>gnl|bykdb|A0A2V8QJT6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=496 residues).
MLEAENDRKMAEAEYNAAKAPGAAGALAEAGAKEIEVTDSELAKLRQKRAQLLIEATEEAPEVKEIDQQIDVLQKHLADT
RARGAATLLKNLETKYRQAADREEALRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPN
NISVVDYAIVPDLPVGPARLRTVMFAFLLALAFGAALALFLEYLDDTVHSTDDVERFLRLPALAVIPAMSSASAPRRLLS
SATSLQKRNSSNGANPELLLNINGRSALAEAYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGASV
VIIDGDMRRPRLRSIFDLPEREGLSSILASDTTADDMLRSVVRDVSSGLFIMPSGPVPPNPAELLGSDQMRKLLATLSEK
FTHIVIDSPPVNSFTDGVLIGSMVDGVLLVVHGGKSSRDVVRRSRQLLLDVGAKIVGVVLNNVSVRSHEYYYYYQRYYHQ
SYYTQDPSEEVVATRS
>gnl|bykdb|A0A2V8QL35 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=362 residues).
MGRVYDALKRAESPERRITASKSAIRQNGNSGNVLYPGWPGNGHDHPWERNAFTGMPSAYDSASTAHTAEAASGPALPAG
TASRDAGATLGAVGSARAIEFSSREVSAARVEPHLVALTDPRSVACEQFRALRTQLLQAGEREHKRAFVITSAGQGEGKT
LTALNLGWLLAQTDGATALLIDADLRQPCAAEYLGIQTEVGLSEVLTGETKLTQAILKLEPSGLHLLPGGAAREDVAELL
SGPRFGRLLEEARKLFDYIIIDAPPLGVFTDANLLINRADAALLVVRAGVTRYAVVDRLLEQLPRERMLGVVLNRAQGKP
DDAVYYYQPRYQRAASAADVGDAGDAFEDRPGMIYIEEEGVS
>gnl|bykdb|A0A2V8QZU0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=366 residues).
MGRVYEALKRAAEQNGSKAKKEEKLAHDSRDERPPAPAAETNGHGRPHAAPGASAPVVGVNRDADDAAEFLFRRSKHFQS
PESATVSASNEHTVTPGGSALPAAASRAAGATLGADGSARTPEFVTLDISAARVEPHLIAITQPRSAHAERFRSLRTRVL
HAGERKKMQAFVVTSAGVMEGKTLTAINLSWLLAQTDGVRALLIDGDLRNPCAGDYLGLDAPTGLSEVLAGEATLAESIV
RLEPAGLHLLPGGAARDDVAEMLSGPKFSAVLKEARRMFDYVIIDAPPLGIFTDASVLINRADAALIVARAGRTRYAALE
RLLEPLPRERLLGVVLNGSDEQLSEQNYYYYRRYGSRRDAGKEQEG
>gnl|bykdb|A0A2V8R0I3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=395 residues).
MSSCASVATLQRRLKMSGQPSAVPVLGEEPMGRVYDALKRAESAQRHNHKPSDFSGRHNGDADNVSLFTPKNEQEHPWSA
SPFTAMPAAIDSAPTAHTAEETGGPALPGGPASRDAGATLGAVGSARAARFRSRDILAARVEPHLVAITQPRSPECEQFR
ALRTRLLEAGERKRMRAFVITSPGVGEGKTLTALNLAWLLAQTDGVKALLIDADLRQPCAAAYLGIETDCGLSEVLTGVT
RLTEAILKLNPAGLHVLPGGASREDVAELLSGPRFARLLDEARKLFDYIIIDAPPLGIFTDANLLINRADAAMLVVRASK
TRYAVVDRLLEQLPRERVLGVVLNRAETRLDDAAYYYQSRYQRQSPLVEAGTEEVADDEATDQPEMIYIEEGFVS
>gnl|bykdb|A0A2V8RSQ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=361 residues).
MGRVYEALKRAAAHGDAKSKRPDDAGPSRVDNTNGNAQHANGNGAAHTRAPVADPLFDRPSAFFHAPDAAHSSASTEHTA
QAGVGSALPGGVAARVAGATVDAVGSTRDATYTSIEVVTSRVEPHLVAITDPRSPHAEQYRSLRTRVLHAGERRKVQAIV
VTSAGIAEGKTITALNLAWLLAQTDGVRALLVDGDLRQPCAAAYLAFDAPVGLSEVLAGQASLNDTIVRLDPSGLFLLPG
GTPRDNVAELLSGPKFSAVLAELRRSFNYIIIDAPPLGIFTDATVLINRADGALVVVRAGRTRYGTLDRVLEPLPRERLL
GVVLNGADSAPDAQSYYYQRRYYRRDETQPGAPTKDVEEDV
>gnl|bykdb|A0A2V8SEH0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=286 residues).
MNATLTPRQPEGSAHAARRAGPRRPEAAAPAARPIGSSGAADEHLVSLLVPNSIEGEQYRALRHQIEQRHKDDGLTVVAI
SSPTPADGKTTTAINLAGALAQDPQARVLLVDGDLRVPSVSEQLGLGEVAGPGLVEAILDPGRSLDDVVRDLPLFNLSVL
PAGRSPSAPYEVLKSPRLGDLFQEARRRFDYILVDTPPIVPVPDCRVISKWVDGFMVVVAAHKTPRRLLQEALNVTEPGK
LMGLVFNRDERLLTRAYGYYGYGQQHGRARAAERGRGGAPRSQPCP
>gnl|bykdb|A0A2V8T7Z1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MMSRPSIEAERSVVSHPAARATAPAPPQKVEGHVVALTAPGSFEAEQYRTLNLVLERMQPGRPLRVIAVSSPAVGDGKTT
TTVNLAVTMAQNPAARVLLVDADVRRPAVGRKLGLGKVRLPGLVELIADPSLGIGGLARRVGPANLSVLLAGRSHADPFD
VLRSPRFEEFLRQARESYDSVVLDTPPLLMVPDCRQLSAWVDGILLVVAAHRTPRRLVEEALNVMEPDRLVGLVFNGDDR
PLSGYYRSYRAYGYPPRLARAAARRPRLR
>gnl|bykdb|A0A2V8TBM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=224 residues).
RTSLLLSSAGQPPKTVLVTSSQPSEGKTTTVVNIATMLAQTGADVLVLDCDLRRPRVHAHFGLPNSRGVTNYLSGDSQVA
DLVQTYERMPNLKVITSGPVPPNAAELLGSEEMRKLLYLLTENFTHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSS
RAVVRRAKQQLQDVGAHIFGIVLNNVKLEGTDYYYYSGYYSGYYSDDDTAPEGAATAGERPGAG
>gnl|bykdb|A0A2V8TKD8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=274 residues).
MSAFSGGDRDHTSDRSERACPAQSAGGLRGLDRHLVSLVAPASFEAEHYRMLRARIEARQEGKALQVIAVTSATIGDGKT
TTAINLAGALAQAREARVLLVDADLRRPSVALQLGLDDPRGSGLADAILDPERSIESVILRRLPLNLGLLTAGRLPPAPY
EALKSPRLGALFEQARRLFDYIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTPRKLVEEGLNLVDPAKTIGVVFNGER
RSRSGYYGYYHAYGRPPGRARRPGARSPAHDTLR
>gnl|bykdb|A0A2V8TKR9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=209 residues).
MLLSAAGSPPKIVLVTSAQPGEGKSTTVVNTAISLAQLGSSVLIIDCDLRRPSTHKILGINPAEGLSSYLTRNIGIDRLI
HKLQIPNLSLLPCGPIPPNPAELISSARMRDLLKEMAARYDHILIDSPPMMNVTDPVILSRMVDGVILVVHGGKSPRTTV
QRARQELQGVGAKIYGVVLNNIDLRREGYDSYYYHYNRYYGGYPSDTNV
>gnl|bykdb|A0A2V8UVN4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=319 residues).
MSKIFEALQKSEGEVAQEALPVLTDGGSQLGGVKVVDKILRETTGERRPADASDGAAEDLPAAATAIDVAGLESARRAAA
ETVEAVPGIRTVALHLSVETPVLPFDVRDGRAGEQYRTARTKLLHHPRQPRLVVISSAGSGDGKTVTSINLAGAMSLKTE
AEILLIDADLRKAQIAPLLGISGEPGLADVLMGTCRLEDAIVRLEQFPNLCVLPSGKPTAHPTELLDSNRWTALCASVRQ
QFKFVILDTPPIAAVADYDLIDAQCDGVVLVVRPDHTDRKLCMQAIDIVPKDRLLGVVLNCVRDWFLWKTQDYYSYTEN
>gnl|bykdb|A0A2V8VI82 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=279 residues).
MREAETGSGAGTQPDAGQPTRTVRSAPSHGPAGPIDQRLVSLLAPDSFEAEQYRTLRHVVEERRGEMSVIAVTSAAAGEG
KTTTAINLAAALAQDAESRILLVDADLRVPSAGRLLGLGDDLPGIADAVREPGALLEDFVRRRPPSRLSILPAGRTSDNP
YDVLKSPRMGEIVQAARRRYDTIVIDTPPIVPVPDSRVLAKWVDGFLLVVAAHRTPQRLVEEALHLLSHAKVAGIVFNGD
DRPSSAYYGYYYGYGRPRGDGRYDRGERPGSRKVAALWR
>gnl|bykdb|A0A2V8VU54 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=282 residues).
MSGYIDAKPDGSVDLMGRSRTATETQGVRGLDPHLVSLVAPASFEAEQYRALRSRLESRPEGRALQVLAVTSAVVGDGKT
TTAINLAGSLAQARDARVLLVDADLRRASAGLQLGLEDPRGAGLADAILDPDRSLPGLVQSLPANLGILPAGRLAPQPYE
VLKSPRFGAVLEEARRMFDYVVVDTPPLIPVPDCRLIARWVDGLLMVVAAHRTPRKLVEEGLNLMEPSKVIGIVFNGDAR
AFSGYYGYYHAYGRPPGRGRRPPQPATRETAPREAAPEPPLK
>gnl|bykdb|A0A2V8W2M7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=312 residues).
MSRIHEALKKAVEERVSHLSVGESLNLAAIAGSMQAPAVPARQVAEQPARVTPPPPSEAGAFLRFDDLVKRCAHPTWKPD
MRFSLFHRTDDDAKIGTERFRTLRSRLYQIAAAKQLRKVLVTSSVPNEGKTFVAANLAQSIVHQPDRRVLLIDADLRAPL
LHVTLGAPTSPGLTDYLRGEANEYDVIQHSSEVNLCFIPCGHPVSNPSELLSGDRMKKLLDLVTPVFDWVILDSPPSLAI
HDASILADLCDGVLFVVRAGETNHETAERAASEFRNKNLLGVVLNRVEQAAGYGDYYYGSLGEEEQPVLRAS
>gnl|bykdb|A0A2V8W380 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=344 residues).
MDSAEPPAKPVKPRTLLNLSVALFLGLALGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVAPANGNHLGIHRFLP
RDKSLVLAGNGSGKNSRSWHLIDRDGAQHAALGEAFRSLRTSVLLSTPDRPPSSLLVTSTQPADGKTTVACNLAISLAQL
GHRVLLVDADLRSPSLHKLFGIDRSLGLVSYLTGQQDWRAVVHPSGSRGLDLLLCGPVPPNPSELLSSQSMGALIRSASA
EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGTTPREQLLHAQSGIRSVGGNLIGVVLNSVDIRTNGYYNYGSYGSN
RGDPPQETFVPTNLHLPPQQKASD
>gnl|bykdb|A0A2V8W5N5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=327 residues).
MSRIHEALKKAHEERHSSQAADTVTLSVETPRTQVIAGIGLRAPAAETRARTETIPAPSRSAPELRFDSLVAHCTRREWQ
PEPGKNVFSNAAATACGAEQFRTLRSRLYQIRGNQPSYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQRVLMIDADLRYP
QLHLALGAPMAPGLTDYLRGEADEMAAIQYSDNENLCFMPGGKQVTNPSELLSNGRLKILLDRLTPIFDWIIVDSSPCLL
VADASMVAGVSNGVLLVVRAGSTSVDVAEKVCQQLKGKNIVGVVLNGAEKSDLVDSHYHAYGYGEPMETPVSGLRRRVSP
LHSWGPR
>gnl|bykdb|A0A2V8WG13 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MSRIHEALKKAAQERSSQVATGTVPDLADVATGLESPFGNKMQAGEPAVRSARVSEGSSFLDFDDLLRRCAHPNWHLDPR
LNIFLKTDEGRIGRERFRTLRSRLYQIAATRPLKRVLVTSSVPSEGKTTVAANLAHSIMCQPDRRVLLIDADLRCSGMHE
LLGAPGGPGLTDYLRGEAEKEAVIQNGLEGNLCFIPGGSEVSNPSELLLGDRMKKLLDLVTPIFDWIILDSPPALAVHDA
SSLADLCDGVLFVVKAGETNHQLAEKASAEFLKKNLLGVVLNSAEIDASYGDYYSGYATDDQKDSY
>gnl|bykdb|A0A2V8X713 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIHEALKKAEEEKSPTRSAPGAGPLDFAGDVAEPSPLGTLYPQMPGGAPTPEFCLGLEELRGRCAKPGWKMNPDYDVF
SAKQTSFPCAEQFRTLRARLYRLREKNPIRILLVTSTLPGEGKTFVALNLALAITRQHERGALLIDADLRASRLHVRMGA
PSAPGLSDYLNGRADEFSVLQADAKADLFLIPAGRFVPNPAELLANGLLKGLLDRVSPLFDWVILDAPPVLAVSDAGVLA
GLCDGVIVVVRAGATAHDLVQTTLQEFRGKNLLGVVLNRAEREANYGAYSYGYGVDTK
>gnl|bykdb|A0A2V8X987 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=308 residues).
MSRIHEALKKAAQERSTQIGAGLDRDVADVAAEIHRPVTVEPVVAVLAEQPRATIGGGHTGSMRYEEIVRRCSRPDWRLD
PRASAFQDSNSGHSGAERFRTLRSRLSQIAGTRTLRRLLITSSVAGEGKTFVASNLGQSIVRQPGRRVLLLDADIRMSRL
HVGLGAPSRPGLTEYLRGEADEYSIIQKGMEGNLFLIPGGSPVFNPSELLLHERMKRLLDLLTSAFDWIIIDSPPALLVH
DASILADLADGVLFVVQAGMTHVGEAEKAAEEFQNKNLLGVVLNKVEKRDSYGAYYHGHLSENAEKAT
>gnl|bykdb|A0A2V8XG53 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=327 residues).
MSRIHEALKKAHEERHSSQAADTVTLSVETPRTQVIAGIGLRAPAAETRARTETIPAPPRSAPELRFDSLVAHCTRREWQ
PEPGKNVFSNAAATACGAEQFRTLRSRLYQIRGNQPSYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQRVLMIDADLRYP
QLHLALGAPMAPGLTDYLRGEADEMAAIQYSDNENLCFMPGGKQVTNPSELLSNGRLKILLDRLTPIFDWIIVDSSPCLL
VADASMVAGVSNGVLLVVRAGSTSVDVAEKVCQQLKGKNIVGVVLNGAEKSDLVDSHYHAYGYGEPMETPVSGLRRRVSP
LHSWGPR
>gnl|bykdb|A0A2V8XHT0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
MSRIHEALKKAAEERSAQLAAGLETGVVEVTGELRRPITQGPGIAQPTAAPRVPTGDNQDVPFHYEELIKRCAQVEWRLD
PVSSVFLNSKPGEGGPERFRTLRSRLYKIASTRKLQKVLITSGVAAEGKTFVASNLAQSIVQQPELRVLLIDADLRSSRL
HVLFGAPSCPGLSDYLRGDADEYAVIQKGTKENLFLIPGGSLVSNPSELLLNERMKHLLNLVAPSFDWIIIDSPPTLPVH
DASILADLVDGVLFVIRAGSTDAAIAERTAAEFQGKNLLGVVLNQVERSDSYGDEYQNYYAERD
>gnl|bykdb|A0A2V8XNW2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=312 residues).
MSRIHEALKKAVEERVSHLSVGESLNLAAIAGSMQAPAVPARQVAEQPARVTPPPPSEAGAFLRFDDLVKRCAHPTWKPD
MRFSLFHRTDDDAKIGTERFRTLRSRLYQIAAAKQLRKVLVTSSVPNEGKTFVAANLAQSIVHQPDRRVLLIDADLRAPL
LHVTLGAPTSPGLTDYLRGEANEYDVIQHSSEVNLCFIPCGHPVSNPSELLSGDRMKKLLDLVTPVFDWVILDSPPSLAI
HDASILADLCDGVLFVVRAGETNHETAERAASEFRNKNLLGVVLNRVEQAAGYGDYYYGSLGEEEQPVLHAS
>gnl|bykdb|A0A2V8Y4D3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=302 residues).
MSRIHEALKRAEEQRPSAWKPAEPTPFGVAGGEGGSASAVSRALYSPKWGEIPAPGRRLRLEELRQRSSKPGWKLNPDYD
AFSPQHSSALCAEQFRTLRSRLYRLKEKSPLRTLVVTSTLPGEGKTFVALNLALAIARQHERRALLIDADLRASRIHVGL
GAPSAPGLSDYLSGKADEFSILQADPKVELFLVPAGKPVPNPSELLANGMLKSFIDGVSPVFEWVIVDTPPVLAVADAGI
IAEFCDGVMVVVRANKTPHDLVKTTLQEFRGNNLLGVVLNDASEGANYGGYSFRAGFGTDKK
>gnl|bykdb|A0A2V8YCY6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=244 residues).
MCPSHRCRKPSGPCAPLQVILVTSALPREGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGTGKYAGLSSYLA
GVSSLDLVSVPHPAIPNLVAIPTGPLPPNPADLLSSHKLADAIVELRAKFKFIVVDSPPIMAATDAVILSVHADGVLLVV
RSGETPKVAFMRTRDLLASVKSRVLGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQEAGEAAQGEASESVGGAISRHHDDD
SQAL
>gnl|bykdb|A0A2V8YMQ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=258 residues).
MAMGQAFAGCWIIQSFLGPGRMERRVTLARAGTALIKEDSVLLSTADHPPGSLLITSTQPGEGKTTVATNLAISLAQLGQ
RVLLVDADLRFPSLQRLFCIRENLGLVSYLTGQEDWRTAVCPSGSPGLDLLPCGPVPPNPAELLSSKSMGAFLGSAKSEY
AFVILDSSPLLTLADSRILASLVDGVLLVAKSGATPREQIRQSQSGIRSAGANLIGVVLNNVTLHTNGYYGLGIYGSNGN
SHSETISDPAEPWNRLSK
>gnl|bykdb|A0A2V8Z1Y8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=297 residues).
MSRIHEALKKAALERSAQLVTELESAEVLGEIRRSVPGPLETEVPRPQAPPRIAGSREPAPSCFGELVKRCAHPEWWPYR
GSSVFGDPAAGHAGAEKFSTLRSRLYQIAEARTLRRLLLTSTVAGEGKTFVAANLAQAIIREPERRVLLLDADLRVPQLH
AVLGAPSSPGLTDYLLGDADECAIIQQGLQPNLFLIAAGRAVSNHSDLLLSKKMKHLLNYLTPIFDWVIMDSPPTLPVHD
ASVLADLADGVLLVVQAGSTAVDDARKAAEEFRNKNLLGVVLNQVEKSDAYIAPDYH
>gnl|bykdb|A0A2V8Z2X8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHEALKRAEEAGPSAWRPSEPTPLGIVGAGGVAGAHRILSSPIRAEMPMAGRCLGLEELRHRCIKPGWKLNPDYDVF
STKQSSALCAEQFRTLRSRLDRLRKKSAIRTLLVTSTLPGEGKTFVALNLALAIARQHEKRALLIDADLRASRLHVRLGA
PSAPGLSDYLSGHADEFSILQADPKVELFLVPAGRPAPNPSELLANGMLKGFIDKIGPIFDWVIVDAPPVLAVADARIIA
EFCDGIMVVVRAGQAGRDLVKTTLQEFRGNNLLGVVLNGSDQDASCASYSYYAGFELDRK
>gnl|bykdb|A0A2V8ZIV5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=380 residues).
QYNILKREVDTNKQLYEGLLQTLKQTGVSASLKATNIRIVDSAVPPVKPATPKIPLNLTVASLLGLGLGISAAFLQERLD
DTLKGADDVERLFGLPALALIPSVHHLNGDRSSVRKLLDSASTLRSSQNGTASTPGAYWHRIDQRGKPQAALVEAFRSLR
ASVLLSTADHPPGSLLVTSTQPGEGKTTVATNLALSLAQLGQRVLLVDADLRFPSLQSLFGMREKLGLVSYLTGQQDWRE
AVRPSGSPGLDLLLCGPVPPNPAELLSSKSMGAFLVSAKSEYAFVILDSPPLLTLADSRILASLVDGVLLVVKSGATPRE
QVMQSQSSIRTAGANLIGVVLNIVRLHTNGYYGLGMYGMNGNSHGKTSSDEADSWRTLSK
>gnl|bykdb|A0A2V8ZJV2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=316 residues).
MSRIHEALKRAAEERAAQLAAGSEASSADVRSELELLRRGPECTGPAVSARGTTSGNENTLLCFEELGKRCVKLEWQIDP
HNSVFVNARPGQEGSERFRTLRSRLDKIASTRKLKRVLLTSAVAGEGKTFVAFNLAQSIAQQPDLRVLLVDADLRSPRLH
HLFGAPICPGLSDYLRGDVDEYAIVQKGMNESLFLIPGGSLVSSPSEVLRTERMKQLLNRVTPLFDWIILDSPPSLRADD
AGILADLADGVLLVIQAGSTAAQIAERTAAEFQGKNLLGVVLNQVEKRDCWNDYYGGRIVQLETTDRALPAGERLS
>gnl|bykdb|A0A2V8ZLE9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=302 residues).
MSRIHEALKRAEEQKPPAWKPSEPTPLGFGGNVNTAVAREALHSPTPTPKGIPTVGRGLRLEELRQRCIKPGWELNPDCD
VFSTKQSSSLCAEQFRTLRSHLYRLREKNPIRTLLVTSALPGEGKTFVALNLALAIARQHERKALLIDADLRASSLHARL
GAPAAPGLSDFLGAKVDEFSILQADPKFELFFVPAGRPVPNPSELLANGMLKAFIHGISPVFDWVIVDAPPVLAVADAGI
IADFCDGVIVVVRAGETAHNLVKTTLQEFRGSNLLGVVLNGGSEAANYGGYACSAGFGLAKR
>gnl|bykdb|A0A2V9A773 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=299 residues).
MSRIHEALKKAEEQRPPAWKPADPTPLGFGDDGIAVAAGAMQSPRREEMPTAGRCLRLEELRQRCIKPGWKLSPDYDVFS
TKQSSALCAEQFRTLRSRLYRLREKSPIRTLLVTSTLPGEGKTFVALNLALAIARQHERRALLIDADLRASRLHVRLGAP
SAPGLSDYLGGRADEFSILQADPKVELFLVPAGRPVGNPSELLANGKLKGFLNGINSVFDWVIVDAPPVLAVADAGIIAQ
FCDGVIVVVRAGETAHDLVKTTLQEFRGNNLLGVVLNGANEGADYGGHSYYAGFGMDTE
>gnl|bykdb|A0A2V9A795 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=618 residues).
MYQRVLERFQDRLTIEPVSRSRLVTVQFDSNNADLSARVVNTLAEDYIDQSLEARWAATQKAADWLSQQLVGVKSKLEKS
EEQLQDYARHNGLVFLETDKGASQNVANERLQQLQEELTKAEAERYEKEALYRLVQSGDYGSLPGVVENKLIQDLSERLA
ELKRELAQLSTKFNAGYPRVKEIQSQIDETEAALKEERQRAADKITNEYFAALRREGLVKEALEGQQKQVNVIAEKAVQY
NILKREVETNKQLYEGLLQRLKEAGVSASLKASNIRIVDSAEPPAKPAKPRIPLNLAVAALLGLGLGISTAFLQERLDDT
LKGADDVERVFGLSALALIPSVHHLNGDRPSVSSLLGRTNLLRSGQNGTASNPAARWHRIDQGQRPQPALIEAFRSLRAS
VLLSTADHPPGSLLITSTQPGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQRLFCIREGLGIVSYLTGQQDWRAAV
RPSGSPGLDLLPCGPVPPNPAELLSSKSMGAFITSAKSEYGFVILDSSPLLTLADSRIVASLVDGVLMVVKSGATPRDQV
MQSQAGIRSAGANLIGVVLNSVTLHTKGYYGLGIYGSNGNSHSEIISDTADSWGTLSK
>gnl|bykdb|A0A2V9AGR3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MSRIHEALRKAEQERASSAAVGRKDELPAINTDALSSSPVAPRNGKLFAPTTGIRDVMAPPSFEVLASRCVHLNWRLDPQ
VSLVDGGESETGGAERFRTLRSRLFQIAATRPLRRVLITSSLPAEGKSFIAANLAQSLACRQDSRVLLIDGDLRAPRLHL
ALCAPKSPGLTNCVRGETDEFSVIQIGAQSNLAFLPSGDAVADPAELILGGRVKKLLDFVTPAFDWVILDSPPALAVHDP
SLFADLCDGVLFVVKAGETSYENAVKGSSEFREKNLLGVVLNQIQEADMYAGDYYYGKTYGRTRK
>gnl|bykdb|A0A2V9AND3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=297 residues).
MSRIHEALKRAEEQRPPSWKPAEPTPLRFGGERLAPGVLQPSLQQEMPTARRCLGLEELRRRCLKPGWKLNADYDVFSTK
QSSALCAEEFRTLRSRLYRLREKSPIRTLLVTSTLPGEGKTFVALNLALAIARQPERRALVIDADLRASRLHVRLGAPSA
PGLSDYLNGRADEYSIIQADPKVELFLVPAGRPVHNPSELLGNGLLRDFLHGMSPIFDWVIVDAPPVLALADAGIVAEFC
DGVIVVVRAGQTSHDLVKTTLQEFRGINLLGVVLNGANLEANYSSYSGYAGVGMDKK
>gnl|bykdb|A0A2V9AWB5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRIHEALKKAAEERAARLTFDVDPREGDGEVRSEPESPLTQGIDLLPPVPSTRTEAVDSSTIASFSFEELNKRCARKEW
RLDPLNSVFLNSKPGEEGPERFRTLRLRLYKIATTRKLKRVLITSGVASEGKTFVASNLAQSIAQQPELRVLLIDADLRS
SQLHVVFGTQGRPGLSDYLRGDADEYAVIQKGMSKNLFLIPGGNLVSNPSELLLSERMKHLLNVVSPAFDWIILDAPPTL
PVHDASILADLVDGVLFVIRAGSTHAEIVERTASEFQDKNLLGAVLNQVEKSDSYGAEYQNYHSDRD
>gnl|bykdb|A0A2V9BCK9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=628 residues).
MKATKMYEKFFGLRESPFNVNPDPRYLFLTPSTQEALASLAYGIRGRKGIILLTGEVGTGKTTLLNRLLDWLRHEQAVTA
FIFNTRLSVTEFFDCLTADFGISCQSPSKSHVLLGLNRWLLDRYRAGETAVLIVDEAQNLSQQLLEEIRLLSNLETSTEK
LLQIVLSGQPELEEKLKHAQLRQFRQRITVRARTGPLSLQETHGYIAERLRIAGANGEPIFAPGAVESVYNYARGIPRVI
NVLCEHALINSFADQQRPVPTHLVDEVAREFELGSLEPTTQPTSTACPENTLAAESPLEDFIGSIGAVPSARLDHCGTQG
RERMSRIHEALKRAEQERAPIQSANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESPNSHHLRLDELRRRCATPGW
KLNPDYAVFCKQSLAVCAEQFRTLRSRLYRLRDKQPVRTLLVTSAVPGEGKTFVSLNLALAIARQHERRALLIDGDLRAS
RLHVRMGAPSAPGLTEYLRGEADEFSIIQADSKDDLFFIPAGRSVLNPAELLADNRMKVLIDRMAPVFDWVIVDAPPVHP
VGDAGVLAGLCDGVIVVVRAKLTAYDLVQTTLQEFRGKNLLGVVLNGADEEATYGAYSYYAGYGMDRK
>gnl|bykdb|A0A2V9BLX2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=293 residues).
MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGASGDLGESRLGQCRKMKIPAVGKLLGQFGSGPALEA
AEESYRALRTRLLRARSAQGLRSVVVTSATPGEGKTLTSLNLSLCCAQLHDLRVLLIDADIRTSGLSRTLGFPPGPGLVD
VLSGKCEPRNAILATDIPNLYALGSGSHTTQPAELFASSHWQEFISWCSESFKLVLIDSPPVLNLTDVDLIAAACDGVVM
VVRAQHAKREVLQKCAGQIDPKKLLGVVYNAVESGAHDHYSYGGYTAARKEST
>gnl|bykdb|A0A2V9BTJ7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MSRIHEALKKAAQERSAQLAAGTAPSFLEVADVPRTAVPLRELDEPTSPERSPAKGGSFLRYEDLIKGCARPIWKTDARM
SVFEGGDDGHVGAERFRTLRSRLYQIGGTRQLRRVVVTSSLPAEGKTFVAANLAQSIVRQPDRKVLLIDADLRASRLHQL
LGAPRSPGLSDYLLGMADEFRVVQKGSESNLCFIPAGSEAPNPSELLLNDRMKRLLDLMTPIFDWIIIDTPPALPVHDAS
MMADLCDGVLFVVRAGATDHEMATKAAAGFQDKNLLGVVLNRVDGDAGYGGYYYSYPSGEEVKKSS
>gnl|bykdb|A0A2V9BW09 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=260 residues).
SLALRGNEQLGPQLPASPGKHPVGFEDVKRVRWPMDSEKRIVAWADPHAIGAEKFRVLRYRLQHLRMARALSKVLVTSAI
PREGKTVVATNLAFTLARSSSHVLLVDADLRLSAVHQMLGIPPMAGLGEVLQGRLDVRAAIRRLDPSGLYYLPAGHPPPN
PAELLQSPRIQELLTQISSAFDWIVLDAPPVNLFADARHLANLADAVVLVLRVGVTPRESTQQVSAALDGAFIAGVVVNG
DVNPLQDRYYYSYYPRHKNA
>gnl|bykdb|A0A2V9C3F6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHEALKKAEEQKPPAWRPTDPTPLNYVGESEVAAASGVLHSPRRGEMPATGRCLRLEELRQRCIKPGWRLNPDYDVF
STQQSSALCAEQFRTLRSRLYRLREKSPIRTLLVTSTLPGEGKTFVALNLALAIARQHERRALLIDADLRASRLHVRLGA
PSAPGLSDYLSGRADEFSILQADPKVELFLVPAGRSAPNPSELLANGTLKRFLDGMSPIFDWVIIDAPPVLAVADPSIIA
EFCDGVLVVVQAGETAHDLVKTTLQEFRGNNLLGVVLNGANEGTNYGGYSYYAGFGMDKK
>gnl|bykdb|A0A2V9CBY1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=346 residues).
MSRVYEALKNAQEQRTIRGPLEAEVTAQESSVGGPVHNGKTASRIREILSALTAEGAPPQEQRTIRGPLEAEATPQESSV
GGPVHNGKTASRIPEILSAVTAEVAPPARSLQLEELQQRCAKPGWKPQLRWNVFSNERSCKRQAEQFHTLRARLYSLRDT
RPIQTLLITSTIAAEGKTFVAMNLAQSIARQRGRRALLVDADLRASRLHIALGAPSAPGLSDYLAGESDESAVIQAGAQE
GLFFIPGGKPRSNPAELLANNKLRALFSRVLALFDWIIVDAPPALPVSDASVLSGMCDGVIFVVRAGMTAFDMAQAACGE
LRNKNLLGVVLNGVEEEAIYGAYGYY
>gnl|bykdb|A0A2V9D4I4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=318 residues).
MSRIHEAMQKAAQERAAAPATEIAPFPFDAEPAPERELKTVASASANGAVTETQISTSAAPSPEPLRFEDLQRQCTRSEW
RPDPRCTVFSNPALSTLCAEQFRTLRSRLYQLRASQRLGTILITSAVPGEGKTFVAANLAQAIVRQAERRVLIIDADLRS
SHLHRMLGAPAAPGLSDYLRGDANELAVTQSGQEGNLWFIPGGTNIANPSELLSNGRLKSLLDHMAPFFDWIILDSPPCL
PVMDANVVADLCDGLLFVVKAGSTPAEIAQRARQELGGRNLLGVVLNAVSEKALAYGSYYNHGYGNGRVKEPMKEKSD
>gnl|bykdb|A0A2V9D5W7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=318 residues).
MTRIHEALTKAGQEYPAAQAIDSLFQLDSTRPIESESKDAPPSGIGSPRRVNILAPAATDPLELDDLRKRCSYPEWSFDP
AVDVFSDQGRSALGAEQFRTLRSRLCQLRGNRPVRTILITSAVAGEGKTFVAFNLAQAIVRQPDQRVLIIDADLRCSRLH
GIFGAPNALGLSDYLGGRADELAIIQSGHEGNLYLIPGGTRIANPSELLANGRFKRLIERVAPLFDWIIVDSTPCLPVTD
ANIAANSCDGLLLVVKAYSTPAEIAQRARQELQDRNVLGVVFNSVQESIVSYGSYYNYPQNGHDEVKKTQAHRNKFRQ
>gnl|bykdb|A0A2V9D656 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=307 residues).
MSRVYEALKNAQDQQTIRGPLEAEATPQESGVGEPVHNGKAASRIPEILSAVRPEGAPPARLLQLEELQQRCAKPVWKPQ
LRWNVFPKERPCGRQAEQFHSLRARLYSLRDTRPIQTLLITSTTAAEGKTFVAMNLAQSIARQPGRRALLVDADLRASRL
HIALGAPCAPGLSDYLAGESDECSIIQADSQEGLFFIPGGKPRSNPAELLANNLLRALFSRVLPLFDWIIVDAPPALPVA
DASVLAGMCDGVIFVVRAGVAAFDMAQAACGELKHKNLLGVVLNGVEEEAIYGAYGYYYGGNGTGGE
>gnl|bykdb|A0A2V9D6L7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEAIQKAAQERSAAPATDFAPLPFDVELAPERKSVAPASVIGCVTPVSTSASTSAEPLEFDDLQRRCTRPRWRPEP
NSTIFSNPALSTIGAEQFRTLRSRLYQLRSSQPLRTILVTSAVAGEGKTFVVANLAEAIGRQRDRRVLIIDADLRASRLH
LMVGASAAPGLSDYLRGDIDEVAAIQSGQDSSLYLIPGGTKIANPSELLSNGRLKKLLDRVAPLFDWIIIDSPPCLPVAD
ANVVSNFCDALLFVVKAGSTPAEIAQRARHELEGRNVLGVVLNSVSEKGLAYGSYYNYRDHAHDPLKESTNRILD
>gnl|bykdb|A0A2V9DKV4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=263 residues).
MRTVGSRPYFQGRRNQTILGLNDLWQRCRKPGWTLDPTYSAFSNSKSFTSCAEQFSKLRTRLYEFRDNEPLHTLLVTSSL
PAEGKSFVSLNLALAMMRQHNRYVLLVDGDLRAPKLATCLGVPGAPGLTEFLQGAADASSIIQTDTEGKLFFISAGSAVS
NPTELLSTERLECFLRQMAALFDWVIIDAPPVLPVSDAIVLAGRCDGVIVVVRAGSTGYDVVSTALQELRGKKILGVVLN
RAEEKEATYGAYPYYGGNGMDKK
>gnl|bykdb|A0A2V9EVA0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=306 residues).
MSRIFEALQKIQSQQTPVVPGAETIPPEPVAFWTEQREEELRPTSSFAPSEPSPRPSLTSFAPGLNALRQRCAKPAWKLH
KDSLVLFNEQSFDRCAEQFRILRARLYRLREKKPFRTLLVTSAQAGEGKSFVSLNLARAIVHQHERHALLIDADLRAPKL
HVSLGTPSSPGLSDYLRGDADEFSIIQSGTGENLFFIPAGRPVSNPTELLGSTRAKSLFERLNTLFDWVIVDTSPVLPVS
DATVLAPMCDGVILVVGAGRTSSDLARTACQELRESRLLGVVLNGVEDDAVGSPYAYYGRSEHVRS
>gnl|bykdb|A0A2V9EY04 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=283 residues).
MSKFFNETQKANQWAQSKLPEPDRDVREMLESIKQGSILETATANAQLPQCQQVQVGNGNATHLVLRQDQSSKVALEAYR
ALRTRLMRAQSRAGVKTIAITSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDADLRTCGLTALLDHPCTLGLAEVLAGKA
TLEEAMVATNQKNFFVLPAGTISSPPPELFTGSHWQELLGRCSELFEVVLVDTPPIIPLADFELISVACQGVVMVVRARH
GQRETLQKSASSVDRKKLLGLVFNGTDANEKHYYGYKYAEAKA
>gnl|bykdb|A0A2V9G0N7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHDALKKATEEKASQSPASPAQTFVDVREGISRFAQARNEVGTAPKNGSGNAVKQPCVRFEQLLKRCAHPKWTLDPA
RSVFGGPDSKKLGAEPFRTLRSRLSQIAGTHVLKRIVITSSVPAEGKTFVAANLAQSIIRQPDRRVLLIDADLRASRLHV
ALGAPSTPGLTDYLRGEVDEYAIIQSGPDENLCFIPGGNDVSNPSELLPSDRMRHLLDVVTPMFDFVILDSPPATPVHDP
IVLADLCDGVLFVVRAGVTDFEVAERAVAEFREKNLLGVVLNGAEQGAAYGEYYNHYTGR
>gnl|bykdb|A0A2V9G1P7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=700 residues).
PTIKELYELDAVSDAYLRTQYSILASESLARRAIDQLHLETLREFNSRKWWQLWPETRKPSTTQTFAVGPVPQVRDRELS
ERVLERFLDRLTIDPVNRSRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLSQQLVGVKAKLEKSED
ALQGYARHNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQTGESGALPGVFENKLIQDLSERLAEL
KREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRAADRMVNDYSAAVRRENLVQQALDDQQKQVNLIAEKSVQYNI
LKREVDTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVKPKILLNLAVAMFLGLGLGIGTALFQERMDNTLK
GDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSHSYWHRIDRDETQHASLVEAFRNLRTSVL
LSTPDRPPSSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLLDADLRYPSLHKLFGTSGSLGLVSYLTGQQDWRAVVRP
SGSRGLDLLVCGPVPPNPSEMLSSQSMSALIRSASAEYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQFMH
AQSGIRGVGGNLIGVVLNNVDICTNGYYNYGPYGLNPDCPSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9G7Y0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=277 residues).
MSKFFNETQKAHQWAQQKLVNQDLDVRQILASLKQGPANDAPPAGARLAHCRHVALGNGNAARLLLRQDDFLIAALEAYR
GLRTRLMHAQAKSGLRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDGDMRTRGLTAMLDHPNSPGLAEILSGDV
GPDEAIVATNQKNLFILPAGTISSPSPELFTGTRWQEFLGQCGEMFKVILIDAPPIRPLADFELISAACDGIVMVVRAHH
GQRETLRKTASTVDKKKLVGVVFNATDVSVKDYDGYE
>gnl|bykdb|A0A2V9GAQ1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=751 residues).
MTEENKLVPRENGSLGGSDLLPVPIRLPVWELSPREPHLYDYLLILRKHQWLILSFLHRENANILPFQGTDSYDIMMDQD
NYIETQSKILTSETLALQTIRNNGLSARPEFSSPNGPSEAVALGSLANQKRPPELGQFLGSLTVKRVPNSHLMDVSFEST
DPQLAARIVNAHISSYIEQNFRSKYEATTRASTWLTDQLTELKIRVQKAEDARIAYERRNQIWTLDDKQNITSQRLGDIN
RQLTDAQSERMKKESLYQFAKSGNLDAIPQVQSNLALTELLKKRGEVSSDYTDALNQYGPNFPKVQRLQAQLKDYDLSIE
KEKKYILDVLESDYREAQQRESLLMQALDQQKTETNQMAEKLVEYNILKREAEANKTLYDGLMTKLKETAISQGLRSSNI
RVVDPEMIPSTPARPAKARNMVLAFLVGLVGGIGLALMREYLDNTVKTPDDVETHSRLPSLAVVPQFTGSNGSGKHHGPL
LGFSSNGHEKRMELVAHHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVIVD
ADLRKSGIGRLLNLASGNYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLPPNPADLLSSHRLVEAVAELRTKYKFI
IIDSPPIMAATDAVILSVQTDGVLLVVRSGETPKKAFTRTRDLLSSVKCRILGVVLNAVDSSAPDYYYSYRYYPYSYGYG
PQEAAEAPHEEDSEAIAHRVSRDRDDDSQAL
>gnl|bykdb|A0A2V9GQ44 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=300 residues).
MSRIHDALKKAAEEKASQSPASPAQTFVDVREGISRFAQARNEVGTAPKNGSGNAVKQPCVRFEQLLKRCAHPKWTLDPA
RSVFGGPDSKKFGAEPFRTLRSRLSQIAGTHVLKRIVITSSVPAEGKTFVAANLAQSIIRQPDRRVLLIDADLRASRLHV
ALGAPSTPGLTDYLRGEVDEYAIIQSGPDENLCFIPGGNDVSNPSELLPSDRMRHLLDVVTPMFDFVILDSPPATPVHDP
IVLADLCDGVLFVVRAGVTDFEVAERAVAEFREKNLLGVVLNGAEQGAAYGEYYNHYTGR
>gnl|bykdb|A0A2V9GQV7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=228 residues).
NGNAARLVLREDGSLNAALEAYRGLRTRLMRAQSKSGLHSIVITSSLPGEGKTLTTMNLGLCYAQLPQQRVLVIDGDMRA
HGLTSMLDHPNSPGLAEILSGDVAPDEAIVATNQKNLFILPAGMVSSPPPELFAGTRWQEFLGHCGEMFKVILIDAPPIL
PRVDFELISAACDGIVMVVRAHHGQRERLQNTASTLDRKKLLGVVFNATDVSAKDYHGYEYGYGYGKD
>gnl|bykdb|A0A2V9H7U2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=447 residues).
LKTQNVDALEQYGPKHPKVERLRSQVNEIQSLIDTERKRMVERLRNDYVAARGREKLLAAAVAKEKVGVGALSQLLIQHN
LLKREFDTNQQLYDSLLQRLKDATVSAGLRATNIHLVDPARPPKVPVRPQKLYNIAVSIAVGLILGVMLAFVKEALDSSI
KSIEEAERVVNAPALAVVPLEREIPHRAARSLTRNNGTSKPGDAELALLKQPSSALAESFRTLLTSVVLSTAPRPPQVLL
ITSATAREGKSTTALNLAIALAQRGDSTLIIDADLRRPGIAESLDIDDGEGLASFLTGAHSIEAALRQFSPVPTLWVLPA
GPKPPNPAQLLSSSAMESLLKELRQRFKFIVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVVRARRVLENAGAR
ILGLVLNKVDVRHNGYYGYYGHYYYSSGSGKTKRTPASESVSSHLQG
>gnl|bykdb|A0A2V9HAK9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=250 residues).
ESLKQGPPINAPPAEARLARSRQVTLGNGNATRLVLRQDDSLDAALEAYRGLRAKLMRAQSKSGLRSIVITSSLPGEGKT
LTTMNLGLCYAQLPQQRVLVIDGDMRTRGLTSMIDHPSSPGLAEILSGDVAPDEAIVATNQKNLFILPAGTVSSPSPELF
IGTRWQEFLGHCGEMFKVILIDAPPILHLADFELISAACDGIVMVVRAHHGQRETLQKTASTLDTKKLLGVVFNATDVSV
KDYDVHEYGY
>gnl|bykdb|A0A2V9HB55 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=662 residues).
KILTSETLALQTIRNNGLSARPEFSSPSGPSEAIAVGSLANQKRPPGLGEFLGSLSVKRVPNSRLMDVSFESTDPQLAAR
VVNAHIASYIEQNFSSKYEATTRASAWLADQLTELKIKVQRAEDARIAYERQNQIWTLDDKQNITSQRLSDINKQLTDAQ
SERMKKESLYQFAKSGNLDAVPQIQSNLALTELLKKRSEVSSDYTDALNQYGPNFPKVQRLQAQLKDYDQSIEKEKKNIL
AVLESDYREAQQRESLLTQALDEQKAETNHMAEKLVEYNILKREAEANKTLYEGLMTKLKETAISQGLRSSNIRVVDPAM
IPSTPARPAKTRNLALAFLVGLVGGIGLALLREYLDNTVKTPDDIETLARLPSLAVVPQFTGSNGHAKKRGLLQGPAANG
HEMRIELAAQHLPKSQMSEAFRALRTSILLSRADHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVIVDADLRKPG
IGRLLNLGGGKYAGLSSYLAGVSSLDLVCVPHPTIANLVAIPTGPLPPNPADLLSSHKLADGITELRTKFKFIVIDSPPI
MAATDAVILSVQADGVLLVVRSGETPKAAFTRTRDLLNSVKCRILGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQEVVEA
PHEEDSEAVTERVSRDDDSEAL
>gnl|bykdb|A0A2V9HRN3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIHDALKKAAEERASKSPASAAQTFVDVTEGISRFAQARNEVGTAPKNGTSTAVKQPCVRFEQLLKRCAHPKWTLDPA
RSVFGGTDSKKFGAEPFRTLRSRLSQIAGTRVLKRIVITSSVPAEGKTFVAANLAQSIIRQPDRRVLLIDADLRASRLHV
ALGAPSTPGLTDYLRGEVDEYAIIQSGPDENLCFIPGGKDVSNPSELLPSDRMRHLLDVVTPMFDFVILDSPPASPVHDP
IVLADLCDGVLFVVRAGVTDFEVAERAVAEFREKNLLGVVLNGAEQGAAYGEYYNHYT
>gnl|bykdb|A0A2V9I4J1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=437 residues).
MEASAVQPLLAESRRQGVPIGEAALRSKLLEPAELADVIRRQAFQLLRHALEKQFSVQSFQVSATGFSVPAQIHFENLLL
EVARGDSKPFQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELRRSRTLQDLATATGLEYVRLTKILDVFRKLQVVDIVDE
ETGQDDTKGSAAVGGQSRFPFEHLIPEISNAVLSEKLEVLKNEFSFVSEQFKALKVRINETQADHAVQTIAISSPRPQDG
KSLIAVNLAFCLAQDLDRRVILVDGDLRNPTVNRYLGVSVEPGLSGYLENGHLQPYCYMRRFKNLYIMTAGGVCTNPVEL
LSQDKMRELIQYLKTEFDTIIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTPFSAIEKAFKVLDRKKLLGIVFNDVKPM
LLHTHYDHGYYRYGKQGAYPYYGTRKPRSRSKTYLEN
>gnl|bykdb|A0A2V9J901 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=237 residues).
MAPAIQTHAEVLEAFRSLRTSILLSASPVPRVILITSALPGEGKTTTAVNLGAALASFGSKVVVIDCDMRRPSCHRSVGV
KNSPGFVQCLTGHVELAEAVLPAPGVPNLSVIPCGPIPPNPAEVLSSSLAAESLRKLRADFDYVLVDSPPLLSVADGRIL
ATMVDGAVLVARAFETPYDLVCRARSLLYGAGARILGVALNDVDLRREGYGHNGSYGYSYTGYGAPGSEASSRHGNT
>gnl|bykdb|A0A2V9JMM3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
MQLTEVAKGASILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVERPPASDLLKMGGTPGPPGIQEQL
RVIRETLFARPLLQEVLKEFTLYGPATDPDWATEDMKKRIRIQVEGTDAFYIGFEDGDRQAVAEVANRLAELFVKSTSAS
QEQNVEEAAGLLDQELARLRDKLADEDEEIKEYKQKVGEELPEHLGTNLKLVEALEMRLQAKRDSIGENQARRAQVLEEM
KGLQKEPAQEIQRELPVEEPTAEQKALDEKRLKLKELEAKYTEQYPEIPRLRKEIADLEQAVAAGPRRKSRSDATAATSR
RYPGPDASMRYLALKGELEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHERALAEMTREQALTRSQYQGLLEKQNEM
KMAERLRQKGQSLVFKVVEPASVPSAPSSPKRERILLLGFVGSLGLGVVLAFLVEQLDTSFDSADDFKTFTNLPLLAVIP
SVRSKSRSGRKLPEGGKGDPHLPQPNLRHLQKNRVVTVTDPGAIASEQYSILAMKLRWHLGEAPSRVLTVTSASGGEGKT
LTAVNLSFALAESGLGKVLLLDADLRKPRTHEYLGIEPRPALSNLLQDPERDIYREAVRLKDLFVIPGGSDFENPVGVLG
SERMRRLVERLRLEFRFIVLDAPPILPIADPQVLAGYADGVLLVVRARRTRRELFKHAIESFRATNVLGVVLNGADYAGS
RYARAYEYYRRTYYKQNIRTGT
>gnl|bykdb|A0A2V9JMZ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=498 residues).
MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVFCRQGLIEAVSSNLEQYHLGQHLVTEGFMEASAVQPLLAESRRQGVP
IGEAALRSKLLEPAELADVIRRQAFQLLRHALEKQFSVQSFQVSATGFSVPAQIHFENLLLEVARGDSKPFQVYPWQLVV
MNNGKDLTHLPWYPQELSVLSELRRSRTLQDLATATGLEYVRLTKILDVFRKLQVVDIVDEETGQDDTKGSAAVGGQSRF
PFEHLIPEISNAVLSEKLEVLKNEFSFVSEQFKALKVRINETQADHAVQTIAISSPRPQDGKSLIAVNLAFCLAQDLDRR
VILVDGDLRNPTVNRYLGVSVEPGLSGYLENGHLQPYCYMRRFKNLYIMTAGGVCTNPVELLSQDKMRELIQYLKTEFDT
IIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTPFSAIEKAFKVLDRKKLLGIVFNDVKPMLLHTHYDHGYYRYGKQGAY
PYYGTRKPRSRSKNYLES
>gnl|bykdb|A0A2V9K0H7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=293 residues).
MSRLHEALKKAEQQKTENGSPLDLERPTVIPGDGKGVAVLPPAELPSGAAELRVLLMERCSQSLWNPDRKMMLFFDRRNP
VVGVEEFRTLRSHLSLIREQLPLQSLLVTSPLPSEGKTVVAANLAQVLVQQREQRVLLVDSDLRYSRMHLSLGASRSPGL
SDYLSGAKDELAILQRGPLENLFFIAGGKAASNPTELIGNGRLRLLLRRLCPAFDWIIMDSPPVIPVSDAKLLAEYLDGV
LIVVQSDATPHDLARKACQEFASKKIVGVVLNRVKPEYSYGSQYYATTPETKK
>gnl|bykdb|A0A2V9L2P7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=372 residues).
MNQLLIEHNLLKRDFDSNQALYESLLQHLKDANVSAGLRATNIHFIDSAAVPTVPVRPQKGRNIAFAMAVGLALGMGLAF
VREALANSIKGAQEVENLIAAPALAIVPDVSSSVTRSGLFAKRSEVKAKKAEMVELSVLKNPGASISEAFRTLRTSILLS
TAERPPQLLLVTSAQPHEGKTATSLNLAFTLAQMGSRALVVDADLRKRRIARALQMSNEKGLSGILTGGYGLQEALLRVE
DIEGLWVLSSGPNPPNPAELLCSTKMQELLKQMRERFDHVIVDSPPVLPITDATILSSRVDGVIMVVENEVTTRATLSRA
CSVIRHSGGKILGAVVNKVDARRDGYYGHYHYYGYYSKGYYDYAEGKGNGQG
>gnl|bykdb|A0A2V9LS17 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=316 residues).
MSRIHEALKRAEQEMEGRSIPSVGTQIAELAEAGTAVPEKLPQSATGIEPAALSELEEPGSDLTLEVLESQVRRFKWNPN
VKTMLFFGEENYALGTEEFRTLRSHLFGLNETSATRSLLVTSASPREGKSFISSNTAQILARQPDKRVLLIDADLRWSRL
HLFLGTPAVPGLAEYLSGEANELSVIQRGPLENLYFIPGGKHPANPAELVSNGRFKNLLRRLSPVFDWIVVDTPPAIAVS
DAQVLAAACDGVLLVVAAGSTSCEASQKTRDQFKGRRVLGVVLNRVDPRGSSSYKYYDYYRGAAENANGKGRRAKT
>gnl|bykdb|A0A2V9M815 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
MQLTEVAKGASILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVERPPASDLLRMGGTPGPPSIQEQL
RVIRETLFARPLLQEVLKEFKLYGPATDPDWATEDMKKRIRIQVEGTDAFYIGFEDGDRQAVAEVANRLAELFVKSTSAS
QEQNVEEAAGLLDQELARLRDKLADEDEEIKEYKQKVGEELPEHLGTNLKLVEALEMRLQAKRDSIGENQARRAQVLEEM
KGLQKEPAQEIQRELPVEEPTAEQKALDEKRLKLKELEAKYTEQYPEIPRLRKEIADLEQAVAAGPRRKSRSDATAATSR
RYPGPDASMRYLALKGELEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHERALAEMTREQALTRSQYQGLLEKQNEM
KMAERLRQKGQSLVFKVVEPASVPSAPSSPKRERILLLGFVGSLGLGVVLAFLVEQLDTSFDSADDFKTFTNLPLLAVIP
SVRSKSRSGRKLPEGGKGDPHLPQPNLRHLQKNRVVTVTDPGAIASEQYSILAMKLRWHLGEAPSRVLTVTSASGGEGKT
LTAVNLSFALAESGLGKVLLLDADLRKPRTHEYLGIEPRPALSNLLQDPERDIYREAARLKDLFVIPGGSDFENPVGVLG
SERMRRLVERLRLEFRFIVLDAPPILPIADPQVLAGYADGVLLVVRARRTRRELFKHAIESFRATNVLGVVLNGADYAGS
RYARAYEYYRRTYYKQNIRTGT
>gnl|bykdb|A0A2V9MDJ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=498 residues).
MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVFCRQGLIEAVSSNLEQYHLGQHLVTEGFMEASAVQPLLAESRRQGVP
IGEAALRSKLLEPAELADVIRRQAFQLLRHALEKQFSVQSFQVSATGFSVPAQIHFENLLLEVARGDSKPFQVYPWQLVV
MKNGKDLTHLPWYPQELSVLSELRRSRTLQDLATATGLEYVRLTKILDVFRKLQVVDIVDEETGQDDTKGSAAVGGQSRF
PFEHLIPEISNAVLSEKLEVLKNEFSFVSEQFKALKVRINETQADHAVQTIAISSPRPQDGKSLIAVNLAFCLAQDLDRR
VILVDGDLRNPTVNRYLGVSVEPGLSGYLENGHLQPYCYMRRFKNLYIMTAGGVCTNPVELLSQDKMRDLIQYLKTEFDT
IIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTPFSAIEKAFKVLDRKKLLGIVFNDVKPMLLHTHYDHGYYRYGKQGAY
PYYGTRKPRSRSKNYLES
>gnl|bykdb|A0A2V9N406 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=310 residues).
MSRIHEALKKAEEQRAASQGGNIEPASISEMVNESAATAVAPAVEHTPSAVSAVPSFSSPFTFDTLLASCAQARWSPDSK
TMLFFNSDDEQGYGMEEFRTLRSRLYQMREKQSLKKVLVTSSLPKEGKSFVAANLAQVMVRQQGRRALLIDGDLRGPRLH
QVLGTASSPGLSEYLLGEVDEFGAIQRGPMDNLFFIPSGRTVSSPAELVANGRLKFLLNRIEPLFDWIIIDSPPAVPVSD
AGLLANYCDGVLIVVRSNATPFDIARKARQEFRDTSLVGVVLNGIDVGSSYTQYYYSSYGHPNSQGDGRR
>gnl|bykdb|A0A2V9NLA9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEALKKAEEQRSAEHEMHIEPPLASAPEVVPDPISMPVAAVPPLADERDRRTVSAAMPSFGTGLSVESLLSRCVAG
HWTPDRKTMLFFNGDEQGYGTEEFRTLRSRLYQLRDRLPLKKVLVTSALPKEGKSFVAANLAQVLVQQQGRRTLLIDGDL
RGARLHNALGTESSPGLTEYLLGEADEFAILQRGPMDNLFFIPCGRKVTSPAELVANGRLKTLLNRLEPLFDWMVLDSPP
AVPVSDAGLLANYCDGVLMVVRSNSTPFDMARKARQEFSGKQLVGVVLNGIDQGNSYSQYYYDAYGKPNGKNEQR
>gnl|bykdb|A0A2V9NPF4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMSQSPGAIETAPAVLEAPLETTPFLRSEPTEARFASGGIAESLLARSRQTAWNPDLKSMLFFSG
EEHGSGMEEFRTLRTRLYQIREKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGKRALLIDADLRCPQLHVLVGAEP
GPGLSEYLASESDEFSILQRGPMENLFLIAAGHRSQNPAELLANGRMKFLLERLQPIFDWIIIDSPPAALVSDAGLLARY
ADGVLLVVRSNTTPADAARKARQEFADHNLVGVVLNGITPELSPYSQYYYSVYSEDGKAKG
>gnl|bykdb|A0A2V9PNZ0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMSQSPGAIETAPAVLEAPLETTPFLRSEPTEARFASGGIAESLAARSRQTAWNPDLKCMLFFSG
EEHGSGMEEFRTLRTRLYQIREKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGKRALLIDADLRCPQLHVLVGAEP
GPGLSEYLASESDEFSILQRGPMENLFLIAAGHRSQNPAELLANGRMKFLLERLQPIFDWIIIDSPPAALVSDAGLLAKY
ADGVLLVVRSNTTPADAARKARQEFADHNIVGVVLNGITPELSPYSQYYYSVYSEDGKAKG
>gnl|bykdb|A0A2V9PTS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMSQSPGAIETSPAVLEAPPETTPFLRSEPTEARFASGGIAESLLARSRQTAWNPDLKCMLFFSG
EEHGSGMEEFRTLRTRLYQIREKQPLLSKLLVTSPLPKEGKSFTAANLAQVIVRQHGKRALLIDADLRCPQLHVLVGAEP
GPGLSEYLASESDEFSILQRGPMENLFLIAAGHRSQNPAELLANGRMKFLLERLQPIFDWIIIDSPPAALVSDAGLLAKY
ADGVLLVVRSNTTPADAARKARQEFADHNIVGVVLNGITPELSPYSQYYYSVYSEDGKAKG
>gnl|bykdb|A0A2V9Q1Y8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=409 residues).
MIRKSRARPRKSAAVCVVIIWQPXXXEQKQQENKLNESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVTAGLRSNNIRQV
DIARTPAGPAEPNIPRNLGFALALGLTSGIGLAFLLEGIDNTVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAA
SKEAVELITISRPQSQMSESYRALRTSLLLTSLGAPPKTILITSALPQEGKTTTSINTATVLAQKGTRVLLIDADLRRPS
IHKTLGMGPRAGLSNVLTGGTTLQQATVRSTLLPNLFILPAGTPPPNPAELLASSQMLDLLAELREQYDHIIVDTPPTLS
VTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDILAQVNARVAGVLLNAVDLDSPDYYYYYEYQGKYGQRYYDEDMTGGD
SVRAASGSA
>gnl|bykdb|A0A2V9QMU9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=329 residues).
MARVPIEPAEPDVPRNLSFALVLGLTTGVSLAFLLEGIDNTVRTPEQAQAISGLPSLGIIPDGSKLSIESSARRRLSLTS
SREAIELVTQSRPQSQMAEAYRALRTALLLSSVGAAPKVVVVTSALPSEGKTTTSINTAIVLAQKGNRVLLVDADLRRPS
IHKTLGMGPRTGLSSVLTGSANVQQTIVRSALLPSLFILPAGPPPPNPAELLSSGNMKKVLDELREQYDHIVVDTPPTLS
VTDPVILSTRADAVVLVIRSGQTTRQALRRARDILLQVNAHATGVLLNAVDLNSGDYYYYEYQGKHGQRYFGQDEPAIAE
EAKATSSGA
>gnl|bykdb|A0A2V9QY75 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=350 residues).
QKLKEAGVTAGLRSNNIREVDIARTPGAPAEPNIARNLVFAFALGLSSGIGLAFLLEGLDNTVRTPEQAQAISGLPSLGM
IPLGSKIGAEAGAKQGLVVASSKEPVELITQARPQSQMAESYRALRTSLLLTSLGAPPKIILITSALPREGKTTTSVNTA
IVLAQKGTRVLLIDADLRRPSIHKALGMGPRVGLSNVLTGGATSQQATVRSPILPNLFILPAGTPPPNPAELMASQQMFD
LLAELREQYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSSQTTKPALRRTRDILTQVNARVAGVLLNAVNLNSPDYSY
YYEYQGKHGQRYYDESQTDENSIAAASGGA
>gnl|bykdb|A0A2V9R269 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=301 residues).
MSRIHEALKKAEQERAMLHPSQRVEMPAVLETPEMPAGAVAGAVGRGIPGMATGMEALMTRSRETRWSPDPKKMLFFGTE
EHASGMEEFRTLRSRLYQAREKQPLSKLLITSALPKEGKSFTTANLGQVMVRQHGRRVLLIDADLRNPQLHNQFGAEIGP
GLGDYLRDEADEYSIIQRGSMENLFLIPAGRISPNPAEMLSNGRIKTLLHRLEPLFDWIIIDSPPAVPVADAAMLANHCD
GVLLVVRSNSTPIDAARRARAEFTGRNVVGVVLNGITAEMSPYMQYYYSAYSPNVRTEDKN
>gnl|bykdb|A0A2V9RKJ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEALKKAEEQRSAEHEMHIEPPLASAPEVVPDPVSMPVAAVPPLADERDRRTVSAAMPSFGTGLSVESLLSRCVAG
HWTPDRKTMLFFNGDEQGYGTEEFRTLRSRLYQLRDRLPLKKVLVTSALPKEGKSFVAANLAQVLVQQQGRRTLLIDGDL
RGARLHNALGTESSPGLTEYLLGEADEFAILQRGPMDNLFFIPCGRKVTSPAELVANGRLKTLLNRLEPLFDWMVLDSPP
AVPVSDAGLLANYCDGVLMVVRSNSTPFDMARKARQEFSGKQLVGVVLNGIDQGNSYSQYYYDAYGKPNGKNEQR
>gnl|bykdb|A0A2V9RN95 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=256 residues).
MPSFASPFTFDALLARSAQARWSPDSKTMLFFNSDEQGYGMEEFRTLRSRLYQMREKQSLKKILVTSSLPKEGKSFVAAN
LAQVMVRQQGRRALLIDGDLRGPRLHQVLGTASSPGLSEYLLGEADEFGAIQRGPMDNLFFIPSGRTVSSPAELVANGRL
KFLLNRLEPLFDWIIIDSPPAVPVSDAGLLANYCDGVLIVVRSNATPFDIARKARQEFRDTSLVGVVLNGIDVGSSYTQY
YYSSYGHPNSKGDGRR
>gnl|bykdb|A0A2V9RTW2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=308 residues).
MSRIHEALKRAEEQRAASQGGQVPSSQTPEAVLSDTPTEAQVVASPSTGVAPPSFAAPFTFDTLLARASQHDWTPDTNTM
LFFKAEEQGFGTEEFRTLRSRLYQMREKQALKKVLVTSALPKEGKSFVAANLAQVMVRQHGRQALLIDADLRGARLHHLL
GTSATPGLAEYLLGENDEFGIMQRGAMENLFFIPSGRSVSNPAELVANGRLKILLNRVEALFDWIIIDSPPAVPVSDASL
LANYCDGVVMVVRSNATPVDMARKARQEFRDKHLVGVVLNGIEADSSPYNQYYYGAYGRPDAKGATQR
>gnl|bykdb|A0A2V9S1P8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=311 residues).
MSRIHEALKKAEEQRVASQGGRPVEPVQPADAAVAEPLAATPPAPQGTTASVGASIPSFGSPYTLDTLLARCPQGRWSPD
RKTMLFFNPEEQEYGNEEFRTLRSRLYQIREKQSLKKVLVTSALPKEGKSFVAANLAQVMVRQEGRRALLIDSDLRGSRL
HEALGTSSSPGLSDYLLGEKDEFAVMQRGSMENLFFIPSGRSIGNPAELVANGRTRFLLNRVEPLFDWIIIDSPPAVPVS
DAGLLANYCDGVLMVVRSNATPFDVARKARQEFRDKHLVGVVLNGVSTESSYTQYYYATYGRTNGRHESQG
>gnl|bykdb|A0A2V9SVU9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=429 residues).
MNSQMKEVDAQIQVEMKKIVSRVRSDYLAALQRETMLRAALDKQKQEANKLNESAIDYSLLKRDVETNRTLYEGLLEKLK
EAGVTAGLRSNNIRPVDEARVPMYPAEPNVPRNLSFALALGLTTGVGLAFLLEGIDNTVRTPEQAQALSALPSLGLIPLG
LKAGVEMSMKQRLSVASSKEVVELITQSRPQSQMAESYRALRTSLLLTSLGAPPKVILITSALPQEGKTTTSINTAIVLA
QKGVRVLLIDADLRRPSIHKTLGMGPKTGLSNVLTGNATLQQATVRSSILPGLFILPAGTPPPNPAELLASSNMKDVLAE
LREQYDHIVVDTPPTLSVTDAVVMSTRADAVVLVIRSGQTTKQALRRSRDLLMQVNARIAGVLLNAVDLNSPDYYYYYEY
QGKYGHRYYREEEMDNGGASLPSVRAGSA
>gnl|bykdb|A0A2V9TGF1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=308 residues).
MSRIHEALKRAEEQRAASQGGQVPSSQTPEAVLSDTPTEAQVVASPSTGVAPPSFAAPFTLDTLLARASQHDWTPDTNTM
LFFKAEEQGFGTEEFRTLRSRLYQMREKQALKKVLVTSALPKEGKSFVAANLAQVMVRQHGRQALLIDADLRGARLHHLL
GTSATPGLAEYLLGENDEFGIMQRGAMENLFFIPSGRSVSNPAELVANGRLKILLNRVEALFDWIIIDSPPAVPVSDASL
LANYCDGVVMVVRSNATPVDMARKARQEFRDKHLVGVVLNGIEADSSPYNQYYYGAYGRPDAKGATQR
>gnl|bykdb|A0A2V9TMX2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=695 residues).
MYQATSKVAIFPEVPNVLGFKDAENIAPDYEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESPMGEPS
MQPDPVQAAGLLGAFRGGLSVQPVPSTRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSEWLGKELADLQ
LKVQTSEEKLVRYQKDHGILGVDEKQNIVTEKLGELNKELTEAETDRIQKEADYKLAVNGDPEMFMKTSPDGRGGSGLLD
KLREKEADLETQYAMATTQFGSGYPRVTELNNQLKQVRAAIEAEKTKLQQKMRDDYLAALQRENLLDSAFNKQKQEANKL
NESATIEYTVLKRDAETNRQLYQDLLQRLKEAGVSAGLRSSNIRIVDIARVPTQPISPNVHRSLVLGFLLALGLGVGLAL
VRETFDSTVRSMEEVRAVSTLPALGTIPLQLVTDERFRKRRLTISPDGERSGMLALVTYERPKSEAAEAYRALRTSILLS
SFGAPPKVILVTSAMPREGKTTISANSALVLAQRGSRVLLVDADLRRPGVEKLFGIRAHGGLSTLISGSSNAEEVILPSS
EVPNLWILPAGPIPPQPTELLGSTVMKDYISRWRNEFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTRPALRRA
CDLLLQVNARVMGIVLNALNLHSVEGYYYYGTQYSNNYYSEESPNNKPKAASKIS
>gnl|bykdb|A0A2V9U6D9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=310 residues).
MSRIHEALKKAEEQRAASQGGSIEPAPIAEMVNDPAATAVAPAVEHTPSAVSAMPSFSSPFTFDTLLARCAQARWSPDSK
TMLFFNSEDEQGYGMEEFRTLRSRLYQMREKQSLKKILVTSSLPKEGKSFVAANLAQVMVRQQGRRALLIDGDLRGPRLH
QVLGTASSPGLSEYLLGEVDEFGAIQRGPMDNLFFIPSGRTVSSPAELVANGRLKFLLTRVEPLFDWIIIDSPPAVPVSD
AGLLANYCDGVLIVVRSNATPFDIARKARQEFRDTSLVGVVLNGIDVGSSYTQYYYSSYGHPNSQGDGRR
>gnl|bykdb|A0A2V9UEM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=299 residues).
MSRIHDALKRAEQERATSMGGQLEPALEQPELQPVGMPEHAHMQTAVMPPIQGSSFSYESLLARCPVSNWNPDTRTMLFF
QEDENRKGAEEFRTLRSRLYQIREKLPLKRLMVTSALPKEGKSFVAANLAQVMVRQHGRRVLVIDADLRSPGMHRHLGAS
QTPGLSEYLMGECDEFAIMQRGPMDNLFFVPAGRQATGAPELLANGRLKLFLQRVEPLFDWIILDTPPVIPVADSTLLAN
FCEGVLMVVRSNSTPSDLARRAREEFQDKLLLGVVLNGIPADQLPKSRYYYGEAVSSPA
>gnl|bykdb|A0A2V9VC62 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=318 residues).
MSRIHEALKRAEQERAASQGGRVDSAPVMDLPASPEPLPGMAEAADATRTAPTAPIPGAPGNGQKVPSFATSFTFDTLLA
RSAQADWKPDPTTMLFFSQEDNALGTEQFRTLRSRLYQLREKISLKKILITSALPQEGKSFVAANLAQVLVRQHGRRVLL
IDGDLRVARLHTALGTTSSPGLADYLLGESDEFSIMQRGPMENLFFLPCGRTVAHPAELIANGRLKMLLQRVEPLFDWII
LDSPPAVPVSDASQLANFCDGVLMVVRSNATPYDTAQKARQEFQGKTLVGVVLNGITRGDSYSRYYYEAYEKTAKPKA
>gnl|bykdb|A0A2V9VQW5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=314 residues).
MSRIHEALKRAEQERAASQGTRTDGTPVMDLPATESVPAMPETAQASKAAAPGTPGNGQGTPSFTTSFTFDTLLARCAQG
EWKPDEKTMLFFNPEENALGTEQFRTLRSRLYQMREKASVKKILVTSALPQEGKSFVAANLAQVLVRQHGRRVLLIDGDL
RVARLHSALGTTSSPGLADYLMGESDEFSIMQRGPMENLFFVPCGRTVTHPAELIANGRLKMLLQRVEQLFDWIIVDSPP
AVPVSDASQLANFCDGVLMVVRSNATPYDTAQKARQEFQGKLLVGVVLNGIMRSDSYYSRYYYESYEKTARQKA
>gnl|bykdb|A0A2V9VR38 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=276 residues).
MFGHDPARFQVSPRGAQSQTVGDRYLQGSRRTRHPSQAAVPNGGVLPRSAYFPAAVEFRRSAQGYPQEGKTTTSINCAVV
LAQKGVRVLLIDADLRRPSIHKTLGMGPHSGLSNVLTGSTTTEQAITRTTILPNLFVLAAGTPPPNPAELLASTNMRDLL
AQLREQYDHIVIDTPPSLSVTDAVVLSPRADAVVLVIRSGQTTKQALRRSRDVLTQVSANVVGVLLNAVDLSSPDYYYYY
EYQGKYARYYREDDSSEHDHDEEHAVEESSPSSSSA
>gnl|bykdb|A0A2V9WCB3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=309 residues).
MSRIHEALKKAEQERAATQAMAVPPPMAAMPMSEQPVFADTPPVPAMPASMGLGMPTFGGGLNMDTLLARCPRTEWTPDP
GSMLFMNGDDHARGTEEFRTLRSRLYHLREKMTLRTVLVTSALPKEGKSFTSANLAQVLVRQHGRRVLLIDADLRGPRLH
LMLGTPMGPGLSDYLQSKNDEFSIIQQGPMENLFFMPSGSGIEDPSELIANGRLKMLLQRLEPLFDWIIVDSPPAIPVSD
ASVLAKACDGVLMVVRSNATPSDAARRARQEFPENALVGFVLNGTSEENAPYARYYYEAYENKGTATKA
>gnl|bykdb|A0A2V9WTP3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=317 residues).
MSRIHEALKKAEQERAASQGGPVPSNFSGAESPVTEPRVIDADTAARVAAVAPAVSAHASPGLPPFGSPFSLETMLARCA
AVQWSPDPKTMLFLNGDDNARGSEEFRTLRSRLYQIREKMTLKKILVTSALPKEGKSFTAANLAQVMVRQHGRRVLLIDA
DLRGPRLHLMLGTSSAPGLSDYLQGANDEFSIMQRGALENLLLIPSGCEVSNPAELVANGRLKFLLQRVEPLFDWIIIDS
PPAVPVSDASLLANSCDGVLMVVRSNATPVDMARKARQEFPDKVLVGVVLNGTSADTEAYSRYYYGAYEKRGTEAKA
>gnl|bykdb|A0A2V9X518 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=282 residues).
MDVPAVEAAGMPPVIERAPLSTAASAAAAGPAFSNAFTFDTLLARCAQSEWNPDPKSMLFFNDDERKYGAEEFRTLRSRL
YQMREKMPLKKVLITSALPKEGKTFVAANLAQVMVRQHGRRALLIDADLRGARLHQALGTSSTPGLSEYLLGESVQRGPM
ENLFFIPSGRTVSNPAELVANGRLKFLLTRVEPLFDWIIIDSPPTVPVSDSSLLDNFCDGVLIVVRSNTTPFDMARKARL
EFQDKHLIGVVLNGIEADSSPYSRYYYGVNGNNKEMQETVQG
>gnl|bykdb|A0A2V9XEV6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=315 residues).
MSRIHEALKRAEQERAASQGGHVESLHPMDVPAVEAAGMPPVIERAPLSTAASAAAAGPAFSNAFTFDTLLARCAQSEWN
PDPKSMLFFNDDERKYGAEEFRTLRSRLYQMREKMPLKKVLITSALPKEGKTFVAANLAQVMVRQHGRRALLIDADLRGA
RLHQALGTSSTPGLSEYLLGESDEFSVMQRGPMENLFFIPSGRTVSNPAELVANGRLKFLLTRVEPLFDWIIIDSPPTVP
VSDSSLLANFCDGVLIVVRSNTTPFGMARKARLEFQDKHLIGVVLNGIEADSSPYSRYYYGVNGNNKEMQETVQG
>gnl|bykdb|A0A2V9XV04 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=368 residues).
MSRIHEALKKAEQERASTQGERVPSSYATTPVADVPGYDDIEVNRVPPSLGMPELGGPSSLEMLLGRCPQPGWNPDLQTM
LFMNGNDSAKGTEEYRTLRSRLYHIREKMPLKKLLVTSALPKEGKSFTSANLAQVMVRQHGRRALLIDADLRGPRLHQML
GAPKGPGLAEYLLGKADEASVIQRGPMEGLFFMASGESIEDPAEMVASSRLKVLLQRIEPVFDWIIIDSPPAIPVSDASV
LAKACDGVLMVVRSNSTPSDVARKARMEFPDQMLVGVVLNGTDRDEAEYARYYYESYEKKPALPSVLPASRSCAAGGRGP
DCLVVVCRGDHPSEPGELVASAERGGWVRQDSGRDSNRALDFALARPV
>gnl|bykdb|A0A2V9Y3Q6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=310 residues).
MSRIHEALKRAEQERATSQGGHLEPLHTTEGPVMDPIQASTVVEHPPVAPSTGIPPFSNPFTFDTLLARCAQTNWSPDAK
SMLFFNSDERKYGVEEFRTLRSRLYQLREKMSLKKLLITSALPKEGKTFVAANLAQVLVRQHGRRALLIDADLRGARLHQ
ALGTNFTPGLSEYLLGESDEFSIMQRGPMENLFFVPSGRTVSSPAELVANGRLKFLLNRVEPLFDWIIIDSPPAVPVSDA
SLLANFCDGVLIVVRSNTTPFDIARKARQEFEDKHLVGVVLNGIEPDSSPYSRYYYGSYGNKETQETIQG
>gnl|bykdb|A0A2V9ZA03 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=272 residues).
MMKDLGLTRNAAASPRMLHDLDSDLAVSNEPPGIEVEVPPNPRLVAMMEREGVGAEKFRVLAARLQYFRKQRQLKKVVIT
STIKGEGKSVVSANLAVTLARRQRTLLIDGDLRQSGLRELLTTHGLPGITDWWQETADVSEFLRRVNGFPLWYLPAGEAM
GQPLEILQSQRMSEMLTQVAEWFEWVIIDSPPLAPVADPNLWAMQADGTLLVVEQGKTPKKLLRKSLESIENLKLIGVVM
NGSQDADHQYYRQYYKSPANSRASAGHERRLS
>gnl|bykdb|A0A2V9ZCI3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=298 residues).
MSRIHEALKKAEQERAASQGSQIDSSHVGEMPVMDPASVATGVAAAPGPATPAFSSQFTFDTLLARCVSVNWHPDEKTML
FFTKEDHAPGMEEFRTLRSRLYQLREKMPLKKILISSSLPKEGKSFVAANLAQVMVKQHGRRVLLIDGDLRGSRLHQTLG
CPNTPGLSNYLMGENDEFAVVQRGPLENLFFVPAGKQVSSPAELVANGRLKFLLNRVESLFDWIIVDSPPAVPVSDASLL
ANFCDGVLIVVRSEVTPFDMARKARMEFRDKQLLGVVLNGIDSSSSAYSRYYYGYGDQ
>gnl|bykdb|A0A2W0B5E2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=219 residues).
MAAQATSEQSEAYRALRTSVLLSVASRAPQTVLITSAKIGEGKSSTALNLAMALAQCGSSVVLLDCDLRKPVLARLLGIQ
NERGMSTHLTGHDSINDVIQQYKEQPNLWLIPSGPIPPNPAELLCSEAMESLFGELRRRFKHIIIDSPPLLAVTDATVLA
SAVDGVILVVESGVTPKKFVSRARNILDGANARLLGVALNKVHMRHDGYYGSYYSGYHA
>gnl|bykdb|A0A2W4TWK5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=304 residues).
MGRIDEAMRRAGGASATVEEAAQPAVPVELPTEAFPAEPGQRPEPSERPVRHARPAMDAPVVDDEPEPALPPLEGRIAPA
LERKVVIDRELDPVSREQYRRLAMALHAAQGTGGVKVIAVSSALANEGKSLTASNLAMTLSESYQKRVLLIDGDLRRPSL
QQIFGLPGEGGLTAAFAPRSDHRIRLHRITPHLTVLTAGRPTTDPMAVLASERMRDLLADVREDYDWVVIDTPPIGLLAD
ANLLADVSDGMVLVVKAGTTPYDVVQKAVELLGRDRILGVVLNQAEPDSLADRYQSYYYSPARS
>gnl|bykdb|A0A321LMC5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium AA13] (length=332 residues).
MPMGRVYKALVKAGRITEQFQQPEGAVFGDAIGPDFFDERDDSFIKESGSTRNSQPASSRREARASAAASNLRVGEFARN
NQGFVEPRQSFSIHDLRVDQHLAGLIERDDLARERYNTLAVRLINLAAKHNRRSLLVTSALEGEGKTTIATNLAWVMARQ
SGKKVLLLDADLRRPSICKMLGLKSPHGLVDVIERRAAVSDSIVAIKPHGMYVLADRSNGDIPNLSAGDILTTSRVEGVL
DELESAFDFVVIDAPPITDFADAQRLAALADGTVLVVKAGRTHHSAVANALKLIPKERRVGVVLNVAEVFNEEVTYYYGA
KNKRRGWFGKKH
>gnl|bykdb|A0A321LXF5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriia bacterium AA117] (length=308 residues).
MSRFFNESRKASRHVTVGPRNVDLQEHISRLREGLETHSRPSSSQVRQVLAPLEDANNIASQVVAARLENCRSIRLPRDN
EQLLLVPQYNLPMQQAMEAYQTLRTRLVKHEGRHGMRSLVISSAAPGDGKTLTAFNMALCFARIQNWPVLLVDADLRTQG
MSSLLGRAGAAGLADILESDCAYDQAVLQTDVPDLYVLPAGKSSTPAPELFSRAAWKEFIGWSSESFKLVLIDSPPMLDL
ADFELIASPCEAVMLVARSGKTSLETFTKTCARVDPKKLAGVVLNACEEVGDKDYKYYRYAVGGPSSS
>gnl|bykdb|A0A350D2W9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=428 residues).
MQRLKAELDTARDLLKNETGGLVKAAYSEYQAALKKENSLKDLFERQKDEAFRLNSNAILYNGLKIEIENKKSLLESLLK
RQSETGVSARLRGLRTSNIRVIDRADLPINPSSPKKLRNLLLALFLGLFGGAGLAFVMEYLDNTVKSAEEVGRYTGLPTL
GVVPVFGDDSNRAYGYYYSYGQKKGEEKGKGGKEDSGKPKNIELIVHFAPESAFAENYRSLRTALLLSSPQGSLKTIMVT
SPLPEEGKSATISNLAVSLAQTGKKILLIDADLRRPKQHQIFKMKNHEGLTSYLALDLPVQKLIKPTMVPSLYLINSGPI
PPNPAELLGSDRMSKLLALLKDQFDFVLIDTPPILTVTDAQILGKLVDGLVLVVQAGTTPREALVQTRELIDLLKLRTLG
VVVNSLNLENHGYYGRHYYRHYYKESRG
>gnl|bykdb|A0A352EZH8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=364 residues).
MGRVYDALRRSGTDGSAIVFEPQPSSSDYRGEIRTHRLVPSAQQIEEELFSASSILNRTEDTVTSSAFTAHTAYATGGTA
LPAGQSSGAVGATLDAARPARVSGLVSYDVDATRVEPHLVAITQPRSAYCEQFRSLRTRVLQAGEREQMRTFVVTSAGMG
EGKTLTALNLAWLLAQSEGVKALVIDSDLRQPCATNYLAIDAPRGLSEILGGELSLRDAIVRLDPAGLYLLPGGQAREDV
AELLSGPTFAGVIAEARRLFDFIIIDAPPLGIFTDANVLISRADGALLVVRAGKTRYAQVNELLEQLPRERMLGVVLNRA
DEELESGAYYYQQRHYRQPRVPAGEDRLRLVSELEEDEEVAIAS
>gnl|bykdb|A0A352FU10 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=363 residues).
MGRVYDALKRAESAERQVTSSKSSVRQNGNSGNVLYPGWPGNGHDHPWERNAFTGMASAYDSASTAHTSEAASGPALPAG
TASRDAGATLGAVGSARAVEFSSREISTARVEPHLVAITDPRSPECEQFRALRTRLLQAGEREHKHAFVVTSAGMGEGKT
LTALNLAWLLAQTDGATALLIDADLRQPCAAEYLGIQTECGLSEVLTGETKLTQAILKLEPSGLHLLPGGAAREDVAELL
SGPRFGRLLEEARKLFDYIIIDAPPLGVFTDANLLINRADAAMLVVRAGVTRYAVVDRLLEQLPRERMLGVVLNRAAGKT
DDAAYYYQPRHQRVASAATTDVADREAVEDEPEMIYIEEEGVS
>gnl|bykdb|A0A353CAT5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=671 residues).
MLRAIGLASDTTKDTTSTADSVNSLNSGLVSADEIAEAIRLAPYVEIIRNNLTVEPVREPRATFKDTRLIEISFRHTNPE
LAAFVVNGLGETFASTNQEQRSGTSRKTSDFLQKRISDLQADIRNDEVRLVELERSEGILKTPGDQTIVLERLGGLNKDL
LTAENDRKTAEAEYNSVKGSPERLKSLAEAESARYITERENFILNNRTETDKAIAGLAATRAKLLEEYKESAPEIKEIDS
QIASLERSLKTATDRANAEIATFRERTAKTLIDVLETKYRRAKEKEDKIRAAFDVQVNEAQGQNAGAVMLKLLQQSIETN
KGFLDNLRKQQSSNDIATQGTDNNIRVAAFAIPPDTPVAPRRLTTVLAALFLSTLFGMGLALFLEYLDDTIRTTEEIENY
LQLPALAAIPTIDSMPKRRLLLVGNAERPAEDDPANSELLIYADSRSSLAEAYRQLRTSILLSTAGHPPKSLLITSSLPS
EGKTTTATNTAISLAQTGARVLIIDADMRRPRLHSVFNITNGIGLSTLLSSELSEAEILKAIRTDDGTKLNLLTSGPIPP
NPAELIGSEQMASLLKVLQKHFTHVVIDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVRRTKQSLIDVGAKIVGVV
LNNVNLRSQDNYYYYQSYYHRDNYRSGDDPK
>gnl|bykdb|A0A355ESH9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=674 residues).
VRSLDLMADPSFNPGAAAAKERTGATTAEEDEATLGKLAQQLKGGLTVDPVRNTQLVRLSFRSSSREFSAKAANAFAESF
IDMGVEDRYASAGKASTFLGSQIETLKQEVAEKEAQLQAFSRSSDIVTLDPQSNVTLRRLETLNTALMDAKKERIEKEAH
YHEVMTGPLDAVADSLAPGVISGLRTQQLQMEQDYETKLKTFKPEWPEMVSLKSQIETGKQHIDSVIREMVQKARSNASS
NYQAVLRQEQSLAAELETIKRQAIDQNSSAVQFTNLKVEIQTRRELLDELLRRQSETEVAVRLQDTRESNVRIIDHALVP
DGPFRPSLRKDLTYGLLIGLLFGIGVALFLEFLDRTVKSPEEVERRFSIATLAVIQDIAETGKAYGSPAYGYGYGYGYGY
GDPPTGEPSRVRPTKGKAKVAGGGWLEKKKGTPGPQAQIELVPHERPRTLISESYRSLRTALLLSSARELKVVAVTSAMA
GEGKTATASNLAVVLAQLGRPVVIIDCDLRKPRIHQVFKLSNRSGLVNQLTGTAELDAVIFPTEVPNLWVIPSGPMPPNP
SELLASERLRDLLRTLRSRFDYVIVDTPPALAVTDATLVGIQTDGVVLTLRSHKVTREEVRLVRDRLRQADVKILGAVLN
RYRALQAGAAAGYRYAEAYGYGAEETGSKAGSAA
>gnl|bykdb|A0A359M0J2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=801 residues).
MHPEDPNSGTSHRPQALTPIVLPRNAQPALYTPFPSEPAPEAPATNWVQFHLAILKRRFWWVLALGFLGTGVGFLVFLPQ
DPQYMAATTIELQPINENFLGAFDPLSGSFSSQNLNAQTQISILRSYSLLSAALERMERESTLTAAAPAGRFAALRRRLG
FVPLEPLEATREATFIAARSVMPRIVPGTRIIQITASSTIPEVAANLVNAVAAEYVYQNQQFRSNSVQRTTQWIAGQLEE
TKFKLEQAEQKLQDFVRKSGNVFVNSEDTLANSKLRQLQAELTAAQTDRINKENRLNVAKGKPVETLPGEIAGGLSTQQG
ALDSLKRQRADLLTTLMPGHYKVQRIQAQIDELEQSLERERVNIVERLKNDYEAALKREQMLTSAYSRQASAVTGQANVA
AEYGTLKREVDILRQSFNALLQQSNQVSIGSAIPVSSVRVIDTAKPNNTQMSPSLFRELARGLGLGLLLGYGCAFLHERV
YRKRQERRFAAPGNSGRLLNVPELGVIPSNAAPERFGKQFFRIRVRRRKSKPLSLTGTGTAAPAAETPPSNPRLEFLEIW
KGKPSIVAESFRLTLTSLTRSGPGSLAPGLVLVTSPSPGEGKTTIAANLGVAMAEVNRRTVVIDMDLRRPSLHNTFGSIP
EVDWTSLVMDDAPITAERIEPLLQATDFEGLSLLAAKAASASTIHSIFNSPRLGELLAVLRQRFAMVLLDSPPVLQFPEA
RLAGRFADGAVVVLRSRHTERDAAMIALRRMAEDGIPLLGTILNDWDPKSGAHHSHGYGADYYSKYYEYQTMAESGKSGT
S
>gnl|bykdb|A0A399W9E4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=332 residues).
MSVLQALQRKNSENPTSTKPKVVAFDAPGRRNLPPDLLGTGLAIGSPRSAFDGQPNSSLGTALPDVETGLTAGAKPNADT
LTRSHRRPLPDCVSWTVDAERVEPRLVAITSPNSSYCEEYRSLRTNVLHKSQRQNLQAIVVASANPSEGKSVTAVNLAWM
LAQTDGVRALIIDSDLRMPSLADYLGIETEKGLSDILTSDARLQDTIVKLEPSGLYLLAGGTARPDVAELISGPKYAELL
AEAREMFDYIIIDAPPLAIFTDATVLINKADGALLVVRANRTKYSALDRILEPLPKDRMLGVILNQSEEVLDESHYNYGY
YNYRRMAEDAAS
>gnl|bykdb|A0A3B9LSB4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=454 residues).
MVDATEEAPEVKEVDQQIAELERQVKDVRSRKSVTLLTNLETDYRQTLAREQALRKAFEQQRGETLSQNEAAINYRIIQQ
EIDTNKTLLDSLLQRSKENDVIMASKPNNISIVDYAVTPDGPIGPNRSSTVSMALFLSLGLGVGLALLLEYFDDTLRSSE
EVERLLQLPALGVIPSANASARRRLMGASGALQKRNGHSDSPELLMNVDGHSPLAEAYRHLRTSVLLSTAGRAPRSLLVT
SSLPGEGKTTTAVNTAVSLAQTGASVVIIDADMRRPRLRSIFGLSDRAGLSSILSSDVSEADMLEMVSTDEATGLRVLTS
GPIPPNPAELLGSDQMRRLMATLQSQFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVRRSRQLLHDVGAK
IFGVVLNNVALQSHDYYYYQRYYGARNYKSDGDDDIEPTSHARRNGSHNTLDLN
>gnl|bykdb|A0A3B9MKY6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=362 residues).
MGRVFDAIKRASAADQGGEQKRHQPDLERHGESPSVPGLPSARQIEEQLPSRSSFLSVSHETAQNSASSAHTADIPGGLA
LPGGKASRDAGATLGAAGAARVDGFATYDISPARVEPHLVAVSQPRSPYCEQFRSLRTKLLQAGERKQMRAFVITSAGVG
EGKTLTALNLAWLLAQTDGVRALVIDSDLRQPCATEYLGIDAPIGLSEVLGGAVRPEEAIVRLDPAGLYLLPGGKARDDV
AELLSGPSYARILTDVRRMFDYIIIDAPPLGIFTDANVLMNRADGALLVVRSGKTRYALIDRLLEQIPREKLLGVVLNRV
DEQFDETAYYYQRHYYNRDRGLTEAKTKQLPGERQEEVALVN
>gnl|bykdb|A0A3D0NW85 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=673 residues).
RGFLRAIGLASSPDAQSDASLSEFAASPNSGLMSADEIAEAIRLAPFVDVIKRNLSIEPVRESRVTVKDTRLIEVAFRNT
DPQLAAFVVNGIGETFAASNQEQRSGTSRKTSDFLQQRIADLQSDIRRDELKLVELERTEGILKTPGDQTIVLERLAGLN
KDLLTAENERKTAEAQFLSVRNNPERVSALAEAESARYITERENFLLNYRNETQKTIAGLTANRAKLLEEFLPTAPEVKE
IDSQIKSLEDSLANATEKAQAEIQAYRGRTADNLLKVLETQYRRAQEKENKIRSAFNVQFQEAQGQNAGAVMIKLLQQNI
ETNKGFLDNLRKQQSSNDIASQGSDNNIRVAQYAIPPKNPVSPSRTTTVLAALLLSTLFGMGLALFLEYLDDTIGTTEEI
ESYLQLPALAAIPSIDSMPKRKLLLVGGSDRPDEETEPLNSELLINADPRSSLAEAYRQLRTSILLSTAGHAPKSLLVTS
SLPSEGKTTTATNTAISLAQTGAKVLIIDADMRRPRLHSVFGVSNGEGLSTILSSEMSENEILGVIQQEPSTKLNLLTSG
PIPPNPAELIGSQPMAELLVTLQKNFTHVVIDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQIVRRAKQLLNDVGARI
FGVVLNNVDLRSQENYYYYQSYYSQSQYRRDEE
>gnl|bykdb|A0A3D0NWU2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=515 residues).
SASQRGEGMNIPDLYENKIFQDTMRLNNERKAKLQDDIRNIDKQIQQAETEKSELLVRYTPEYPEVKKMEERIASLKESR
TRTEQEVSSIIDRDQKRIEREAVGGALTALRAQLDAKRKEEAQAQAAYDREAALANIQGQAQTRLTTLKRDIETKRNLLD
TYTQRLKEQELAIANSTPDNIKMAAAAETAPRVGPNRTRNIIVALLLSLAAGIGLAFLLDYLDDSVKNSEEIGRQLGLPT
LALIPHYFGSEKKRLRLAAENGGSPGTSLVALEERHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEGKTTTAINT
AITLAQADVDVVIVDCDLRRPRIHNYFDLENSEGLTNYLSGDRNTKNLIKACRDLPRLKVITSGPIPPNPAELLSSNEMR
NLLQFLRSKYKHVIIDSPPAISFTDAAILSTQVDGVILVAMAGKSSMHLMRRFKQRLGNIGARIYGVVLNGIKQGSVEYG
YYGSGYYDYYKSADADTTTPRMDSDANGNGSNGRA
>gnl|bykdb|A0A3D5SKZ1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=362 residues).
MGRVFDAIKRASAADQGGEQKRHQPDLERHGESPSVPGLPSARQIEEQLPSRSSFLSVSHETAQNSASSAHTADIPGGLA
LPGGKASRDAGATLGAAGAARVDGFATYDISPARVEPHLVAVSQPRSPYCEQFRSLRTKLLQAGERKQMRAFVITSAGVG
EGKTLTALNLAWLLAQTDGVRALVIDSDLRQPCATEYLGIDAPIGLSEVLGGAVRPEEAIVRLDPAGLYLLPGGKARDDV
AELLSGPSYARILTDVRRMFDYIIIDAPPLGIFTDANVLMNRADGALLVVRSGKTRYALIDRLLEQIPREKLLGVVLNRV
DEQFDETAYYYQRHYYNRDRGLTEAKMKQLPGERQEEVALVN
>gnl|bykdb|A0A3M1SNQ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=305 residues).
MKILKALQRRKQENERIVPFERKYQPESYAPTTFPLGDIKIGAPTSSEPEIASNDSPITFTQAETLVFPRVEIDPEIVHQ
RLISIKAPNSGYCEEYRNLRTHILHESQKRHLKVITITSINPNEGKSITALNLAWLLAQTDGISTLLIDADLRNPSLASY
LGIEPDKGLAHVLSGEIKLRESICRLEPSSLHLIAGGAIKSDSSELLSGPKFRDLLQHLKKMFDYILIDAPPLAIFSDAK
VSINQSDAAILVVRSGHTKYSTMTRILEGLPREKMLGVVLNDSEDLLQNESYYRSYQKYAEVVDS
>gnl|bykdb|A0A3M1SSE1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=317 residues).
DIPVSPRRLLTVMMALFLSACFGIGLAFFLEYLDDTIKTAEDVENYLGLPVLVVIPSMNAAQKRRLLLVESSDNEPASKN
RSELLIYDNSRSSSLSEAYRQLRTSILLSVAGHAPKSLLVTSSLPAEGKTTTAVNTAITLAQTGAKVLVIDADMRRPRIH
SIFNISNREGLSNLLSSEIKRDKVLDSIYFDMSSRLYLLPSGPVPPNPAELIGSAQMSTLMEIFQKEFTHVIIDSPPIAS
FTDGVLIAAMVDGVIMVVHSAKTSRQIVRRSCQLIQDVGAKIFGVLLNNVNISSQDNYYYYQSYYYNSYYKKEEEEE
>gnl|bykdb|A0A3M1VTE1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MTAGGSGRGADRGSPTRYAIGAGVGARPRRPRPRITLAPTEELVVAREPNCPAAEAYLRLRSALLHESDGTPPRVIVVTS
GMPQEGKSLTAVNLALAFAACGDERVLLVDGDLRRGGLARFLEPAPRAGLRELLEGKVPEEEALLEVSGTRLAVVPAGRP
VANPVGLLSSGRMAGLLAEWRSRFQRVVVDTPPIVPFADAGILGELSDGVLLVARAGRTPKALIEQVVEEAGSVKLLGVV
LNDWTGSLADRRTGYDSRYYSRYYGKGGR
>gnl|bykdb|A0A3N5G7M6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=233 residues).
SARPLLVDREISTGFGEAFRAFRTNVRLSMLPGGMRSVVVTSACAGDGKTLVASNLAVALALAEHRVLLIDADLRRPTLH
TAFNVKSEPGLTDFLIGEGRIANLIRRTRIPRLHLLTAGTLPPNPSELLDSQRFRKFLARLGNHYDWVILDSPPVMPVTD
AIVLAEAATGVIFVTAAETTPIPASRSAVDQLRRAPAPLLGVVLNRADLKRRGYYTRYYRRAYQAYYGHPTPA
>gnl|bykdb|A0A3N5NSX5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=595 residues).
ARRLTRAATPSGATAGQPSATDLANAFLGAVHVEQVRGSRLFNVSITSSDPQFAARAADALAAEYVQFNLEYRTDATRKS
LDFLAGEIAKQQTKVEDSERAMAEYRESNNALSLEDRQNTVVSSLNQVNDEYTRIRTVRIQKEALYNQIKSLPPSSVGDA
PAVGASPAVQSLRTRLAELQRQKVQLNERYGPKNPQVIENDNAIADTTQQLQTALTAAVAAIRSEYQTARATELRLADAL
KQSQGAAMELNRKNVGYTVLEREAQSNRGIYEALLQRQNELQIVSNSGGNNVRLMDRAVVPGSPFTPDVRRNYMLGALTG
LLLSLGLVLAIDYLDDTVKTPEDITRRLKLPFLGLVPAVKGNNHPLLSQEVPHEFGEAFRALRTSLVFSSGTEGTRVIAL
TSAQPLEGKTTTACNMAIALAYGGSRVLLIDADMRRPSVSRTLGIENNVGLSHLLTGQATARQAIHRTNVQNLWVMTAGM
TPPNPSELLASDRMKTLIANVQTGPFDWVLIDTPPVLAVTDAVIIAPWVSGVVFVIGSEMTQRRLAERAVETLLTSRPHV
LGAVLNRVDIIRNKYYYSRYYGYKYKNYYVKSNAA
>gnl|bykdb|A0A3N5NYV3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=303 residues).
MSRLAEALKRASAEQESDGAEQQEPIKREKPPTSHPKLAVAEATAKLESAVQAEAASVATEAESEATAPRVTSSVTSLIA
EKLVVTPSISPVSLEQYRRLAATLHRRQTESRIKTVLVASTMAGEGKTLTAVNLALTFSESYGRNVLLIDGDLRRPTTHA
VLEVPNILGSGIGSKQETDQKLSLIQVSPRLSVLTAGQPDPDPMSRLASDRMRRVLMEAATQFDWVIIDTPPVGTVPDAN
LLATMADVVLLVVQAGRTPARLVQRTADALGRERVMGVVLNRADDLVVSSDSSSSYAYGPNNN
>gnl|bykdb|A0A3N5P5F2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=530 residues).
IERNLQFKFDASKDAADWLTNQLDAQRKNVEETELALQRYREQNNATSTNDPEVIQRLSGLNAAVMEARTARLEKEAALT
QLRAIQHDKAALASAPAVVANASVQRLNQELADLQRQDAQLSRQYGERHPEMIKVRTAIQQIRQKLDAELHNAVQAVEGE
YVGAQAREESLTRELEAQKADVLAINRKSIGYAALERDAASNRQIFEALLQRAKETGISSELKTNNIRIADPADVPRVPI
SPNKQRDLLFGVMVGLVAAIGMAFLFEYLDNKIKSPPEIRTYLNLPCLGLVPRIAGKHGSSPLLLNNGAPDSFAEAFRAV
RSNVLFSVSPECRRLVVTSTAPREGKSVVASNLAAGLAMAGHRVVLIDADMRRPRVHAIFDVELSPGLSQLIVGSAKAEV
IRRSRIPNLWIVPAGEVPPNPAELLSAQQFEHFLNSLSARFDWVILDAPPVLAVTDASIVAHSASGVVFVTSADLTDRNA
AVQAVSQLRSAKANFLGVVLNRVNLSRNAFFYAPYYRREYTDYYSRALRS
>gnl|bykdb|A0A3N5PFU4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=230 residues).
MNTFATQLVSLTNPASFAAEQYQNLRLKIERLRQTRDLRVIAVTSPGAADGKTVTSINLAGALARGAAARVLLVDADLRR
PQVADHLHIPQGAAGFADLVVSARASLGEAVRPLDGFNVDVLPAGVVAGPIHDVFRSARLPQLLSEARARYDYVVLDTPP
LVPVVDSVLLSRVVDGVLVVVAANKTPRRLLEEGLNALDSAKVLGLVFNSDVRPLYGYDNNYRRYFSRAH
>gnl|bykdb|A0A3N5YKY1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=314 residues).
MQVFATPSAATHPNVPPTVGVGGASAVPPAAAFPGAAGPTAAPASPAAAPASFPGNGGHQPLPIVVPNPVLAGGRRARSV
TLHPLLAAALEFGSPAAEQFRALRTRIGQVEFGGRDCRSLVVTSPMPGDGKTVTSANLALSMAQEFHRKVLIIDADLRKG
ALHRMFGVDNEPGLTDVLAGDVPLEEALIWIPEYRLTLLPAGRPTNQPTELLGSFEMRRAVDTLRTHFDRIVIDTPPALA
LADVGVVGPLSDGVLLVVRAGQTPRPAIERALRQVAPARVLGLVLNDVGEISSGYAYGRVDNQNAGRRVARSGA
>gnl|bykdb|A0A3N5YN96 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=371 residues).
MSRIQRVLDKAEREGQVRRTTSEVPPAADTAAAGRVSSPVSPQPPVASRRAVPPEPPMQVFATPSAATHPNVPPTVGVGG
ASAVPPAAAFPGAAGPTAAPASPATAPASFPGNGGHQPLPIVVPNPVLAGGRRARSVTLHPLLAAALEFGSPAAEQFRAL
RTRIGQVEFGGRDCRSLVVTSPMPGDGKTVTSANLALSMAQEFHRKVLIIDADLRKGALHRMFGVDNEPGLTDVLAGDVP
LEEALIWIPEYRLTLLPAGRPTNQPTELLGSFEMRRAVDTLRTHFDRIVIDTPPALALADVGVVGPLSDGVLLVVRAGQT
PRPAIERALRQVAPARVLGLVLNDVGEISSGYAYGRVDNQNAGRRVARSGA
>gnl|bykdb|A0A3N5ZFD3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=269 residues).
MAEALSASPAEPRSAAAQPRATGPMAVFHGFDPSVRERIVTGHAETNGNLAVMTVATEQYRRLAATLHHAQMEKGLKIVM
VVSSMAGEGKTLTATNLALTLSESYQRQVLLVDADLRRPSLHRVFGLPNATGLNEALTEEAGNPPALFSISPQLTLLAGG
RPHPDPMAVLTSDRMRRLMEEAAAGFDWVVVDTPPVGLLPDANLLAAMVHAAVLVVEAGKTDYASVQRAVAAIGRDKIIG
IVLNRAERPAGTYGNYERYYAGYAKRTEG
>gnl|bykdb|A0A3N5ZNH4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=262 residues).
MPSLGVIPTIAKPGRTQKFLAAKNSEEDENSTALLNANELRFRVWESYRSLRTSILLSNSGKPPRTILVTSSIPGEGKTT
TVANIGIVLAQTGARTLLVDLDMRKPALDDKFNCRGEKGMSSYLSGNSDLSSLIRPTAYPNLFILPAGFRPPNPAELIGS
DKMETGLKLLGEYFKYVVVDSPPVLAVTDALVISPLVDGVVLVVRGGATPKDVVRKAGGHLVGVHARILGAVINNVNMDA
PEYVHYYRHYYDETYSNDFSAA
>gnl|bykdb|A0A3N5ZPQ7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=529 residues).
MDPAQASRLCSYPCAAFPTPKATEVNRFESSMDNRKAILEYMKQIEVQEKTGSLYLVHGAADHTELTEMKEVIRVYFHGG
LVSAMSSSLPEYRLGQYCLKEGIIDPPDLHKQIKGRDHRPLGEAIVAAGLAEPVEIQQLLQKQAIDVFRRALENGFRIES
FEPMSVHLGIPLKARLDVLLLDLARTAANTFEPGLYEKIGLIAEHTFATLPWQPAELAVLDCLLQPKNLEELMGETGLPE
SQLVACLQTLRALGMIEIREEETEEERSVALTVRERLPLEQLVPEAADALLSQQLETVTNEHSFASEQFASLKVRIKESR
AGSPHKVITVTSPHIQDGKSLVSANLAFSFARDSGTRTILVDCDLRRPSLHRYLGIPPEPGLIGYLSTNLLRPYCFMRQV
QGLFVLAAGGISDSPIELLSLRKMRELFDYLRIEFDVVIIDSPPLNPISDTRLISGFSDDVILVIRRGRTPFATIEQGLK
VVDRKKILGVVFNDLDEKESQFSYYQHSYYHPGKDRQSSRTRRRKRNAP
>gnl|bykdb|A0A3N6BI26 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=629 residues).
MTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGRDKNRDVLDTFRDRLEVAQVPNSRLVEIRWVSPDPTLAAAVSDTLAE
EFIEQNLQTKFEANTRATEFLKKQLQDMKGKVEKSEQELVKYARENNIVNIGPDRGSMVLQTLEDLNRQMTTVEGELIGK
TADYQAVRDATPESFPQSLRTPSISLLEERLFGLQQNLASLSAQFGSEWPAVIQVRQQIQEVEKQLLREKKETINRVQSE
YRVAVNRRQMLLGALNRQKAEANQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETGISAGMRASNIHVVDHAEVPEAPY
SPQRAADLALGLGVGLFLAIGLAFLMEYLDNTLKTPEDMEQSLGLPSLGVIPAMADLPAGSSRLLASRNESGDSKTDLPA
AISPARFRVWEAYRSLRTSILLSHSGKPPKVIMVTSSVPGEGKTTTVANTGIVLAQTGARTLLIDLDMRKPALASTFGYN
GNQGISAYLSGNGDLSSQIRQTSYPNLFLLPAGFRPPNPAELIGSERMESALRLLGDYFKYILIDTPPILSVTDGLLLCP
HVDGVVMVIKGGSTPKEAARKAGNHLTSVGARILGALINNVDMNAPEYSYYYRHYFDERYNTDLSSAAG
>gnl|bykdb|G8NS05 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=747 residues).
MIPSRPENFSAEPDSRAASAGPAATDATLSEALMTIRKRKYVILAAALLGMIYGFYKGSTQPHLFESYGDIEIRSGSSDQ
YRIAGSTGAGGNRLPTEVAILKSDTLLLTVAEDLDLANNQDFLGMTQRPPHVNIEDPNVRQATIGRMQAIVSVANIPKTD
IIRISCSTFNAKLSADIINKLIDAYIKRSFTSRVSSTQRASGWLTSQLDELKHQVETSQNQVIDLQKRIGVLSIDPTHNQ
ISSSLEELTTAAGTAQIARILAESRYRVLSGMDPNSLDQTVANTTNNVAATQLATLRSQRETDMANYAKLTAPGNLGPNH
PQVKAAHAQIEELDKAIKQEQDRVIAQAKQTFIAAQANEQQTRAALEDQKSEAYKLRDDLVQYTLLQRDFESNRTLYEGL
LEKLQTARVQAGLDSTEIDIIDQAVPPAQPSLKSKSSIMMLNTIIGIVLGAILGFILESLDTNLHSVAEIEAVSGLHSLA
LIPRARRTGIDTSNLSVIQRNLATLSSPKSQFTEAFRGLRTSLLLSTAGKLPKVILLTSATPSEGKTTVSTNLACVFAQR
DVRVLLIDADLRRPTVHHRLGLNGKVGLTSVLTGSHTLEQAIQNVPEMPSLDILVSGPVPPFPTEMLSSETMAELLEKCR
GIYTHILIDSPPLLSVTDGIILGRDADAVVLIVRHGKSNKHTIRRARDLLLRAGVHITGIALNAIDLNSPEYYGYYGYSG
YSGYGSAGMDAAGWESQSGKSTGKGQK
>gnl|bykdb|G8NXD3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=282 residues).
MITLNLREYQTIEPHLMIASASNGDAGSPHKHQNAVVDRPASDQSDAINWLNMVPKLERLPQKHRTTIAFESGADSRACE
QFRLMQHRLVTARPAGGVVLITSPSAEDGKSLNCQNLAWALAEAGHKTLLLDLDLRRPSLLAALGGVCPQSIEQVLKGEV
TPEAAIRSVGDLPLYIIGLDKAVSKPVPLLRAPELSNLLKWAQKNFQWVLLDAPPVLPVADVEQLLPSADLVLMVVRERV
TRRAAVQRAAEMLGEHLSSLIFNDVTMSIAAGYGANYDRGYR
>gnl|bykdb|A0A022KX11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium muris UCD-AY4] (length=334 residues).
MAGEFSTLLKSSGQKVVSTPIQPASAPAQPVSPNPTRNLALGLLAGLVLGLGLAFIRHALDTKVRGEEDIRAHSDAPMLA
GLPLESRGSKRGLISVEEDPHGRHAEAVRRLRTNLMFVDVTTGRHSFVITSAVPGEGKTTTAVNLALAMADSGRRTLLVD
ADLRNPSVAKTLGMEGSVGLTTLLLGDADLDDVIQTWGSAGMDVLPAGPIPPNPSELLGSAPMEALLTRLMQEYDFVLID
SPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLETVGAHVSGFARNFVASKGSDYRYGYHRYEEEMTRRARK
AARTEPRAKQRARG
>gnl|bykdb|A0A023X491 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rubrobacter radiotolerans] (length=242 residues).
MARSKPLKKHKKTENLTDRLVSLSDPGGQAAEAYRTLRTSLLYSVVDEPPHVVAVTSPGQQEGKSTTCANLAVTLAQAEK
SVLLLDCDLRKPVVHSIFELRNTRGVVDALVGSENVEELWQTPLDNLSVLTSGPVPPNPAELLGSERFGALLGDLARRFE
YVLIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIESVGAKVLGTVMNNARPARNGTYGGYTYSYGEAA
GS
>gnl|bykdb|A0A0A0IYK2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia flava TL1] (length=569 residues).
MTLQDYIKVFRHRWMVILVCALVAGAVTWFVTPASADTTKKVGSYAATATILVGSTDPENPNPNMGRIPLYMTTGEIPRR
AAAAVGYDGDPALLARGLTVTPDVVAAAITVSATASDGSRAAAVANAFATETVKFFRERSRPGAENVAVSILQAASPVPV
ANSDGGFVVPPGRGPRTAIATVLGLLAGLALALLLDRLDSRLRTRQEIHGALRMPIIAEIPRLRRSERHQGAIAVAEDPL
SNYSDGYRAARTALVHTTGQIMPGDYTPRRSAAGARPAAKGARLILVTSAHAAEGKTTSVANLAASFAETGQRVLVLDAD
LRSPDAHNVFDVPQGAGISDFLSDPSDDASLGSVVRPTSVPGVRIITAGTSLAHPASLASRLGSLLEEVRGMADVVLIDT
APLLEASDVFDILPMVDTLLLVVRSGRLTELAGNRVAELVGRFQVPVSGVILLGAPEKRADAYGYGYGENRQSKRKAKRA
RKRAQSRSARSAAEQETTFVDSRTPGASPVHSAESRDTSRNPEDAPDDLQLDVTPGGEVPTATDEAHAATRGEVGEERRR
SRRRSSSSA
>gnl|bykdb|A0A0A0JGH0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia sinensis KCTC 19936] (length=531 residues).
MTLQDYIRIIRQRWIVIVICAAVAGLVTWFLTPANASSVKDAPSYTATATVLVSAATADEQVSVDRVVLYAKTGAIPTAA
AKALEFEGDPAILASQVTITSDPSGAALTIAASDRDGAKAAETANAFAKQTVAFFAKPRPGVGRAVVTILQEATPIPDEI
GGGFVVPPSRPLRAALAALVGLLLGFALALVLQRVDSRLRTRDEVHAGLRLPIIAEVPRLKRSQKGERTITVAVDPLSPY
SDAYRAARTALMHTVSRQAPGEYMGRRAARPEPRPVVEGARLILVTSGNAAEGKTTTVANLAASFAETGQRVLVLDADLR
SPNTHTLFDVPQGAGISDYISDNEDTPLEALIRPTNVPAVRIITAGTRLTHPASLASRMGHLLAEVRELADVVIIDSAPL
LAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLGRFQVPISGVVLVGARGRRADGYGHSYGYGDTARPQRDSPSPK
MELDPRQQPSAPSVAVPQHASAPEVDRWSLPPRVDDPQDAAPSRRSRHSSH
>gnl|bykdb|A0A0A0JTY0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia subterranea KCTC 19937] (length=526 residues).
MTLQDYFKVFRHRWIIIVICALVAGAITWFITPASSDTTKKVGSYTATATMLVTAKASSAATAVAPNLDRVALYLKTGEV
PKRAAKKVGYEGDPAVLASGLTVVTDPAAQAITVAATASDGKQAAAVANAFANETINYIKEKPRAGVENARLEVLQTATP
IPTAGSDGGFVIPPGRGPRTAIATLLGVLVGLGLALLLDRLDSRLRTRSEIHNALQMPIIAEVPRLKRAQRSRASIAVAT
DPLSIYSDGYRAARTALVHTTGQVMPGDYTPRRAASEVPEKQAATGARLIVVTSAHAAEGKTTSVANLAASFAETGQRVL
VLDADLRSPDVHNVFDVPQGAGISDYLSDVSGDASLASLMRPTSVPGVRIMSAGSSLAHPAALASRMSHLLDEARGMADV
VLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVGRFQVPVSGVLIVGAPTKRADAYGYGYGDDRMSKR
KAKRARKGARSRQSGPVGPPTGHMGDFFDDAEQPESRRSRRTSSSA
>gnl|bykdb|A0A0A0JXF2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia aerolata DSM 18566] (length=547 residues).
MTLQDYIKVFRHRWIVIVLCAVIAAGVTWLVTPASADTTKKVGSYTATATILVGSTDPERTGNMGRIPLYMTTGEIPRRA
AAVVGYEGDPARLAAGLTVTPDNAAEALTVSATASDGEEAAAVANAFATETVKFFKETSPPGAENTTLTILQPATPIPST
ANDGGFVVPPGRGPRTAIATLLGLLVGMGLALLLDRLDSRLRSRSEIGDALSMPIIAEVPRLKRSQRNRNSIAVVEDPLN
LYSDAYRAARTALSHTAGQVMPSDYTPRRSTVEPRRSASSARLVLITSAHAAEGKTTSVANLAASFAETGQKVLVVDADL
RSPDVHNVFDVPQGAGISDYLSDPGGTSLETVVRPTSVPGVRIITAGTVLTHPASLASRMGGLLEEAREMADVVLIDTAP
LLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVGRFQVPVSGVILVGAKARRGDAYGYGYGETRKAKKKVKRERK
LAEKRGPVAPATPSTSSRPTTGPAEETRSRDAVGTADPTTTVDPVLGVDDDDVEPDSRRTRRRASSL
>gnl|bykdb|A0A0F0KYJ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=231 residues).
MRELRTNLVYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMIGTVFGLPKGAGISDVLAGC
ATIAEVAQRFGNGQLLVVAAGKVPPNPSEVLGSARMRELLKSIAREAIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGK
TTYEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYGYQYHGDYYRNDGQELPTGTVRGDNANIYAKSK
>gnl|bykdb|A0A0F0LP73 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=555 residues).
MTVLDFLVLIRRGWFFLALGLLFGALGGFVTAQLTPPVYTAQATGFIAGTGGAVIAGTNIAIDRAGAYMPLVDTAQVREE
IAKDAKVPLSKLNGSLSAQVVPGSTMVRVTANAPDPQSALRLANGALHALANVVARIEDAAGAGATPPPGSTVVPTEGIV
IVPLDQAVAPRTPSAPDKRAMIIAGALIGLGVGLLLVLLRRALDVRVRAHTDVAAIVGAGVLGRVPKFDPDGRSKKDAIA
RAVAHEAHRQIRTGLRFASVDQEVRVVMVTSANLGEGKSSTTRTLARVLAESGQRTLVIDGDLRRPTVAEGFDLDGTVGL
SEVLSGQMPIGPAIRQTSDPNLFVLPAGGIPPNPSEMLGSTAFQRLLGELRRDFFIVIDAPPVLPVTDASVMSAFVDGVV
FVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVAMRNSANGYGYYRKNSHYYAQTSRNDDAAGDDEVAALISEAELSP
AAFDGEPPAPEESGAEDEGASRERRASRSRTVSDDAASSRATHARPRIAQTGQRSTPVRARRAKDANDLDPDATA
>gnl|bykdb|A0A0G3V3F3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium IMCC26256] (length=475 residues).
MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNRAERVYEATALLAVTPSDTGLGINADQATFLAKSYALYAETPRVTAA
AAKSSGLDITANDAASLISASAVGDLGFLEVYAKGPSVSEAEQLSSAATVALIDAVRAQQTASLAQDIAPIQAQRVILQK
QLSNLPAFDPQAASIQANIDALNKVEAERRAQPANRVNVAASAHASSTPISPHPTRSAVVAFLLTCILVGELIVASRAIG
DRIGRTGDDDADVARITGLPVLGRIPKGEGFETVEAFRVLRTNLMVLEAAGRPRTVAVVSNTQDAGKSFISINLAQSASA
LDDKVVLIDADLRRPTIHEQLSVPRTPGLTSVLLGSDLSEALRKVAESPFLRVLSSGPPVEDPSAILGARAFRVVLDTLR
AVRLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQRAGANVVGVVVNRTEVVNRSAYYEA
>gnl|bykdb|A0A0G3V3M7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium IMCC26256] (length=635 residues).
MRPADYLRIVRRRWWVLLVTVVIAMTFALLTRPSSAATAKASRPGVSFRATTTLISSGSANTSVNGRDYDRLALLMITGE
VPKRVAEAIDEVRWPQIQNANANKCTETGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPDPATGSLAITAQVGD
AELAAKVANLFAAKLVGYVDELGQKQYDEQIFGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRREAVLRKLANAD
SDLSNLQEIGPQTSGLTTLEAATKGRATIIVSRAQGSTSESQRLLFGAAIGFIVGLGILLLLEILSARIRDVPGTEGAAR
MPVIAEIPVMNLDRSLRFQVTTAVDPTSLMAEAYRSFRTSLVAMWQRHPTNNRPVLAGASEPEATPLRVLLVTSPGPAEG
KSISVVNIAAAFAETGISVLLIDGDFRRPQMYKYFSGATTPNLTDIPHQGTAADVLAVAQETGIPNIRFIASAPTRTDPG
TAIEMVKVAARLGRDIADLVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLRRLEATTVGVVLVGAE
HGARAGYYGYYGYYGYGYGYAHPGEVPKMSRLFPWRKPTNGAGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF
>gnl|bykdb|A0A0J6YE86 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium chlorophenolicum] (length=408 residues).
MSADELQARITATAKPDTVLIDVAVLDESAVRARDIANTLSDEFVGRVRELETPENSTRADSRVVVEQRASIPSSPVVPK
RARNIAVGLVLGLVLGVGFALIRDLLDNTVKDRTTLEQIANVGLVGTVPLDKERRRHAAIAFENDNSVIAEAFRKLRTNL
QFLSVDNPPRVIVITSSMPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPTLSKYLDLMSKVGFSTVLSGAVSIDDSLQ
KTRFPGLSVLTSGAVPPNPSELLGSQSARKVLAELRSRFDYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLA
HAVGSLESVGAPLLGAVFTMVPTRGTGSYSYNYGYYGEDEGRRGGNSSTRGGSAESSKTTSANASESRDRSAGDLPARPV
TQRRYKTT
>gnl|bykdb|A0A0K2RXS2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYSKDGDK
KSSKKSSTKK
>gnl|bykdb|A0A0K8Q3D9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Hiyo6] (length=233 residues).
MVTSSMQAEGKSTVTANLAVTMAAAGENVVVVDGDLRRPTLTDVFNLVPGAGVTDVLSGTADLDDVLQPWGALPNLSVLG
SGRIPPNPSELLGSRAMKNMLQALAQNATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQKVRGR
VLGAVLNYVPTKGTDAYAYHGTYTSAVAPSVLGEDADLLQRDSDASGSWVGENYEVDHAMIEEYVPPRRRVKS
>gnl|bykdb|A0A0Q5AWK6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. Leaf294] (length=493 residues).
MTVVDFIAFIRRNWKALVVAVLVGVTAMAAFSFVTPKVYESSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA
VYERIQSDPEANPGGEALNGRLTASVAPGSTLIQVTAEASTPENAAALANGALAALAAVIADIETQSTADRTPQITVVPL
ENAEPASTPTSPNWLRNLLLGAAGGLVLGFVVAFLRRALDIRVRTVDQLTELFGVGVLGRIPKAGRRAGRKGETVDRITA
EAYRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKMLGIDGAVGLSEVLS
HQIPVEDAIRPTGTEGLFALPSGHIPPNPSEMLGSAAMRTLVERLSKDYFVIIDAPPILPVTDASIVATVVDGVVFVVAS
NRTRRPEVTAARRILAQVRGRVLGTVLNMVTAQDGDTGYYYYDRKNSYYTQPQQAATENAAVGRSARRSPRTQALEPVES
RAERPTASRRTLR
>gnl|bykdb|A0A0Q5JKD6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf151] (length=544 residues).
MVRVVRAYWKAIVALIVVGGLAGLGWSSLQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVAET
ARGELGLSDSPESLVQRVRVSNPIETVNVRVDATGPTPESARDLAEAWIRGMTEEVDQLETGGGGQSAVRLVAGDSARLP
TAPSSPNVRLDVTLGALAGGVAGLIFAFVRRAFDRRVRSAHDITDAVDASVVGVLPVDKELAGGRAVFSFDDIKDGRGSF
AHKEAMRELRTNLQYVDVDRPARVLVVTSPLPGDGKSTIAANLAVSIAATGQSVVLIDADMRRPVVGGMFGFSDDVGLSD
VLAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQSLARKLADDMVVIIDSPPTLAVADAAVIASWADGAVL
VVTAGRTTDDMLTRATDNIAKTRGHLLGVVLNRMPLRGADSGYYGSQYGGYYGYGVPSSSPNGRWRLGLRRRGKKAEVVD
AEQEATPRRRSGGLPPENVSGLRTLSQRRMSATAEGEATSEIAVASTAEPDTVDTMSRRRARRG
>gnl|bykdb|A0A0Q5L115 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf164] (length=586 residues).
MDRPDTEPRPRTLDLQDYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQTRVYESSASGVVQVAAGGDANLAFAADQLAKSQ
AQSYVELGGSLAVAESAAAALGGAASPASLLGRVTTSLPEDTAIITVTSRGSTPADAAALTDAWLAAMGEQIAAMQEEST
DTGGSATSFVALSSASVPTSPASPNVEVALLLGGLSGLMLAGVYLLVRNTLDRRIRSAAEVESRFGVGVIGTIPQNDALA
EHGGLVAALPNATADDRHVNFAMSEALRELRTNLAYVKVDAQPRVIVMTSPQPGDGKSTLAANLAESLAVSSDQRVVVID
CDLRRPTLSKVLGVSEGAGLTDVLSGRAQLHQVMQQTEAASNLWVVGAGRIPPNPSELLGSQTFQDLVSTLAEHATVILD
APPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVTRGGGDVLGVVLNRVPTKGRDAREYGYFGGSYYYYEGDV
GTGGAVGAGAGSGTAPASREAVTAPAPVVAPTPPAAPTPAPVPAPAGAAAAAAAAAAPGGEPAPARVPASPASPAAPTSP
AVPASPVEAPGGALTRREIRERERTR
>gnl|bykdb|A0A0Q5M6Z7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. Leaf336] (length=495 residues).
MRDFVQLLRRYWVGELAIVMLTVGLVAALTAVQPRVYESTASGLTQAATGESLSMAFAGESLAKSRAESYVRVANSDAVA
DRARKILGTDRSIGDLLGHIQASLPADTAVIEITARASTPDGAAKLANAWIAGLTKQVRALEAPEGAIAEPAISFVALAS
ARPPYFPSSPNVQTALVLAILAGIALAVVYGLLRQHFDRRIRSVEQIERLLGAPVIGTIPASPALEDRRRVTDSDSGDDA
VELFTISESLRELRTNLSYIDVDQPPKVIVVTSSIPGEGKSTLTANLADAIASANSNVVVIDCDLRRPMQSTLFSLRSGV
GLTDVLSGRVDLNDALQAPSDSPHLRVLGAGRVPPNPSELLGSRTMRELVSALADVAIVILDAPPLLSVTDAAIMGTIAD
GVVITVGAKQVTGEQLEKAYRSVVRVNGKVLGVVLNKIPPRGIDSHDYGYYRSNYYTSNADESGEAQPVASIEAGGDTSV
DGQANEQRSRRASRS
>gnl|bykdb|A0A0Q5Q5L3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf179] (length=540 residues).
MRILRAYWKAIVVMTVLGGLAGLGWSATQARVYSADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVADTA
RQQLGLSDSPEALVERIRVSNPVDTVNVRVDATGATPESARDLAEAWIRAMTTQVDELESGGSGQGAVRLVAGDSARLPT
SPSSPNVRLDVMIGALLGLVAGVVFALVRRTFDRRLRSASDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFA
HKEAMRELRTNLQYVDVDRPARIMVVTSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDV
LAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVADAAVIASWADGTVLV
VTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQYGGYYGYGIGRTEKSTWWRRVLRKSSTEPGAAEE
HGKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPRRRRTTP
>gnl|bykdb|A0A0Q6DVM4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf436] (length=540 residues).
MRILRAYWKAIVVMTVLGGLAGLGWSATQARVYSADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSVADTA
RQQLGLSDSPEALVERIRVSNPVDTVNVRVDATGATPESARDLAEAWIRAMTTQVDELESGGSGQGAVRLVAGDSARLPT
SPSSPNVRLDVMIGALLGLVAGVVFALVRRTFDRRLRSASDITDAVDASVVGVLPVDKELAAGRAVFSFDDIRDGRGSFA
HKEAMRELRTNLQYVDVDRPARIMVVTSPLPGDGKSTTAANLAVSIAATGQSVILVDADLRRPVLGGMFGFSDDVGLSDV
LAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSKRMQALSRKLAEDLVVIVDSPPTLAVADAAVIASWADGTVLV
VTAGRTTDDMLTRATANIAKTRGHLLGVVLNRAPLRGADSGYYGMQYGGYYGYGIGRTEKSTWWRRVLRKSSTEPGAAEE
HGKRRTSADLPAENVSALRPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPRRRRTTP
>gnl|bykdb|A0A0Q6VV12 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root122] (length=485 residues).
MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVLYSATSSGLVVVGNATTAGEEQGNAALAEEKAGLYAFLVSSMP
VAEKVVDDLGLDVPPSEIAGRFSATVNADVNALTITAIGSTPEQARDLANGVVDAVVEYAQEVDTGESNPRRDPLTRVVP
VQPAELPQAPFTPDYAKAAMKGAAGGLALAYAFLIARRLIDRRIRSVKHVEDATGAAVLGIIPKEDALGRTHRGVRGDLG
RAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQ
ALAGDVDVRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYSGYGGYGGYRAEEATREAYSTAGKGRRRKLVRS
SSDKA
>gnl|bykdb|A0A0Q7KBQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root472D3] (length=472 residues).
MRSRWVFSVSTFVVGAVATILLVLSMSPVYGSSAKLFITSPVGQQVTDPTAAYFASQRLASYADLAREPSLLQDVINRLN
LTGVTREELAGQVTAQIIATTQTLQVDVTADSAELAQQIAEAEAEGIVSLVARLEKPTSGNGSPAFVARIVGPPSISQTP
VAPNVPLNIAVGLLLSLFVAIAGAVLRDLLDRTVKTRQEAEELSGGAVLATLPFDRQLKKQALTSEGHGALAEAFRVLRT
NLQFANLDAKVESILVSSAVPNEGKTLVATNLAMSMAQSGRSVLLIDADMRNPNVADLLGLENSVGLMTVLIGRTSLDEA
TQVHDSGISFLGTGPKPPNPAEVLDTQAMRDLLHGLRSEYDVVVIDAPPMLPVADASILMREVDGALMLVRHGSTTREQL
RLAVARIETVGGKLFGTILNRTPRRAGDVYGYGYGYGYGQEQHEPIGEQARRMVGALGRGESRSSSGRRVSR
>gnl|bykdb|A0A0Q7QDF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root495] (length=452 residues).
MTSRSGWTAVARRWPLVVLLGALGLGAAALVLSGQTTRYDGSAEVLIQPTSPATSLSGRAVESYAHVLGGTALEQRAVKA
LGLEDAGDAEVRGEVVGNSSVVRVVVRTTDPERAAQLAGQVAEELVSWIASYQDRAAERAGEDAPDLPTLSPIVIQEGTA
SSQPVEPDARRTYVLFGLAGLLLGLLLAALRNLATATVTSSDALTEQVKAPVIGAVAQDRHVADHPLISTLSNQHPRAEA
MRIIRTNLQFLDVDRVSNVYVVTSSVAGEGKTTTASNLAISLAQSGQNVVLVDGDLRRPRLHEVFGAEQNVGLTSVLVGK
VPLDSAVQGTDVPGLDVLTSGTRPPNPSEIIQTAAMETVLIELGRRYDIVLVDAPPLLPVADAALLSVISDGAILVVRHG
RTGHDQVRAASERITTVGGRLLGTIISMSPKKETARYGYGYGYDDGKGRRRR
>gnl|bykdb|A0A0Q9L0H3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Knoellia sp. Soil729] (length=519 residues).
MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYTATATLLVGSNDPETGSTNLGRIALYMTSGEVPKR
AAARVDFTGDPALLASGLTVTPDTVAQALTVSATASDGKQAAAVANAFATETVKFIEERKRPGAETTTLSLLQPATPIPS
AATDGGFVIPPGRGPRTAIATLLGLLVGLGLALLLDRLDSRLRTRGEIASALRMPIIAEIPRLKRSQRNSASIAVASDPL
SNYSDGYRAARTALVHTSGQIMPGDYTPRRPGGEESRSRQGGRLVLITSAHAAEGKTTSVANLAASFAETGQTVLVLDAD
LRSPDIHTAFDVPQGAGISDYLSDPSDGAALDAVVRPTSVPNVRIITAGTSLAHPAALASRMGQMLEQARDLADVILIDS
APLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVGRFQVPVSGVIIVGAQTMRADAYGYGYGENRQSKKKARRG
RKRQQLRAAEPVADELHPPTTGDERPRESRHDRRTSSSL
>gnl|bykdb|A0A0Q9LZR0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Phycicoccus sp. Soil748] (length=477 residues).
MELTDYLRVARTYWRGLVAFMLLGVAVAGGLSLVTPKVYQADASGFVSAGASSNPGEASVGDSLAKSRATSYVDLAKSRA
TAQDVINTLGLGAQPAGLIGSITVTQPVDTVLLKISARAATPRGAQQLADAWVAALARQVQAVENPTGKAAQALRVVPIE
SAALPASPVSPNTRRNLALGFVLGLMLGLGYALLRSQLDRRVREPEVVERDFGVTVAGAIPETSALVRKKGGLVPLVVAG
TSKEKDPVHSAESFLKLRTNLQFMDIDNPPRIIVITSPLPGDGKSTVAMNLAAALSMSDRRVVLIDGDLRRPVVAESFGL
IEGLGLTDVLIGSVEFEEVVQQVGGLPNLSVLAAGRVPPNPSEMLGSKAMRRLLEGLGETYTVIVDAPPLLPVTDAAVLT
ASADGALVVVSAGHTLDTQLRDALANLATVNGHTLGVVLNRVSPKSSSAGYYSGNYGPLQETPQRAVRSEAGTAATR
>gnl|bykdb|A0A0Q9QB08 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Soil774] (length=502 residues).
MTFGDFVRLSRAYVWVLIGCTVLGAALMVAKTTQDPVLYSATANGLVKVGEAGSAAEEQGNASLAEDKANLYAFLVPTTP
VAEQVVKELGLDMPPSAIASRFSATVNSDVNAITISAVGTTPEEARDLANAVVDAVVVVAQQYETGEENPRGPSLTRIIP
VTPAELPGAPFTPDYRAAAIKGALGGLALAYAFLIARRLIDRRVRSAKHVEDATGAAVLGVIPKEDALGRVNRGVRGDLG
RAAEAFRVLRTNLRFVDVDNEPRRIVVTSALAGEGKSTVSSNVARLVAQAGTPVLLIDADLRRPMIATTFEIDGAVGLTQ
ALAGDVDVRDVIVESGVANLSLLPAGRIPPNPSELLGSLRMKQFIDDLSADHLVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGKTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGAASIAYGGGYGTYGGYGGYEADDTSREADATAGGGRRRKHPKK
AAKNAAKKDAEAEAQTEADAGV
>gnl|bykdb|A0A0Q9TBP0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Soil805] (length=565 residues).
MALLVLLAAVAVSCAYSLAATPLYIATADVLIEPSGADISASSGTKIDADEVATQVQVVTSLPVSRLVQERFSLASPPDL
SELVSVQAVGTSRILRVTAQDSSPDRAARTANIVATSYLQFREQDSVGRYEQARDRLAQEQADIESRLSEVNALLEKNPG
GQALQGERRTLIASSAQVAAQIDALTDSLTTAAAGGELLHSAEPADNPVSPQIVLNLILGALVGLVLGVGAALLRDRLDD
VVHDEEAVRQALDAVVLARVPQWSERSHRDRLVTLVDPHSPASEEYQRLGVNVRFMVATGAQESAPIVLLTSGQESEGKT
VTSCNLAVSAARLGLNVVLIDADFRRASVAPRFGLGDPPGLSDLLVSEEDPSSYLIDIGVDNLTLLPAGTLPPNPAALLA
SGQMHLVLEELAAKADMIVVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLRQVSVESVGIVYNGVGDS
ARATYSYTSRERAVTGTDAAPDSAPTRAGKDQAGDPVPSAGTPPPSGDTHHGSAPTGHRDTPPVAPAGHGDSRKTAVAEP
GDDVA
>gnl|bykdb|A0A0W8I9Y2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria polaris] (length=366 residues).
MGLLYAFARFKMDRRIKSVEEIRDGFGVAVLGVIPTDDRLADHREIVETGFSAGRGHHEFSEALRELRTNLSFVSVDSPP
KMIVVTSALPGEGKSSITANLAVAIASTGRNVVVVDGDLRRPVITDLFGLVPGVGVTDVLTGQVQVDEVLQTYDKFPNLQ
VLGAGRTAPNPTELLSSKAMHAMLETLAEDALVLVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQV
HGNVLGVVLNRVPTTGADAGYYGYYGKSYYANSDDQPAPKTGAQPVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPT
VPSAEDAAPAPRAERSNGQGSAEHESFGLEAWGRSGSSTGSTAQGH
>gnl|bykdb|A0A101KZQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. EpRS66] (length=410 residues).
MAKSRSVALDVQENLGIDTSINQLLSSISIANPVDTATLKVSAESNTPESAQQLAEAWVKAIENQVSEVENSSATKSSSA
SIVTFRSFDAAELPTSPSSPNFKIAIAVGLLVGLFMAFAYAMLRHAFDRRISSIESVESSTGHSVIGTIPQTDTLDREQR
LITSIGGNDRNEEHAGEYAVAESIRELRTNLQFMNIDNPPRTIVITSALPGEGKSTVAANLAITIAASDQKVVLIDGDLR
RPTIAKTFGLLEGVGLTDVLIGNADIDDVMQPWGESGNLVVLGAGKIPPNPSELLGSNTFQNLIQSLAQEAIVLIDAPPL
LPVTDAAILTARTDGALVVSRVRKTTYDELESALNNLQRVNAHALGLILNGVPLKGAQASNYGYAYKAYYRQDTKGRRSA
VANPVANDEA
>gnl|bykdb|A0A151BT98 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius sp. NY16-3462-2] (length=457 residues).
MTIRDFLRIMRQRWRWLLGTLLVVLAVAAVSTLMQPKTYEASARFYLAGSNGQGTPVQRDDLATYAQVVSAPAVQKVIRQ
QAKLGPSVPVTVSATLSDTANIMTATASSGSAQEAAAIANATGPALAAVAPQFSQLLSGAGSVTSTAVQPAEVPASPASP
DLKKALELALAVGLLLGVAMALLRHFMDNRVRTVEDLETLVQRPVLSIVPRVGGGHRVVDTSDHPSGAMVEAMRRLRTNV
KFVNVTNDVPAVVVTSARPGDGKTTVAANLALAMARDGYRTVLVDGDLRKPGVGSAIGIDGSVGLTNVLVHEVGLKDVLV
EPEPSLPLFVLPAGPVPPNASELLGSSAMQGLFQELVAEFDFVVFDSPPMLPVVDALELEKLTGNLILVARGGQVSRREL
QITLKALETVDANLSGTVLNYADHFSDDYGYGSKYGYGEQEMAASGRTRSRRSDKRG
>gnl|bykdb|A0A1C2B334 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardia farcinica] (length=262 residues).
MGVVDSPVIGLVPGDSALDGEGFVDFGAGGSVIAESYRRIRTNLAFAAVDPASRRILVTSASVAEGKTTTAINVAASLAE
YGHRVVLVDADLRRPTVAKRLSLNNSIGLTDFLIGQGDLPDLLQQGGLDRLDVLATGQLPPNPAELLGSSRARELFDTLA
ASYDYVIVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDASDRAGAYHNTYYGDT
DTPRMASQRSRSHDIAQVGLRR
>gnl|bykdb|A0A1C6T1J1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora nigra] (length=486 residues).
MDLYRQLRLVRRHWWIVLVTLMVALGTTALVTIRSEPRYVASVTFFVTTPSEGVAAAYQGGLFLQQRIKSYADLLVSDRL
AQSVVAEGQVGLTAEQIQGRVSTSTETGTVLLRASVTDTDQTRALKLTELLSAKFVDLVQKVETPPSGEPGPIKIEIVSG
PRVSASPVSPQPLRNFTIGGLLGLVAGVALAVLRGMADVRLRDAAGLQRVTGSPLLGEIPLDTAARTAPLIVGEAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLGLRESADIVIIDTAPLLAVTDGVVVAVQSDGALLVS
QQGRTSRTQVAAAARALHAVSVRLLGCVLNMAKVPKADAYQYEAYRVVAGLGTPSVPADRATSGRHAEHAAAGVSDRTQE
LTRLPR
>gnl|bykdb|A0A1E2SNF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia xyli subsp. xyli] (length=250 residues).
MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLREVLQDPDVSLHTHIRVLTAGR
TPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTG
VVLNRVPRRGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPA
NRGRRAARHG
>gnl|bykdb|A0A1E4BP96 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. SCN 70-18] (length=429 residues).
MYTASASGYVSGASLAAETGSPLVGDQLARSKVTSYLDIGSWRAVAEHAIEDLGLSASPESLVGNVTVSNPLDTVVIHVA
ATAATPESARDLAEAWIRGMTAAIDDIEGTGVAGSAPVTLIPGDSARLPTAPSSPNTTLNLALGGLVGLALGIAYAVMRS
VLDSRIREPQDVERNTGASVVGVLPLDHDLDNRREVLSFTGASGNVVRGALTEAIRELRTNLQFMDVDDPPRSIVVTSPL
PGDGKSTTAANLAMSLAAAGQRVVLIDGDLRQPVVASLFDLPEGAGLTDILAGRATTGDVVQPVQGSQNLYILASGRVPP
NPSEVLGSRRMRDLVTSLTEHALVIVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVL
NKATRRGRPDYGYAYGSGAADTRPAFVPR
>gnl|bykdb|A0A1E8S156 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC065B04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1E8S5S2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069C10] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1E8TRD6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC065C12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTSNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYSKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9DXX2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069C03] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVNAKASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDNAV
VSPTGGNTVRVIPLNNASVNPPLVAPNYKQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPISDD
LNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9G8X4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC062H08] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9IAW2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC075F09] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9M791 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069D01] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSED
LNEENIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTD
ASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9ZBC9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC071B01] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1E9ZDP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC078H08] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F0DAA9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC061C12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRSSLTATAGDNAALITVNAKASSPKNAQVLANSALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVKGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0KX60 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC066H02] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENAA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLALARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNAKLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0PHK9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC076D04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRSSLTATAGDNAALITVNAKASSPKNAQVLANSALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVKGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0R6B5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC066G07] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F0THV9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC036D11] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A1F0VZG6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC071C12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSLSTGQIRSSLTATAGDNAALITVNAKASSPKNAQVLANSALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVKGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASILKKVNANLFGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1F0XT88 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC072B04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTSNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYSKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F0Z7N5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC068E02] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1D897 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC066G02] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1EVP5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC073B08] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPELSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTSNTVRVIPLNNASVNPPLVAPNYQQNVLVGAAAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYSKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1FV74 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC069C04] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSSAAKERARSYAAIVSSEAV
AQKIKQNNPDLSLTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSED
LNEENIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTD
ASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1F1IHY9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HMSC067E09] (length=482 residues).
MSLSKAMSMLQRHWMILVAAPLIGVLLAGLWVLTQNPRYASTANALVVVGNSESLGVALTADNLAKSKAQQYALLGESRA
VSDKAVEELPFDLSSGEALRNVEVASTSGSAQIVVRAEDSSPERAQQLASAWLGALEAQATEVEAGGIAGQSIISLETLS
DASLPSAPSSPNLPLALSIGGALGLLAGLGVAVVRHVLDNKIRSAAALESRFGLTILGTVPESTRSARNRRRRDGGDVIN
LAGRVDGETSPKQHQDSFRLTESFKELRTNLQFLRPDEAVSIVTVTSAHPGEGKSTVAANLAVPVAESGQRVVLVDGDLR
RPVVAENFGLISTVGLTDVVLGRVELADALQTVGNRPSLQVLASGPIPPNPSEILASDRFNDLINALAEDALVIIDAPPL
LPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIRKIDGEVLGAVLNRVPASGTAASAYQYYGATYYTASQQQDVAG
RS
>gnl|bykdb|A0A1F1J417 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC067H10] (length=502 residues).
MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A1F1QKB0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC08A08] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSNLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNNTATPAPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVRASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A1F1X071 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. HMSC06H03] (length=536 residues).
MTIEDFLRLLLRNLLLLVAGLVLGAATGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMEFQYSKAQSYLPL
FNTRAVGQRIVDELGLEASPDEVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEATAAEARELETGGNENAAVGV
QLTNYQNAVVPGAPVSPDREKFLLAGAAFGLLVALGLAWLRDRNDSRLRTADDVTDVVGLPTLGALPDAKELARGKDGVL
PEPTSFPSREALRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYGALGGYDESAVVPDAE
EVDVEQAGGPAEPGPASAPAEPGPVVEPDGHEPEGDSAAAARTSPRGRRAASTWGR
>gnl|bykdb|A0A1G6GTN3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium enclense] (length=546 residues).
MQRVVRILRAYWKAIVALIATGALAGLGWSSLQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSV
AETARQDLGLSDPAESLVQRIRVSNPVDTVNVRVEATGPTPESARDLAEAWIRGMTVEVDQLETGAGGRSAVRLVAGDSA
RLPTAPSSPNVRLDVTLGALAGGVAGIIFALVRRAFDRRVRSTHDITDAVDASVVGVLPVDKELASGRAVFSFDDIKDGR
GSFAHKEAMRELRTNLQYVDVDRPARIVVVTSPLSGDGKSTTAANLAVSIAATGQSVVLIDADLRRPVLGGMFGFSDDVG
LSDVLAGRAQIEQVARQVDQNGRLFVVAAGRTPPNPSEMVGSQRMQALARKLADDMVVIVDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLTRATENIAKTRGHLLGVVLNRMPVRGVDSGYYGAQYGGYYGYGAERSSTKAWWRFRRRGQTTPVA
AAEDREAGSRTQPADPPPENVSGLRTLAPVTTPAVPGGEVTDEITVPATSGETAAGTLPRRRTRRG
>gnl|bykdb|A0A1H4I042 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. 283mftsu] (length=407 residues).
MDTYQGNLLSQERVRSYTILLTGEALAQRTIDALHLDMSARALRQEVSARSKMGTVLIDVDVLDPSPVRARDIANTLSDQ
FVKMVRELETPGDGSLPDTRVVVEQPAAIASSPAVPNLMRNLALGLFAGILFGVACALGREMIDNTVKKHEDLESITGVA
VVGDIPMDKARRGTPAISFGTENSQIAESFRKLRTNLSFLSVDNPPRVIVVTSSIPNEGKSTTAVNIALALVEVENNVLL
VDGDMRRSIAHKHLNVDGAVGLSTVLSGAVSLSDALQETQFSGLTVLAAGATPPNPSELLASHAAKNLLEELRGKFDYVI
VDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQNVGAALLGSVFVMTPPRSRSAYGGAYYYYGDNRGSN
SRHSRKT
>gnl|bykdb|A0A1H4LCS9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides exalbidus] (length=483 residues).
MTFGDFVRLSRAYVWLLIGCTILGALLMVAKTTQDPVLYAANASGFVKVGNATTAGEEQNNAQLAEDKANLYAFLVSKLP
VAQLVVDDLGLDVPPEAIAGNFSASVDTTVNALTVTATASTPQDAQDLANAVIKAVVVYAAQVDNGGTTPKGDSLATIVP
LEEAQLPGAPFTPNYQKAAMYGAAGGLGLCYAFLVGRRLIDRRIRSAKHVEEATGASVLGIIPKEDALGRGHRGVRGDLG
RAAESFRQLRTNLRFVDVDNEPRRIVVTSALAGEGKSTVSSNIGRLVAQAGTPVLLIDADLRRPQIASTFEIDGAVGLTQ
ALAGDVDIRDVIVDSGLTNLSVLPAGRIPPNPSELLGSLRMKQFIEDLSHDYFVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGKTQIEQSQHCRRILDQVGGRLLGVVLNKAPIKGAAAIAYGGGYGGYGGYGGYKSEYASREAYSTAGKGRRKLLKVG
KKD
>gnl|bykdb|A0A1H6WL79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. yr096] (length=573 residues).
MERTTQLLQDDKPQGMSGNDLLSVVRSHWLGILVITVLMTGGSLGWYALQPKVYAAESSGIVVAAGAENLGLSLAGDSLA
KSKAKGYQSVGESILVAESVIRTLGLKESAPDITRSISVSVPLDSVEIRITARSSDAQTAQNVADAWVAALASQVYELDK
GNASPGTEPVTKIVPLAKATLPSAPVSPLLTATIGIGLAGGLLVGLGYALARNHFDRRIRAASEIERLFGLAVVGTLPLD
KRLSEKSSVLESTSVVHRVPGGHAMAEALRELRTNLNFIDVDNPPRILLITSSLPSEGKSTVTSNLAATIAAAGRDVIVV
DADLRRPTVHQVFDVLPDVGVTDILSGRASIDDVLQEWGPNPRLRILTAGRIPPNPSELLGSRAMEHLLKDLAQRAIVLI
DAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALSNLTRVQGRVLGVILNCVATKGQGDLNYGYYGAYVSADESR
DTIPPRSGMNPTSQPGHAGVSVDGNGFEAHSPWQGPAKAAEITSQAMLSGLGHAIAGPSNSLTNSSDTPSFLAPESQWRS
PSDGRGRRSAPPS
>gnl|bykdb|A0A1H6YPK1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Lysinimicrobium mangrovi] (length=560 residues).
MEFRDYLDVLRSRWLSIAVCTLVVGAVAYLWSDMQPRVYSTSAEALVTPAGSLDEVGDAATVESRMAVYTRLATSDQVAA
VVAESIGGDADALRSRISVSGSTETAIMLFTGTGSAPESAQELVNAWMDATFLVVSDVERTSRGISNPERTVINVMVLQQ
ARLPSVPASPAIKQNTAVGLMLGLALGVAYAFVRATLDRRLRSRNDVEIQFGVPVVGTVPWDGAIAKKGPLGAVPGFAFT
EAMRQLRTNLQFMNVDHPPRVLVVTSPVPGDGKSTMAVMLAAAIAESGRDVVLVDADLRRPTLAKALGVSPEAGLTSVLA
SQASIEEVTQQVGDSGRFSVVTAGVIPPNPSELVGSDTMRSLLYSFPEDTMVIVDSPPLVPVSDAAVLAARTDGALVVAR
AGATSADMLEEALRILDRVQGRALGVILDGVAPVGPRVKHYGYGNTSPGLSSLGGAPAQHDEDDSWEHDEALRKVFPEDV
LHRADDVPVLAERDDELVFGQAPEGAEKGPGGHESIDETHSEERPPGEISFGHSVDAVEVAVSGRSAVRDTMHLRRLFRT
>gnl|bykdb|A0A1H7N9P7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Blastococcus sp. DSM 46786] (length=481 residues).
MSLSVFLGLIRRRSSWLVAGVVLAVAVAGVGSLTATRLYTAEARLFFTLEYGDSAGDLAQGSNYLQSQVASFALLAETPT
VLGPAGEAPDVAAGSRSLAAQVSASVVPETVVVQISATDPSPARAAAIANAVAAELELAVEGLSPAGEDGSPAVRATTVA
PAGVPGAPVSPRTSLNLAVGVLAGLLLGCGLALARDRLDTRVRDAAVVAQLTGLPVVGSIPTRPSGSTAHPAVDADPHGV
VAEAVRQFRTNLQFLGMQDEERAGARIVAVTSSRSGEGKSTVAVELAAALAETGTRVLLVDADLRRPTIADRLGLEAAAG
LTTALLGRASVADLVQEWGTAGLHVLPSGPVPPNPSGLLGSPVMRRLLERLRDDYDHVVLDTAPVLPVSDAAVLSRSVDG
LVVLADVTRVRRAQLSQSLHSLAQVQATVLGVVLNQVRREAEVYGYAADVVAGTDRPVPTAPAPLPAARSAEAADRPASR
R
>gnl|bykdb|A0A1I0W453 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides alpinus] (length=518 residues).
MVGGGAPPRLAGMTFGDFVRLSRAYVWVLIGCTILGAALMLAKTTRDPVLYSATSSGLVRVGNAATAGEEQGNAQLAEDK
ANLYAFLVSKTPVAAQVVEDLDLDVPPEAIAGRFSASVDADVNALTVTAIGTTPEEARDLANAVVDAVVVVAQEIETGEE
NPKEPALTRIIPLEEAQLPGAPFTPNYESAAMKGALGGLGLAYAFLIGRRLIDRRIRTTKHVEEATGASVLGIIPKEDSL
GRSHRGVRGDLGKAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSSNIARLVAQAGTPVLLIDADLRRPMIAT
TFEVDGAVGLTQALAGDVEIRDVIIDSGMPNLSLLPAGRIPPNPSELLGSLRMKQFIDDLAHDYLVILDAPPLLPVTDAG
LLSAFCDGALLVQAAGKTQIEQSQSCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYGGYGGYGGYRAEYTSREAYST
AGKGRRRKEAKAKAAKVDKVEKVDTAEKPSASEKAGTS
>gnl|bykdb|A0A1I6GVG4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cl127] (length=274 residues).
KPVVGTIPEEKSFTADNRLLPFDGGTSRSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLA
VTLASSGQPVVLIDGDLRRPMVDTVFGLPKGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMREL
LKSIAREAIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYG
YQYHGDYYRSDEQELPSGTVRGDSPRRRGESEAA
>gnl|bykdb|A0A1I6IST1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cl127] (length=283 residues).
KPVVGTIPEEKSFTADNRLLPFDGGTSRSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLA
VTLASSGQPVVLIDGDLRRPMVDTVFGLPKGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMREL
LKSIAREAIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYG
YQYHGDYYRSDEQELPSGTVRGDSLAPTRPRMPRRASKTRVGS
>gnl|bykdb|A0A1L2ZMQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Neomicrococcus aestuarii] (length=555 residues).
MPIDEDQRQGEGLRILMAVVRRFWPVLLIATLVGALCGFGWAALQPKMYQSTSSGLIVTPKSSTVGEAIAGNSLAQDRAG
SYAVMASSQRTAERAVEKLEKQGVADVPDAGSLISSITAAVLEGSTELRVTASASDPVFAQQLANVWIDALAEEAHDIES
TGVDGVDKDFQPAVELMPMTEGTLPTSPYAPNVNQAVLIGAVVGLVLGLIWAAIKHLLDRRVRSVEAIQKVGMSAVGTLP
SDPRLSRGRQVLPVVYSAETRTDRSYHAYSEALRELRTNLAYMDVDNPPRVIVVTSSVPGEGKSSLSANLAVTIAHTGQK
VIVVDGDLRRPVVSEMFSLPGDAGLTDVLAGQAELDDVLQDFEPVPNLQVLAAGRIPPNPSELLASKTMGKLLEDLSERA
FVIIDAPPLLPVTDGAVLAKASDGALIVVKAGKPTIDELAKATENLDRVGANKLGVILNQVPTRGAEASRYGYYGKYYSK
KETKAKAAADLQEPSVTDNPPTEQIQTPASVASRSRHNEGTRGTSSQSMTVTKPAPDNFDEIVFRGTRAKRSDES
>gnl|bykdb|A0A1L2ZMV4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Neomicrococcus aestuarii] (length=499 residues).
MEYTAENQPQALNHQVRRLAHVVLNNWKGAIAIFLLAVLASVGLFLISPKTYAATNTVMVVAGGGNNLGSYLSAETLANT
KAETYLALGNAPEVSQLVSKHFAEEGQAVSWKGVTFTKDPSNSQIRVTATAENPEHARASADAFASALAEEAERVERVMA
TGGTDSTSSVPVVQIIPISSALLPSAPSAPVLRTNLMYGAIAGLILAALFVFIKHLFDVRIRSTEQVETTTGHPVLGTVP
QDKRLDHHRQVITVGEPGDKQGWATSEALRELRTNLTFSRVDNPPRIIVVTSALAGEGKSSIAANLAVTIAQSGSKVILI
DADLRRSVQTDIFQLQSGAGLTDLLSGAVDLDDVLQEWSGDPRLQVLGAGRVPPNPSELLGSRAMKRLLTDLAQESVVIV
DSPPLLPVTDASVLSTSADGVLVVARAGSTSIEALKKATDRLDRVNGHVLGVVLNQVPRKGSSAGQYGYYSDSYYYTSTD
GQRTRRQSGKRRAASSSSK
>gnl|bykdb|A0A1M3LEY6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcales bacterium 73-13] (length=337 residues).
MPQEPISPNTRLYLSLGLLIGLIVGLAVAILIEVLDTRIRGEANVRQITDAPILGGIAFDKLAPKRPLIVQSEPNSPRAE
AFRSLRTNLQFLDVEGGPRSFVVTSSVPSEGKSTTSANLAIVMAQSGARVLLIDGDLRSPSVADLFGIEGGVGLTDVLIG
RARLSDVTQAWGLRNLSLLPAGAMPPNPSELLGSQAMVNLLRHVEKEYDVVLIDGPPLLPVTDSALLSKQVRGALLIVAA
GRTHRGQVHGSVEALQNVGAHVAGVVLTMLPTRGPDAYGYGRYGYGAYGYGYGYGRTAQAGFSQIISPAESPGRRQSSAV
PPSGPARTTAQARQESV
>gnl|bykdb|A0A1M6K628 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus bendigoensis DSM 12906] (length=521 residues).
MAIARRKPRTGRDILDLVQLWALARRNWLTLLLATILGVAVGAGISYLQPTLYSATSVGYVVVGNSSTENAGARNPAAEK
AATYLPLAESRSVAETVAQELGVQSGEVSLDAKNDGVIFEITAQAPTAEGARLMADAGIRATSVAANELETMTVTGEPTD
QLVVKIAPVEPALTPSRPTSPNWARNLALGLALGLLCGFGAVVLRRSLDRRVRQADEVEELTSATALGVVPTAVELASGV
SLVNDSGTAAEALRQLRTNLRFVSVDTPVRSIVVTSPSQGEGKSTIAMQLAALLAESGEPTVLIDADLRRPRVAQLFGID
GAVGLTQVVAGSLTVADALVSTSQPNLSVLPAGRIPPNPSEIVGSKRMADLIAHLSETHLVIIDAAPLLPVADAGLVSAV
SDGVLLVVQHGKTLREQIALATRNLDNVDAALLGFVMNQVPKKDLGAAAFGYGYSGASPRYYYAEDDGRRRPAAEVSGAR
QGRGRSQSTPRPRRVAADDQRVEVVDASADAVVMEPASTQL
>gnl|bykdb|A0A1M7V0F8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus obscurus] (length=472 residues).
MTLSAFLGVLRRRSSWLLVSVLVGLTVAGAGSAAATRLYTAEASLFFALEYGDSAGDLAQGSNYLQSQVSSFALLAGTPT
VLGPAGERAGVSADARSLAGRVTATVVPETVVVRIAATDPSPARAAAIADAVADQLERTVEQLSPAGEDGSRAVRATTVA
SADVPTAPVSPRTSLNLAVGVLAGLLAGCAAALVRDLLDNRVRDAGVVAELTGVPVVGAIPARSPRSAPGAVVETDSHSV
AAEAFRHLRTNLQFVGVQDEDQGGARVLAVTSSRPGEGKSTVAVNLAAALAETGARVLLVDADLRRPAIADRLGLEAAAG
LTTVLLGRATVADLVQDWGTEGLHVLASGPVPPNPSELLGSPAMRRLLERLRDEYDHVVLDTAPVLPVADAAILSRSVDG
LLVLANATRVRRPQLTETLRSLAQVGGTVLGVVLNQVRRDEDVYGYAAEAQPPARVGELPAVPVPAGRIGQL
>gnl|bykdb|A0A1M8I0C2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=234 residues).
MAFKKEKKAKVSDFKRKLIVKNDPKSPVSEQYRTIRTNIQFSTVDNEIRTLMVTSSGPGEGKSTTVANLATVFAQQGNKV
LLVDADMRKPTVHYTFSITNTFGLTTVLTKQSNLDGAVTQIDTSNLYVLPCGPIPPNPSELLSSRAMDEFLEAALNVYDL
VIFDTPPVLVVTDAQLLANKCDGTVLVVSSGFTEKENAIKAKEQLTTSKAKLLGVILNNKKQDQSQYYYYYGGK
>gnl|bykdb|A0A1N1YAY7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=233 residues).
MAKLELSEKRQALVKKAEEYYNALRTNIQLSGDKLKVIAVSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFMSTEKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSEKFEVMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKTQLEQTGVPFLGVILNKFNIHLEKYGTYGTYGGYGNYGAYGKK
>gnl|bykdb|A0A1N5CK61 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=473 residues).
MTVLDFVRMVRVNAKYLLIGMLVGALLGFGYSLLQPKVYASSATGYVTVGESTGIGDVISGSSAAKDKASSYLALVSSGP
VADEIVKQNPNIGMSAEEIKGHLTASLEGDSALMKVQATASSPEAAQTLANTSLSATAKVVNDLEGSTTVRVVPLDDATL
PGAPSSPNTKLNVLAGALAGLVLVFAAIFLRKAIDVKVRTRDDVAKATKTGVLGTLPETEQLSEKNLLTNQDDHTSQEAI
RQLRTNLRFVNVDNPPKSVLVTSSEPGEGKSTVSTSLARSLAESGQPTILIDADLRRPTIGKKFNIDAKIGLTQVLAGQV
ELAEAVRQYEDSQLFLLPAGRIPPNPSELLGSDKMRQLVKELSSEFMVIVDVPPLLPVTDASLLSSAVDGVILVVTVGKT
RKEHLEEAANMLNKVGAALIGVVINRTPLKGLGNSYYGFGYAGSYGGYSSYYGEDASKNSKKKRGSKRAKRNK
>gnl|bykdb|A0A1N6CE53 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=228 residues).
MVKKKITLSPLYVHEKPKSTISEKFRGIRSNIMFSNAENEIGSLLVTSEKTASGKSTISANIAVTYAQAGYKTLIIDGDM
RKPTQHYIFDLPNNSGLSNLIINKATYSDSIKESNVDNLAILTAGPTPPNPSELITSSKFETIFNELLDHYDFIVIDTPP
VNTVTDAQVYAQTVKNCVLVIDAEKNNKIEVKKAKDLLNKSDGKLLGAVLNKMPVDKNSSYYYYYGED
>gnl|bykdb|A0A1N7DLV3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. RURRCA19A] (length=549 residues).
MQRVARILRAYWKAIVALTLAGGLAGLGWSALQPRVYTADASGYVASVSSDGSTSSALAGGTLALSRVKSFIDMGYWKSV
AETARDELGLTDSPESLVQRIRVSNPVDTVNVRVDATGPTPEAARDLAQAWLQGMTVQVDQLESTGGGHGAVKLVAGDSA
RLPTAPSSPNEKLAIAVGALAGAVAGVLFALVRRAFDRRVRSAHDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRDGR
GSFAHKEAMRELRTNLQYVDVDRPPRVMVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVLGATFGFSDDVG
LSDVLAGRARIEQVAHQVDENGRLFVVAAGRTPPNPSEMVGSQRMQQLARTLADDMVVIIDSPPTLAVADAAVIANWADG
AVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPLRGADSNYYGSQYGGYYGYGAPSSGVDRPRWWRRPWRRATVE
KKDAGEQAPGPRRRSAELPPSNVRGLRTLAPGRKGSPVPGDSGGEGVVPVAAPAADVPDDRTSRRRQRG
>gnl|bykdb|A0A1N7E3F1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbispora rosea] (length=466 residues).
MELLRYARLMRRYWPLLLLSVLAGVGTAHVVTVNTAPRYLASITMLVSADAGDGGLSTALQAGALSQQRVQSYAALLTSR
QVVGRIAGGEDVADVQARITANAIPETTLLRATVADSVPTRAAARANALGAAFARLIDQIERPTPKSPPTIRVTVVDDAE
VPEDPVAPQPLTNMALGVLIALFAAVTGLVLRDRLDTTIKTAETLRQVAKSSVLGLIGYERDARRHPLVLRDQGRSVRAE
AFRSLRTNLQFIGVDRQPKSLVVTSCLPGEGKSSTSVNLAITMAQAGWRVVLVDADLRRPSVPRYLGIEGGTGLTDVLIE
RARLHEVIQTWGQPGLSVLPSGRIPPNPSELLGSRVMRSVLAQLTEEYDMVIVDAPPLLPVTDAAALGAICDGALLVVRH
GKTRNEQVLRAGELLSSINARLVGTVLNFVPAKHGSYYGYGYGYEADPVEQETSSRTPQPQTPMPV
>gnl|bykdb|A0A1Q2CI19 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus flavus] (length=497 residues).
MSLKDFLSILRHRWLVIVLCVLIAAGVVFAITPAERDVSPRIGSYTATSTLLVGSVGAPDAGAGYASLGRVALFITTGEV
PRNAAAALGYEGDPALLAKQITVETQGESASVTITTTASDGERAANVVNTFANETIAFFETSPPGAETTRLSVLQEATPI
PNESTANFVIPPDRWFRTLLAAVLGLLFGIALALVLERLDSRLRTREEIAEALDMPIVGVVPKITAAQRRNKEILTVTQP
LSPYADGYRSVRAALAHGQAEAAPARGHQSLVVLVSSAHVAEGKSTSTANLAASFAETGKQVLVIDADLRSPDVHEKLDV
PQGAGVSDLLVDGQGSLNSVIRPTNIPGVRVVTAGTRLAHPTALASRMGPLVASARKRADVVIIDSAPLLEAAEVFDILP
HVDDVVLVARSGRLSAASAQRTKEMLARFNIPVVGAVIVGAPLRKGDIGYGSGYGYGYGETKGKAKGKRGGARAVADEKP
EASLVEPAEDVQAQRSK
>gnl|bykdb|A0A1Q2CJ92 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus flavus] (length=486 residues).
MWGLLRRGWLVIVASLAVGLALAFALSLTQPVLYSATSAGYVVAGNSATVGDAFAGSTLAAEKAGTYLPLVQSRSVANRI
AEELALPSTGPVVGNLEGSVDGVIFRIRATADSPELAASLADAAIRATSVEANALETLTITGESSGQTVVRIVPVELAQT
PTTPVSPNYVRNLALGAALGLLLGLGIVVGRQSFDRRIRRAHEAEEVAETSSLGIVPAAAELAGESALVTGSSAAAEAIR
QIRTNLRFVSVDNPAKSIVITSSNEGEGKSTLAANIAAMFADAGEPTVLIDADLRRPVQAERLGLDGAVGLSQVLAGTIK
LSDAMQATDHKHLQVLPAGRIPPNPAEMVGSSRMRSLIEHLSKAHMVIIDAPPLLPVTDATLLSASADGAVVVVQSGTTR
REQLEVAAHKLRQVDGNLLGVVLNKVAKKDLGEATFGYGYGSYTSKYYRTDEAQKPHRRERARRVTKLVETDDQAAELAE
PRRPVA
>gnl|bykdb|A0A1Q2CRV2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus aquimaris] (length=415 residues).
MQAGSNYAANQVQSFAKVAKSGFVLTPVIEDLQLSVTPEQLARRVAVTIPAQTATMDLAVTADSPEEAARIAHAITERLI
VAVDELSPPGADGQKPVVATVIRQPLVPTAPTSPKPLQNLAIGGLVGLLLGAGQALLRDVLNTVVRSRRDIEQVSDQAIL
GAIPLDESGDVLVLNSDPHGLRAEAYRSMRTNLQFLALDKGGRSIVVTSSVPGEGKTSTAINLAATLAAAGEKVLLIDAD
LRRPRVAAQLQLEGAVGLTTVLIGDARLGDVVQPYGRTPLDVLTAGRVPPNPAELLGHTRMRALLEDASKLYDTVIIDSP
PLLPVTDAAVLAGETAGVLVVVGSGIVRRPELTASLEVLERVEARVLGLVFNRVKRSEGEAYGYRHSYYSDHPRAAPKKG
DRKSKKRRARAEVAA
>gnl|bykdb|A0A1Q7CZ24 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium 13_2_20CM_2_66_6] (length=236 residues).
MGEHLVSLLNPASFEAEQYRVLRHLVETLRKGANLQVVAVTSPGVGDGKTTTAINLAGSLAQAADARVLLVDMDLRRPAV
AGQLGLSGGKRGLAEALLADSGLSLEDTVETLAHFNLSVLPAGRATVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFV
PVPDCRVITKSVDGFLVVVTVHRTPWGVLTEALDLIDPAKVVGLVVNGDDTRRSSYYDVYAGSSRGARGRGAWSRA
>gnl|bykdb|A0A1Q7WJN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium 13_1_20CM_3_68_10] (length=245 residues).
MPHVERRNGSGEEGAAGVIEALRGVRLNVAYAHGTGPLLVSITSPGRSDGKSFVASNLALAFASVGYRTLLIDGDVRRGG
LHRILTVSRKPGLTDVLAGDVTAEAALQRTPYSGLSFIGCGSRRHRGPELLSSAAMPRLVASLRPHYEAIIVDTPPLVAG
VDAFVLGTVTGALVLVLRAGMSDRDVATAKLDVLDRLPVRLLGAVVNDVRSGGDYRQYSYYLAGYEVADEDELREPAQSL
LRDPQ
>gnl|bykdb|A0A1R3WWR6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. RU1D] (length=539 residues).
MQRVVRILRAYWKAIVALTIAGGLVGLAWSAVQPRVYTADASGYVAAVASDGSTGAALAGDQLALSKVKSFIDMGYWRSV
AETARTELGITDSPEALVQRVHVSNPIDTVNVRVDATGPTPESARDLAEAWIRGMTTEVDQLQSGGNGESAVRLIAGDSA
RLPTSPSSPNVRLDIAIGALVGAMAGTVFALVRRAFDRRIRSAADITDTIAASVVGILPVDKELASGRAVFSFDDIRDGR
GSFAHKEAMRELRTNLQYVDVDRPARVMVITSPLPGDGKSTTAANLAVSIAATGQAVVLIDADLRRPVLGGVFGFSDDVG
LSDVLAGRAQIEQVAHQVDENGRLFVVAAGRTPPNPSEMVGSQRMQALTRKLAEELVVIIDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLSRATENISKTRGHLLGVVLNRAPLRGVDSTYYGGRYGGYYGYGAPRGTTRSWWRFGRRPRTADSE
NTTDTGPRRQSADPPPENVRGLRTLSHGRTSASNQDDSSGENVASVTTAPSPVGRRRQR
>gnl|bykdb|A0A1R4JTI6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus lylae] (length=460 residues).
MVTAGVNENLGIALTADNLAKSKATQYQELATSRAVAEGAVKQAGLDISPEAASGAVTATVPPDTAEVRLSVVQDSPDAA
RALADSWVSSLAEEVSNIENQTLPGVEQSEESSAQSIVKVLPLVQATQPQTPHTPNVRMALALGALVGLVVGLGVAALRS
LNDRRIRGVKVLEETFGLTVLGTIPAMAGLGRRAQRNRTQSKDSNAEVESRSALLELTGHTGRDDFHVVEAFKELRTNLQ
FLRPDNPPRIIVVTSAAPAEGKSTVAANAAITLAQSDVPTVLVDADLRRPTVAGSFHVEGSVGLTNAVVGNAQVDDVLQP
VSEVENLTVLASGPVPPNPSEILGSDRLEAILRSLAQDHMVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGRTTRDELAK
SLGNLEKVNGDVLGTVLNRVPTRGKEAGYYGYYGKSYYSSSATPDQDFDVTSRNAGSTRE
>gnl|bykdb|A0A1S1CAD0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC061D12] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSITAAAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGDSTA
ASPTGGNTVRVIPLNNASVNPPLVAPNYEQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1S1D5T1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC064F07] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPSNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAATGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGGTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A1S1DFA8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC065C03] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A1U2GAT5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=360 residues).
MSRDAAASALSVHNVPDTVLLTVAASTPDPETSAKLANGVAAELTDYVSSLESMSDGGPPVAKITVVSNARPEADPVVPR
THRNVALGFGLGLLVGAVAAYLRYRFDNRVRSVADLVNVVGDNVLSVVRFQPDLSNGPVAFLDGGAPVAEDYRKLRTNLG
FVGGDRAVRGIVVSSAAAGDGKSTTAINIASAFAESGSRVLLVDGDLRKPVISERFSLSSEVGFSNVLRGDGNFAEFVQP
SGIDGLWILSAGPLPPNPAELLALESTGRIVNELMDCYDYVIFDSAPILPVTDPVVLSRWVGGIVLVVRADESRTPMLSR
AISEVHSGDGVLLGTVLNGVTLSDGYYGESLYYGKSADGV
>gnl|bykdb|A0A1U3NFN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. massiliense] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAGAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A1U3QN81 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. massiliense] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A1U6THY0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=235 residues).
MAASKRAKKGGLALNRRKLITKYDPRSPISEQYRNIRTNILYSSIDEEIRSILVTSSGPGEGKSTTAANLAIVFAQQGKT
VLLVDADLRKPTVHYTFNLNNTTGLTSVLTNQLGLMEAVQENDEKNLYVLPSGPIPPNPSELLGSRAMNHFLERALEEFD
IVLFDTPPVLAVTDAQVLANLCHGSILVVSSGRTDKEAVVKTKEQLSASSGKVLGVVLNNKKADKKGDYYYYGTN
>gnl|bykdb|A0A1V2NSB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. CSI-V] (length=549 residues).
MQRVARILRAYWKAIVALTLAGGLAGFGWSALQPRVYTADASGYVASVSSDGSTGSALAGGTLALARVKSFIDMGYWKSV
AETARDELGLTDSPESLVQRVHVSNPVDTVNVRVDATGPTPEAARDLAQAWLHGMTVQVDQLESTGGAHSAVKLVAGDSA
RLPTSPSSPNEKLAIAVGALGGAVVGVLFALVRRTFDRRVRSTQDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRDGR
GSFAHKEAMRELRTNLQYVDVDRPPRVMVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVLGATFGFSDDVG
LSDVLAGRARIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQQLARTLADDMVVIIDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPLRGADSNYYGSQYGGYYGYGAPGSGAERTRWWRRPWRRQVGD
AGDAGASAPGPRRRSAELPPSNVSGLRTLSARRNPVAASGDFTGEGAVAVAPPAAVVADERTPRRRRRG
>gnl|bykdb|A0A1V8PLV6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium catenulatum] (length=201 residues).
MIVISSVEPSEGKTTVSVNVAAALAENGAKVLLIDADLRHPSVADHIGLEGGAGLTHVLSDQAAVKDAVQRYWKPNLHIL
PAGPKPLNASMLLNSKTMSKLLDTALHTYDYVIVDTAPMVVANDAAVFGAKSNGIVLVSGRDMTMKRDLKEIAVQLDNLN
VPVMGFVFNFAKERKVSANGNYYYYYDEGGKKSRKKSKHKS
>gnl|bykdb|A0A1X6X0E0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium faecium] (length=221 residues).
MKRKLKQNLITFYNSKSPVSEQIKAVRTSLNFATIDQDAQVILITSPTPSSGKSVVSSNLAVSYAQQDKKVLIIDGDLRK
ATQHYQFKADPYRGLSSLLIGKLSIADAIQETFVPNLSVLTSGPMPPNPAELLSTNKLDTLMDEFKKSFDIIIIDTPPVI
NLTDAVVISRVADGIILVVRANHTQKNEVSRSVEILKTTNKKLFGTILNDAKHEVSDYYYY
>gnl|bykdb|A0A1X6Y1L5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium faecium] (length=228 residues).
MRKTKIKDKKRLNIILNRENAKSIPYEQMKNIRSSIQFASTKELKSLIVTSPESGTGKSFVATNLALTYAEQGKKVLLVD
TDLRRPTIHKMFGKENILGITSVLTGQETIDDCVQDKIFNSLTILTSGFLPPNPAELLESEEMKAIIKQLTTDYDIVIFD
APPVLPVVDSALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIKSAGSRIIGTILNDKSSKDSGYEAEYY
>gnl|bykdb|A0A1Y4CKD6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Olsenella sp. An285] (length=514 residues).
MNDRRYGLDLSPVRDEEQGLDMAELASNYLRIARRMWWLFLACVAIGVGCLYVASYVSYTPLYRSEATFTITSGDGSSLY
SSVSSASQLSKTFPYVLDSSYFRGVLEDALGTDSLDGTIEAQTIDNSNMVTMWVDSASPENARAILEKALEVYPEVSRFV
LGNIAFNLIDEISTPATPVNEPSQSRIWGFGVMGGICTAALVVGLIALFNNTIKTAEDLESVSSMVCLGALPEVRAKARK
RSAASRYVSALDKRVSHGFRESARAMGARVRDALSERGAKVVLVTSSIAGEGKSTVAINLAEQLAQDGSRVLLVDMDLRS
QGDGALLGCGASHGPAEVLEDSGLGVDDCIVLLEESGIGFWGGAGPVQNPVEVLSDERLPSLFDGLRGQWDYIVLDASPC
GMFQDAAMLANWVDEVLFVVRFDKVGRHNVQDALSMLDGERASVLGYVLNGCPQTAGSYGYGYGRYGYGKYGYGSYGDGY
GGLADEVDEGVKPVVEPEIVEEEVVPPRGKHFRV
>gnl|bykdb|A0A1Y4CTD2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Olsenella sp. An285] (length=450 residues).
MVLDGVTVREAARQVAQNWWVVLALALATFLGMTGVGKLTYVPEYTSAATLVIRVKGADAYSSLAQASQMTAVYSEVFQS
SALRNEISASVGEPVEGSVSCSQVSGTNLLTLSVTSPTPRQAYLFIQSALQNYERVSGYVFSNATLQLVQEPSVPESPSN
TSPLIAYRYLGAAIAALGAVALIALIYLLRNTVKTAEQASDLLDGRVLGTVPFERKRVVRGGDERSVPALVLSSPLVSMG
FAEANRRTATRLEAHLRSGGFKTVLVASVEENEGKSTVAANLAAALAERGRRVLLIDGDFRKPAQRRIFDEQNLERPSFS
DYVLEDGVAGVGPVLNGRSGVYELFQYKALRDPMAVFSGERLADVMAELSERFDYIFVDCSPVAAAADAELWMRQVDTVV
LVVRQDMTDVRVINDTVDVAWKSAGDFSGFVLNAFQGEWSLTHGRGYSAY
>gnl|bykdb|A0A222TG79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia rubripertincta] (length=414 residues).
MYVTSGDDSNVQAAYQGSLASQQRIASYAQLASSDAVISNAVSESRKSISSEDVRKKLSTSWDPDTVLLNVTVEDSDRSV
AVVLANSVAASLQDYVESLETPAGGGSPMAKLTTVTPAVEPSVPVSPGIEKNTLIGVAVGLLFGLLAVMFASRLTNRIQT
PADVVEVTESPVLAVVPRFPSAADSPVSFGAGSSPASEAYRRLRTNLSFIGVDSPHRRFAVTSALEGEGKTTTAVNLAVC
LSEVGYKVVVVDADLRRPMVAVRLGVNPDIGFTDFLSGRAALEDVLQSTSFSGVDALAGGQIPPNPAELLTSQKASEGIN
SLSSLYDYVIVDTPPVLPVTDAVIASRLVDGVIVVVRSGASRRPDLESMLSHLGRANAAVVGVVLGDAQSRAGYYANSYA
LEYGQVGVRDSAER
>gnl|bykdb|A0A231VTW0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. Olga] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A255G8R8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium NML 030167] (length=382 residues).
MTTTVPQKTVIVEVTVTDPDAASAARIANAIGDQVAETVRELSPKRDGQDTVKATTISPALPPPSPSSPKVAQNLALGLL
LGLALGFAAALVRERLDTRVRNEADVAAVTTASQVGSIPYVAGTPEHPLELGAHTDQRFEAYRRLRTNVQFVAAPQGRTA
LVVTSSVPGEGKSVTVANLALAMADAGNRTLLIDADMRRPTVADNFGLVGTAGLSTILAGQATLSDLVQPFSGHPDLYVL
TSGVVPPNPTELLDSAQMRALLDEALAEYDVVLIDSPPLLPVSDGLVLGKLVGGALLVTGIERVKKPQLAESLAALGTVD
VKVQGVVLNMVRRKERGDAYGYYAYGSEPGRQRSSSAATGRRAAPSGQRPDDLVLTPRQARE
>gnl|bykdb|A0A259S8H9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 13-71-7] (length=590 residues).
MLDLFTILRRGWLYLAAGLLLGALAGFGYAQTLAPVYTSQATGFIAATGTAVIAGSDEAVARAGAYMPLINTSQVRDEIA
KEAGVSAAELHGSLSARVVPGSTLVEVTADAADPKSALKLANGALHALAKVVAHIEQVAQSAAPVDPSLPPEPKSATNAA
PGGIAIVPMDEAVAPTRPSAPNKPLIAGIGGGAGLVLGLIALLLRRAMDVRVRAHTDVAALVGAGVLGRVPRMRKSGQGR
NAALARAVAHEAYRQIRTGLRFASVDQEVRVVMVTSANLGEGKSETTRALARVLAESGQRTLVIDGDLRRPTIAKGFEID
EAIGLSEVLSGQVPIGSAIRRTEEANLFVLPAGGIPPNPSEMLGSAAFQQLLTRLRQDFFIVVDAPPVLAVTDASVLSSV
VDGLVFVVAMGRTRRVEIVEARTQLEQVRARVLGVVLNLVSLRGGDNGYGYYRKNSRYYMKSHRAATAEDGDDAVDAFAA
MANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGPADIITDGDAADAGEEASPAIVRPHGSNGRAAAARARRSVPPVE
VAEPVGERVDGEDEAHDAAKPRYARRNARP
>gnl|bykdb|A0A261FE22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium tissieri] (length=440 residues).
MAKNSDGAMTTGASNGGSSPLASYAQLVQSDAVLEPVVNNLGLHTSVAGLRGNVSASASDGSAFVSMTVTYSDPNDTVTI
LNEVVKQLNKQITSDGSSGIQLSFIQKPYVPSSPSSPNVKGNMMMGAFAALIIAAAGAVIREMSDNSIHTKAEIQSIVPA
PILAAVPKSPTLAGRTPAVIVKPRGHAAEEFRRLITNLSFVKNDRGNRGNVLVVTSAMLGEGKTTVSVNIAATFVEKGES
VLLIDADVRHPSVAKALGISNGVGLMQMLTNQVDAQTAVQQYWKPEFQVLPVEDNQGTAAVMLSSAVMENMIDQAAKHYD
HVIIDTAPMQVSNDASLFAREGATLLLVVAQTVGRKKVLRDVAHEFKVSRVKISGVAFNRVAHERSRKGNYYYYEESETK
AKKSSKRSSRKASASAPATQARPQVQAQAPRSARTAVSGK
>gnl|bykdb|A0A261FQA1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium lemurum] (length=466 residues).
MSIADILQMIKKHWIVGLAVLVVSLAVTVCVVQTTVPEYSASVTAVTNAQSAAADGSTSDSRMGVVSRVATSSAVLEPVI
DELDLDTSVDAMASSVSASVDASGLMTVTATSSDSQQAADIANAVYDSLVQQIEDDSFASNETGLFNGLQFSVIERAVAP
SSPVSPNKPRLIFMGTLAGLVLALVVIVVIDVSDKRVRDTADIQRILYSPVISSVPKSDTFRGTAPAVISDPSSKAAEDI
RRLALNLDFIVPDKTDMSNVIVVASSDASEGKTTIAVNLAAAIAERGRTVLLIDTDLRKPSMAGVLGINGKVGLAHVLAR
QAKLDEAIQQYWKPTFHVMPAGEQQANPSILINSKAMNMLLHAAAKQYDNVIVDSTPMSVANDSAVFAKEGGTLLMVVGQ
GVAQKKTLKASAEEFELVGVKPAGAVVDMVKEQRGKGDYYYSDKAAKHSSQGTSEKSHEPTEKAEQ
>gnl|bykdb|A0A285VUW0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Ornithinimicrobium pekingense] (length=480 residues).
MSVRDLFLAIARRWRGAVAILLLVVAATAFATSRQPQVFESRTTVYFAATDEAGESSGNLYQMPAGERSTLARIARSPLM
LDPVRETLGLDASVPLSVEAVPGGDDTALFDFVVRSDSPDHASAVAEALPQQLATTARSYAPTLAQSGASVAAQFVDQPT
QSSEPVSPNPTRNLAIATLAGLMLGLAYALGMQALDTRLRSTADVEALTGRPVLSTVPVLPTAGRTSSMYIENDPFGPQA
EAIRKLRTNLVFVDVASDAGHSFVVTSSLSAEGKTTTVVNLGMAMAESGRRVLVLDADLRHPSVASELGLEGAVGLTSVL
AGDARAEDVIQRWRDTEMYVLAGGEIPPNPSELLGSRAMERLFKQFLRDFDFVLVDSPPILPVTDALVMSRLTGGLLMVV
SAASTRRRHLQEALRTLEAAEAEVSGFVLTKTPAERSGSYNYQYYGRETPVTAGETRGSRRQSGGARRLARRKGARAARR
>gnl|bykdb|A0A291DEI8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTA
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLIGAVAGLGLVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSED
LNEENIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTD
ASLLSNSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|A0A2A8D6P2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A2I1VJQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A0A2I1Z490 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPSNAQALVNGENTG
ATPTGGNTVRVIPLNNASVNPPLVAPNYQQNVLVGAATGLALVYLAIFLRRALDQRIRTRDDATKATGASVLGVLPVSDD
LNEDNIVKGDTEDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQVDESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVIDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|A0A2N3R006 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum subsp. pseudolongum] (length=372 residues).
MAQLKEQVSVTNPTNTAFVNISVTDGDPAQAADIANAIAKSLSSVVETTLYASGSHSSVKLSVVQPAAVPSSPSSPKWKL
NILVGIVGGLILGVFAALLKDVLSKRIQDDDEISEYIDAPIIGRIPEEELLNSAKPVIVSEPGSPVAEGFRRVRTNLSFM
APMEDTNCQLIVVTSTGASEGKTTTSVNIAAALAENGAKVLLIDADLRHPSVANKLDIDGSAGLTHVLSGQASVKDVVQR
YWKPNLHVMPAGPKPPNASALLNSPIMVELLNNAIAQYDYVLIDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLRE
ISEELATLDLSANGVIFNCARESKKSLEYSNYYYYYSDSNKKRSKKGRFSLK
>gnl|bykdb|A0A2N3YJR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera duodecadis] (length=474 residues).
MTLLDFVRLSRTHLLSLVLLTLLGGAAAFGLTTRLPQVYQADASGYVRVTAAGSSTGEGIAANALSGSKADSYLPLVTSR
AVAQRAIEATGVKASPASVASRVTASVAPDSVILKVTATAPSPEEARVLADAVIKATAEEANRIETAGSGRGAASVTIVP
IESALPGTKIAPDPRRNTLVGLVGGLFLAYALIFVRRQLDTRVRSAEDVEKETGASVLGVVPVTPELRAARGRGRLDALG
ASAESFRQIRTNLRFVGVDDPPRSIVVTSANAGEGKSTVSATLARVLGQSGQSVVIVDADLRRPTLAKVFDRENTIGLSH
VLTDQVSLVDALQATDQPNVRLITSGRTPPNPSELLGSARMHDLVRELSVDNIVILDAPPLLPVTDAGVLSASCDGALFV
FAVGKTHREQARLAARMMGQVGGRVLGVVLNLAPKGRAGAVMYGYGYGGYATYASDTKSRRDYEKASRGRHGTD
>gnl|bykdb|A0A2N4T4Q5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria flava] (length=336 residues).
MDRRIRSVEEVRETFGTPVLGIIPEDDRLADHREIIETGTSGGRGHHAFSEALRELRTNLSFVSVDAPPRVVVVTSSMPG
EGKSSITANLAVAIASTGRDVVVVDGDLRRPVMTELFGLVPGVGITDVLVGEAEVDDVLQVYDKFPNLQVLGAGRTPPNP
TELLASQAMRTMLAELAEDAFVLVDAPPLLPVTDAALLTASADGALVVATAQGTTVDELGKALGNIEHVRGRVLGVVLNH
VPTTGADAGFYGYYGKSYYASDDSGGDAPEAPLRPAKEVPDAGTAAPASRAPDTGSTAALETESPADAAVSDLPADESER
FDLAAWQRPGKGTHRA
>gnl|bykdb|A0A2N6V1R5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces graevenitzii] (length=639 residues).
MTRVNLGFLILCVLLGLAGGFGYASAQPWTYTATSQAMVVVPGTDAFSQNSISGQKASVYAVLAGSQNVANRVAKTLKTS
NMEGTLSGSADAVPGLFTLTATASTPERARDIANAGIKAVSDEANAITTLNAPTVQPTTKTTTNPDGTQVTTTTQSVDGT
TNVTTTDNSYRETRVTQTLQAVAPSAPSSPDFYKLSGMGALAGLVIGYLVVFMRRLMDNRVRHNSDVEELLGSSVLAVVP
KSTELNAKGRQNVDGLGQAAEALRHLRTNLRFVDVDNPPRAIVMTSANPGEGKSTMSAVLAQMLASSGQRTVLIDTDLRK
PVVHKIFGLDGSVGLTQILAGDMQLSDVAQKIEGQPNLRVVPAGRIPPNPSELLGSQRMKALMDYLKDDAMVIMDAPPLL
PVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASRRNLGSVYYGYGYGGYGQNYYYYEEDEK
RKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRV
STVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
>gnl|bykdb|A0A2R7MGI0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. HMWF026] (length=514 residues).
MQRVVRILRAYWKTIGALLALGALAGLGWSALQPRVYTADASGYVATVSSDGSTGSALAGDQLALSKVKSFVDMGYWRSV
AEAARQTLGVNDSPESLVQRVRVSNPVDTVNVRVDATGPTPESARDLAEAWIRGMTTQVDDLETGGTGQGAVRLIAGDSA
RLPTSPSSPNIKIDVAVGGIAGGVLGVVFALVRRTFDRRVRTVQDITDTVDASVVGVLPVDKELANGRAVFSFTDIRDGR
GSFAHKEAIRELRTNLQYVDVDRPPRVIVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVMGGVFGFSDDVG
LSDVLAARAQIEQVAHQVDEEGRLFVVAAGRTPPNPTEMVGSQRLQSLARKLAEEMVVIVDSPPTLAVADAAVIASWADG
AVLVVTAGRTTDDMLTRAIENISKTRGRLLGIVLNRVPLRGPDSSYYGARYGGHYGYGESHATGAEGIKRSTRRGARGVA
AKSGPAETGPRRRSNAAPDDARALHAGEVFRDLG
>gnl|bykdb|A0A2R7RCA1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. HMWF013] (length=243 residues).
RTNLSFLDVDQPPRIIVVTSSVQAEGKSTVTANLAVTLAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELA
DVLQPWGALPNLSVLGSGRIPPNPSELLGSQAMKNMLNALAENAIVLIDAPPLLPVTDAAVLSRAADGAIVVIRTGRTTQ
EQLAQSLGNLDKVKGRILGAVLNYVPTKGTDAYSYYGTYTSAPTSAPGPVAEAEPDLTGPFWEGPGESVQVPESVSAGRR
ARG
>gnl|bykdb|A0A2R7Z032 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides currus] (length=477 residues).
MTFAEFVRLTRAYWWFLVLLTALGAGVMIAKTSREPELYSAGASGIVKVGFSSSAGEEMSNQSLASDKAALYVALANTTP
VAERVVEKLGLDVDPGAIAGRFSASVDTDINLLTVQAIGTTPEEARDLASIVVQAIADEAEEIENTGRPAGNKAETLVQV
VPLEQAQLPGAPFTPNYRNGAIKGAGGGLVLAYVILIARRLIDRRIRSVKDVETATGSAVIGIIPKVDALNRTHRGVRGD
LGQAAEAFRQLRTNLRFLDVDNPPRRIVITSALASEGKSTVSSNLARLVAQAGEKVVLIDADLRRPMLATTFDIDGEVGL
TQVLAGDLRAGEAMVSSGIDNLWLLPAGRIPPNPSELLGSLRMSQLIDELARTHLVLLDAPPLLPVTDAGLLSAFCDGAL
LVQATGQTYIEQSEHCRRILDQVGSRLLGIVLNKAPLKGVGAIAYGDGYGYGGYGAQAEYASREAYSTAGKGKRRSK
>gnl|bykdb|A0A2R9UAT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 71-36] (length=448 residues).
MLANNLALSKVVSYVDIGSWRSVAEYAIEKLRLDSSPEALVRRVDVTNATGTVTIKVQASAPTPETARDLAEAWIQGMAT
EIDGLESDGGKVQAAVRLVPADTARLPTAPSSPNVRLALAIGGVAGLVVGLMIALLRFTLDRRIRSAELVERETGVAVVG
TVPVEKSFTAANRLIPVGGQRDERLFAVSEALRELRTNIQFMDVDHPPRVVVVTSPLPGDGKSTMSANLALAMAASGQQV
VLIDGDLRRPMIAAIFGLVEGAGVTDILAGRAEVDDVAQTFGHLDTLRIVAAGRTPPNPSEVLGSERMKDLLRELSREAM
VIVDAPPLLPVTDAAVLTHSADGAIVVVGAGRTTIDVLKKAMNNLERAGGRALGVVLNRVPRSGGGYYDYRYTGDYYQAD
QTPYDEAVHNPPNNVDGITRPVVETQPAATGDPQDQLAPLRRTRRRAG
>gnl|bykdb|A0A2S0LQ32 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces sp. oral taxon 897] (length=604 residues).
MKVNAVFIICCVVVGGLLGFGYAKTQPKLYQSSAQATIVIAGTDAWSANSVAQQKAGVFAKLAGSAAVAQSVSQSLGLQD
LGGSLTGAAEPSSPIVTITAVSSDPSRARDLANAAIPALGSYIASLEAIGSGQSPSPADAQPPAAGSDQPSTPSPADEQP
AAPEPATPEPRQEEPRGGNQDEGANPGTGERRSTPGRGNGTGEEKEDAAADAQARVVPAVAGTGASLVPAVAGAPQAAVG
QAGVGQAGQAAPAAPATAAPTDETYNSQTRLVALEPAQLPGAPFSPDTTKLAGMGGAGGLALGLAVAFLRRALDNKIRHN
SDIEDILQSSVLAVVPRSTDLSAKGRRNVDGLGQAAEAIRLLRTNLRFVDVDNPPRAIVMTSANPGEGKSTISAVLAQML
AASGQRTILVDTDLRKPVVHRIFDIDGSVGLTQVLAGDVPVSDVAQFVKGHPHLRVIPAGRIPPNPSELLGSQRMKALLD
RLSQEAVVLLDAPPLLPVTDAALLSALADGAILTFEVGGTYKEQARLTGKILGQVDARLLGVVLNRASRRSMGSVYYGYG
YGSYGHHYYYGERPRGWRRLLPGGRRHTRHQEPAETQEHVPAAS
>gnl|bykdb|A0A2S5ULV5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. AY1H1] (length=532 residues).
MTVLDFLRLTGKSWKILAIGVIVGLLAAFGYTQIQPKVYEADSAGFVIAGSSGEFSSIDGSEQAITKANSYLPLITSQPV
YAKIAENPNSGLAAGETLTGRLSATVAPNSNLIQVSASASTPSSAVALANGALQAMADVITEIETQVGGGTSGVTVVPLQ
NAVEPTSPVSPNLRNNLIIGGAIGLVLAYAFALLRRSLDVKVRDSKDLATASGAGTLGRIPKSPQLMGKNRGTNDADAIA
AESFRRLRTNLRFASVDEEIRSIVVTSANAGEGKSTVATSLAQVLAQSNTPTILIDADLRRPTVATVLGIDGKIGLSEVL
SGQVSLEDALVGSKIPGLYVLPSGRIPPNPSEMLGSEAMKSIVSLLSKDYIVVIDAPPLLPVTDAAVLSTRVDGVVLVAS
AGRTRREDVMAARDMLKQVHSRMLGTVLNMVPPRDSADGYEYRRNRSYYVTADKKGMPKFKAVKGHTDPSEHFGAQPDVA
APQRESLSPSRPAQPAAEQAAPSQPQAGPVPSSAPTAVATEQPQSRRSRRGA
>gnl|bykdb|A0A2S5UYV0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. AY1F1] (length=533 residues).
MTVLDFLRLTGRSWRTLLIGVAIGLLAAFGYTQVQPHVFTANSSGFVMAGPAAEGGYIGGSEAAIAKAQSYIPLITSQPV
YAKIAENPALGLAEGQALTGRLSASVAPGSNLIQVQASADSPSSAVALANGALQALADVITDLESQAGGGVSSVTVLPLQ
DAVEPTSPESPNLRNNLLIGAGLGLVLAYVFVFLRKALDVKVRNSKDLASAAGVGSLGRIPKSPQLMGKNRASNDADAIA
AESFRRLRTNLRFASVDEEIRSMVITSSNAGEGKSTIATSLAQVLAQSNTPTILIDADLRRPTVASVLGIDGSVGLSEVL
SGQVSLEDALTATKTPGLYALPSGRIPPNPSEMLGSEAMRSIIRLLSQDYIVVIDAPPLLPVTDAAILSTRVDGVVLVAT
AGRTRREDVGAARDMLSQVHGRLLGTVLNMVPPRDTADGYEYRRNRSYYVTADKKGMPVFKSSKGHVDLLEPQPEKNASA
AISLAPRPNSQSSEQPPQAVVAQQQAPASETPSDLSSTPEVQGAPTRRSRRGA
>gnl|bykdb|A0A2S5WZJ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. RFBG4] (length=408 residues).
MADVITDVETQVGGGVSNVTVIPLEDAVPPTTPVTPNLQTNLLLGAGIGIVLAYVFVFLRKALDVKVRTSKDLATATRSG
SLGRIPKSPQLMGKNRGANDADAIAAESFRRLRTNLRFASVDEEIRSMVITSSNAGEGKSTIATSLAQVLAQSNTPTILI
DADLRRPTVATVLGIDGKIGLSEVLSGQVSLEDALVASKIPGLYVLPSGRIPPNPSEMLGSAAMKSIISLLSTDYIVVID
APPLLPVTDAAVLSTRVDGVVLVATAGRTRREDASAARDMIDQVNGRLLGTVLNMVPPRDTADGYEYRRNRSYYVTADRK
GMPVMKSIKRGHEQPEAFAVQTDASAAQTPQPTFAAVAPAAAPARESLAPTRPSASSAPRATPAASQPTPPPQTPGSELP
SRRSRRGA
>gnl|bykdb|A0A2S5X9U6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. RFBA6] (length=526 residues).
MTVLDFLRLTGKSWKILAVGAIVGLLAAFGYTQIQPKEYEANSAGFVVASGNAELGYINGSEAAIAKANSYIPLITSQPV
YAKIAENPDSGLAEGETLNGRLSATVAPNSNLINVQATASTPSSAVALANGALQAMADVITEIETQVGGGASGVTVVELQ
NAVEPTSPVSPNLRNNLIIGGAIGLLLAYAFALLRRSLDVKVRDSKDLAAASGAGTLGRIPKSPQLMGKNRGTNDADAIA
AESFRRLRTNLRFASVDEEIRSIVVTSANAGEGKSTVSTSLAQVLAQSNTPTILIDADLRRPTVATVLGIDGKIGLSEVL
SGQVSLEDALVGSKIPGLYVLPSGRIPPNPSEMLGSEAMKSIVSLLSKDYIVVIDAPPLLPVTDAAVLSTRVDGVVLVAS
AGRTRREDVSAARDMLKQVHSRMLGTVLNMVPPRDTADGYEYRRNRSYYVTADKKGMPKFKAVKGHADPSEQFRAQNDAV
PAQRESLAPSQPAQVRSAPVVPAQLETQSAEPVSEQPQSRRSRRGA
>gnl|bykdb|A0A2S5XDQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1C5] (length=489 residues).
MTVVDLIAFIRRNWRTLVGAVLVGALAMAAFSFLTPKVYESSSAGFVIAASDGSSADAISGSQTAVTRANAYLPLISSSA
VSERIEADPEANPGGEALSGRLTARVAPGSTLIEVTAAAGTAQNAAALANGALAALAAVITDIETQSTADRTPQITVVPL
ENAEPPAAPTSPDWVRNILLGALGGLVLGFGLAFLRRALDIRVRTVDDLTELFGVGVLGRIPKAGRPGRTGGRRGTDALT
AEAFRSLRTGLRFSSVDEETRSVVITSANQAEGKSTIAAGLARVTAESGQRTLLVDADLRRPSVARMLDIDGAIGLSEVL
SHQIPVDDAIRPTGTAGLYALPAGHIPPNPSEMLGSEAMRALVARLSKDYFVIIDAPPVLPVTDASIVATVVDGVVFVVA
SNQTHRPEVVAARRIVQQVRARVLGTVLNMVTARDGDTGYYYYDRKNAYYAEPQPATGRKRAAAAPRRSELAPVESRALP
PQTSRRAAR
>gnl|bykdb|A0A2S5XNN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1F3] (length=489 residues).
MTVVDLIAFIRRNWRTLVVAVLVGALAMAAFSFLTPKVYESSSAGFVIAASDGSSADAISGSQTAVTRANAYLPLISSSA
VSERIEADPEANPGGEALSGRLTARVAPGSTLIEVTAEAGTAQNAAALANGALAALAAVITDIETQSTADRTPQITVVPL
ENAEPPAAPTSPDWVRNILLGALGGLVLGFGLAFLRRALDIRVRTVDDLTELFGVGVLGRIPKAGRPGRTGGRRGTDALT
AEAFRSLRTGLRFSSVDEETRSVVITSANQAEGKSTIAAGLARVTAESGQRTLLVDADLRRPSVARMLDIDGAIGLSEVL
SHQIPVDDAIRPTGTAGLYALPAGHIPPNPSEMLGSEAMRALVARLSKDYFVIIDAPPVLPVTDASIVATVVDGVVFVVA
SNQTRRPEVVAARRIVQQVRARVLGTVLNMVTARDGDTGYYYYDRKNAYYAEPQPATGRKRAAAAPRRSELAPVESRALP
PQTSRRAAR
>gnl|bykdb|A0A2S8MDM2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. ITM-2016-00317] (length=237 residues).
LDKERRKQPAISFETDNAATAEAFRKLRTNLQFLAIDSPPRVLVVTSSVPSEGKSTTAINLALALAEADHKVLLVDGDMR
RPSLHQYLDLLQPVGFSTVLSGRALLGEALQKTRFPGLTVLTSGSIPPNPSELLGSQSARRLLSELRSQYDYVVVDSTPL
LAVTDAAIMAAGADGVLVIARHGSTKKDQLTHAVSSLHSVGAPVLGAVFTMMPTRGSSSYGYSYSYYGTETPRHAPP
>gnl|bykdb|A0A2S8WHZ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. MYb227] (length=511 residues).
MQVVRAYWRGIIGIFLICILLAFLWTLTQPRIYAATSSGLVIAGDSENIGNALAGDNLAKSKAVGYKSIAGTRTIADLVR
KELKLDESSDVLLGKVEVTVPTNTAEIRVTASSQGAEEARNLADAWVVALAAQVEELESVSVGGSDRATAVKLQPLGQAV
LPSSPVSPNTKLSLALGGVIGLALGLGYALTRNHLDRRIRSVEAIERLGVSVVGTIPEDQRLTEGRSVVETGSIVHDDRA
AHAFSESLRELRTNLNYIDVDNPPRIIVVSSSVPGEGKSSVTANLAVAIASTGRNVVLIDADLRRPVQTELFDMMDGAGL
TDVLSHSADLEDVLQPYGHLPNLQVLCSGRIPPNPSELLGSKAMKSLLSELALDAVVLVDAPPLLPVTDAAILSTSADGI
LVVVRAGSTTGDELGKAIENLKKVDANILGAILNQVPTKGAGAAQYGYYGKYYYSNTEQDPKADAKPSRRLQDPVPVDQP
VISSNRFGEIPGLGAHAGSSEPEFRRLRRRR
>gnl|bykdb|A0A2T0S3C8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudosporangium ferrugineum] (length=493 residues).
MDVRDYLRVLRKRWWMLLAGIGVACGLAGILTSQMTPQYATSVTFFVTTPNNGVTDAYQGGLFSQQRVKSYATLLTGDRL
AKVVAAKTPGLELTPAEVRERITAEALPETVLLQATVTDGSAERSRLIAGVLAREFTTMVEALETPRDRTASPIKVEVVA
GPTGGDTPVSPKPLRNLALAALLGLLAGGVAAVLRETLDTTVKTADALHELAGAPVLAGVPFDADARSGPLRLTGSGHSP
RSEALRQLRTNLQFVDVDRPVKTLVITSAMPGEGKSSTACTLAGLFAEAGQRVLLIDADLRRPRIADYLGLEGAVGLTTV
LAGRASIADVVQPWSEGMWALPSGSLPPNPSELLGSQHMADLLEQFREQYDMVIVDCPPLLPVTDGAVVAARADGALLLA
RSHKTTSSQIQTAARALQSVDARLLGCVFNMVSAKGPEGYYYEQYGMTSQHRRGAWRDRMRAPATTELRDLMACGEPESA
PERRLDEPIGSGR
>gnl|bykdb|A0A2T0UZ65 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera remsis] (length=486 residues).
MTFLDFVRLSRANLLRIVLLVLIGAGLAFAYAQTLPKVYAADASGYVVTGGGQNTGDVFAGSTLAGSKAESYLPLINSRA
VGKRAGEIIGSDAPPEVLAARVAGSVAPGSVILKINATGPTPTDARDLADATMEAVAAEANRLELGGGEVKPGTQALVRI
IPIETALLPGAPIGPNVTKYVLAGAVAGAALAYAWIFIRRLSDTRIRTSKDVEDLTGSSSLGVIPLSNELRKARGGRSSG
LGLAGESFRQIRTNLRFVSPDAPPQSIVVTSASPSEGKSTVSSTLASIIAEDGRPVVIIDADLRRPNIANILEVSSTVGL
SEVLSGQMDYTDAMQATRHQDVFVIAGGQVPPNPSELLGSARMRQLLQELTRDHFVILDAPPLLPVTDAALLSGAADGTI
LVFAVGKTHKDQVEACAKMIQQVGGRILGIVLNMAPKRGMGSVMYGDGYSTYYSHGSYEYYKSGPKKGRRRAAKKAKDRV
GAGRRG
>gnl|bykdb|A0A2T7WQY4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium testaceum] (length=516 residues).
MDMQRVVRILRAYWMTIGALFALGALVGLGWSALQPRVYTADASGYVATVSSDGSTGSALAGDQLALSKVKSFVDMGYWR
SVAEAARESLGVEDSPESLVQRVRVSNPVETVNVRVDATGSTPESARDLAEAWIRGMTTQVDELETGGSGQGAVRLIAGD
SARLPTSPSSPNVKVDVAVGAIAGGVLGVVFALVRRTFDRRVRTVEDITAAVGASVVGVLPIDKELANGRAVFSFTDTHD
GRGSFAHKEAVRELRTNLQYVDVDHPPRVIVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVMGGVFGFSDD
VGLSDVLASRAQIEQVAHQVDDHGRLFVVAAGRTPPNPTEMVGSQRMQALARKLAEDMVVIVDSPPTLAVADAAVIGSWA
DGVVLVVTAGRTTDDMLTRAVDNLSKTRGRLLGIVLNRAPLRGPDSSYYGARYGGAYGYSEPDADTRKGAKRTRGRDRRP
SSVMGAPGATGPRRRSGTASDDARVGASGEVRRSRG
>gnl|bykdb|A0A2V2CXY5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Collinsella tanakaei] (length=248 residues).
MASEGRAGMKELVIRNMPKLPFDVTEALNQFRINLGFCGDEVKTIMVTSSLPNEGKSFLVMQLWRMMAEVGTPTLLIDCD
YRNSEMRTKYGIGSTEKIIGGAHYLAGKADMADVIYQTNIPNGYMIPTTSAIANPTILLEGTRFSHMIESCAKTFSYVLV
DTPPLGSVADALNVAPHCDGTVLVVRSGATPRKLVDNSVQLLKRTETPLLGIVLNRADMNSKSNMYYHRYYRSSYYYNSY
GSRSQKQK
>gnl|bykdb|A0A2W1Z497 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_040] (length=561 residues).
MAPDARPDERTSRTLADYVRMFRTYWFGAVLIVLACVAAAGAWTLTQPRVYTSGASGFVRVAGNGDANLDYAADQLSKSQ
AETYVELGGSLAVAKRVVRATGTSASPQELLGRVQTRLPEGTAIIDVTASGATPRESADLADAWIAGMGRQIAAIQSSGE
ALASATTKLVPLASATVPTSPSSPDVRAAVTLGVLVGLLLASVYVLVRQALDRRIRSAAAIEAAFGVPVLGTIPLNPALT
DHRQLVDALPNRTPEERRVNFATSEALRELRTNLSYVHVDERPKVLVVTSPLPGDGKSTIAANLARSLAVTSTGRVVLID
CDLRRPVLSAVFGVARGAGLTDVLSGRADLADVMQQTDDVGNLWIVGSGRVPPNPSELLGSRMFRDILASLGEHATVVLD
APPILAVTDAVVLAAGADGLVVTVSAQGTTIDQLGRALQLVARGGGTVLGAVLNRVPTRGQDARDYGYYGGAYYAGDDDG
SEPAPGTDGGAEHGTDGDAEARAARGARPSGGSRLTPSLPDRDASVPRSPVVSPYDPSLELPSRRSRRRAAAVGGTDDTR
P
>gnl|bykdb|A0A2W2A4B0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_047] (length=470 residues).
MTPLTRALVLRWYFAVGGALLGFVVAIALSSTVTPQFRATSKIWISISGDAESSALDLAQGTNAAQQRIHSYLDLVPQPI
VLQPVIDELHLDVKASELARSVSATSPTGSVVMQIAVTSPDRQRVAEITDSIVRSFSSVVQDRLDANASGVGVTVTQTSP
AARPTTPVAPRTRANAALGGAAGAGLGVLAAFLRWALDTKVRGRDEVQELWDLPVLGDIGFDPEASKQPLVLRDARASAR
AEAFRSLRTNVQFLASRPEGARTLAITSSRPSEGKTTTAANLAVALAESGLRTVVIDADLRRPNLANVFGIEGSAGLSDI
LVGRVELADVLQPWGRAGLSVIPSGTVPPNPSELVGSPAFTALIEDVAALFDVVIVDTPPLGSVTDAALVSRAVQNMLLV
VASGRVRRAEVSSSIESLATVGASVQGVVVTMARSRGARDAYAVYGADVPPETQRSHRSAVPGSTSEVTP
>gnl|bykdb|A0A2W2CFC8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Jishengella endophytica] (length=483 residues).
MDPLRQLRLVRRHWWIVLVTLMVSLGVTALVTVRAQPRYLATVTYFVTTPSQGVSDAYQGGLFLQQRVKSYEQLLTSDRL
ARSVVADNQLGLTAEQVRGRISTSTETGTVLLRASVVDTDQTRALRVTEAVSAKFVELVKQVETRPDGSAGPIKIEVISG
PGVTPSPVSPQPVRNVLIGTLIGLLAGVGLAILRGIADLRVRDGASLRRVTDSPLLGEIPLDNDARTAPLIIGVAAASAR
AEAIRKLRTNLRFVDADEPARVIAITSALQGEGKTTLSCNLAITLAEAGWRVLLVDADLRRSKVGDYLGIDSAVGLTDVL
VGDVPVGDVVQRWGDKSLLVLPAGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLIS
QHGRTARTQVAAAARALNAVSVRLLGCVLNMAKLAKAEAYQYEAYQVLSSSLPVDRATAGRHAEQTAADEPVDNAEELTR
LSR
>gnl|bykdb|A0A2W6DK08 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudonocardiales bacterium] (length=575 residues).
MGIKDYLTALQRRWPVVVVAGLLGLLIGYLVAPGAANQLSGKGSYVATATVLQAPDVKEAVASTTLLVTAEPVAERVSKM
LNTHHAPQDLLLKVTAVADKPSNAINITASDVDPQNAVALANAFAAGTVDEFRARHAAAAAARFRSLEGQLTEVDNQLKQ
VTGFTGAVSTPVNPVLQARAAALSARYAAIYGLLQETANQANNPTGLDTLSPAAGATFNAGAFSLSSTTARTVVGLVLGV
VLGCALALALEHFDTRPRDRAAAGRAYRLPVLAEIPQARHSERRNFAVITASEPESSAAEAYRSLRSSIMFTENRMNHFD
REDMVLDRSAVDTTQPPQVILVASACAAEGKTATVVNLAACFAEVGKRVLVLDCDFRGPDAHQYLGVSPGTGLSNLLRST
TTVDLSLHVRQSDIPRVDVVTAGTQLERPSTLPARMGNLVMQARELADIVLIDSAPMLLANDATDLMPYVDTVLVVSYAS
RTTSEEARRASELLARTRAPAIGVALVGVKGRSYRNLMSYSNGSRGSDRDARFAAVISANDRAHSDRHWRRAEMSELIWH
PSTPAPNGFLPERRP
>gnl|bykdb|A0A2W6VLC6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=236 residues).
PTTFVITSSVPGEGKTSSGINIARALADVGTHTLLVDADLRRPKTDVYLGIEGGLGLTDVLIGRARVEDVVIDMAPRGFS
VLPAGRIPPNPSELLSSPRMKQLIAQLSLAYDVVIIDAPPLLPVSDAAVLAKQTRGALVLVGAGRVTRNQLQESLEGLRA
VGATVAGVVLSMAPTRGPDAYGYGYGSYGTYSASVPDTGWSVSHAAAEASAGVAGAARTESTAGREGTPHREAPFS
>gnl|bykdb|A0A2Y8ZRF8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius hedensis] (length=455 residues).
MTIRDFLRIMRQRWRWLLGTLLIVLIAAAVSTMLQPKTYEASARFYLAGSNGQGTPVQRDDLATYAQVVSAPAVQEVIRK
QAKVGPTAAVNVNATLSDTANIMTGTASSGSAQEAAAIANATGPALAAVAPQFSQLLSGAGSVTSTAVQPATVPSSPASP
DIKRTLELAFAVGLLLGVAMALLRHFMDNRVRTVEDLEALVQRPVLSIVPRVGSGQRVVDTSDSPSGAMVEAMRRLRTNV
KFVNVTNDVPAVVVTSARPGDGKTTVAANLALAMSRDGHRTLLVDGDLRKPGVASAVGIDGSVGLTNVLVHELALKDVLV
EPEPSLPLFVLPAGPVPPNASELLGSAAMRNLFQELVAEFDFVVFDSPPMLPVVDALELEKLAGNLILVARGGQVSRREL
QVTLKALETVDANLSGTVLNYADSFSDDYGYGHKYGYGEQPPAARGQSRRTGKRG
>gnl|bykdb|A0A345NSU7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Ornithinimicrobium sp. AMA3305] (length=367 residues).
MLQMSGSAVSAETVVPAAVPGRPVEPDPERNLALGALAGLLLGVAFALARQALDQRVRGTADVEAISDRPVLSTIPMRKA
DDAHSIYLELDPFGPQAEAVRQLRTNMMFVDVTTGKHSFVISSTLPGEGKTTTAVNLALAMSDAGTKVLLIDADLRHPSV
GTTLGLEGGVGLTTVLLGDADVHDVVQPWGGNNLHVLTAGEVPPNPSELLGSSKMHELFERLSEQYDFILVDTPPVLPVT
DAMVIEKLTGGMLMVVASGETRKRHVSEAMRVLETTGTHVAGFVLTKAPAQPSAYYSYYGGEHASTRPDGPRKRKRRQGK
RDKRMSKSRPHAEAAASARAERAVDGGEALEFRSRARQRLDRRNGSG
>gnl|bykdb|A0A346XTB0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Euzebya sp. DY32-46] (length=559 residues).
MEEQLRRGPSLLESLWRYRVVVAGVTLFMGLLGYVVGLQEDVRYVAQGTLFLADPNLGDELQGIVSARISAEEYVPRQAA
RIQSRAVLQEAADLIDNRISVGELGSNFDIESSAETLEIVLVAEDETAEGAAELVNAVAEAYRTQKRAQEVQRAEDAVAE
LRAQQVRLEEERSGLQSSLEADSSNVALPFLIQSLDARILDISGRIDATLLAVRLRGDGVEDFQDAIPPDFPSRPRPRLT
ALSFAFLGGVASAMWAYWYAFKSQRVTSRTDPEIVLGVPPLGEIPLYRMTSEDQLTGLLRVDPSAAEAYEFVLSSIEFAL
ADLDGKSLLITSTLPGDGKTTTTLQLAIAASRDRRRVVLVDADIRARGLTRVLGADDRVGLSDLAAMDMEPNEVLRRYKF
SEQSQIPVVTAGQRRGDPAALLRTHAFRKGMERIVDSAELLIVDSSPLLAVADATIVAGSVDGIVIVVSHGTPFSELQKV
KERLKFVSTPLLGYVFNRSDSSTAGAYGYGYGVAEDDDGQRRLLPGSRRRNGGNEGTRGSHRDADRDADRDADPDGEGA
>gnl|bykdb|A0A346Y185 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Euzebya sp. DY32-46] (length=621 residues).
MEAVCLFCWQLWQGSQLERTSRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHRSGRLNPMDSLQAPATSVEAL
VGVLRSSIGRILLVGVAAGLLGFGLSALQSLRYTAEADLLLADPRNTGLFGETGVNFLDPSRYVRNQAEFAQSNAVAERA
SVLLGGRLDSDQVREQSRIRPASDLDQLSISATDGTASGAAQIANAIGEAYQAVVREEAERSTQASLSELQTQRAALEDA
IAAAEARLAASPTDASARAERDAAVSQLIMIDSRADQIAVDSTLFGSGVELFERADVPESPSAPTPVRNAVLACFLGALA
AAALAWWRADETATADGRNDPSRMLKAPLLGTVPSFEEIGLTGSVPTVEAPKSPAGEAYQFLVGALAFALAETGGQSVVL
TSASPVDGKTVTCLNLAVASAQDGRDVVLVDADTRVRGLTRRLGAKDTGGLPALADPRNNLSEIIVPLTADEGQYVPFIP
AKSLGDDTAAFFRTPGFRQAITRLREVADLIIVDSPPLLLASDASAIATNVDGIVVVVSRGTSMKLLEEMRERLDRIGTP
VLGYIYTKAKLDGAGYGDYAYRYGYSYAYGYGETPDDRRPQKEVKPRRRPGGRHREKATTK
>gnl|bykdb|A0A348NU28 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=352 residues).
MARSIEVTIPLNTVILEIKSSSGDPESAAEIANGVADSLTAVVREISPSSANGSSRISANLVDEAVVPNVQALPNKPRDA
LLGAVVGLLLGVLAALLWTLLDTRVPNETVLSQVVPAPVLGSISRVRGNGERGLYVAREPLGHTSEEFRRIRAALSYSGV
AEKVQRLMVTSVSPGEGKSMFASNLGLTLAGLRNNVLIIDADLRRPRVADYFGLEGSVGLTTVLLGDVSIEDARMTRPGS
TLDVLPSGSIPPNPAEMLTSDAMKRLLEEATARYDYVIIDSPPVMSVADANLLAPFVDGVIVVVDAGKTRRNQLIQAAAS
LESAGGRIVGLVLNKVRRKRKESAYYTANTDA
>gnl|bykdb|A0A349B7N2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidimicrobiaceae bacterium] (length=582 residues).
MVLGLTLGWVTTPSSAGPDEPDYYRATHTLVAETGTSAPPNLAQLSLLLRVGDVPERVAAEFGVEPDVLVSQVQVRQNPQ
VATLDITSVGTDPDRAVRIADGFAGALLATLTETTQQERAEAQTRLSARLDELEARLADLDAQIEDGAGDLVQAQRDALV
REYGIVYEDFQVLSREPEATVGLRTLQPAVAVPISGDAFVAALQETLGATDPSEPTAIEDGDPDEEDPLLEAFDAGPSEP
PSPARRGMLGGGLGLVLSVGAVVLFDRFDDRLRTKEDAEEAFGLPVVAEIPLLRRRQRRNSEVVSAERPRSRIAEAYRGL
RTSVQYMGVVTSRVGESPSDLRRQQTKRRDRSDGTVVLVTSPGPAEGKSTTVVNLAAAYAESGSRVLIVDGDFRRPAVHE
FLPEADVGRGNGLAPVDAPDVSGLIGRSHIPGVSAITHLDERLESVQPADLLSWIRSTVQQARPTSDVVLIDTAPFLTVN
DARDLLDVADQVVVVARSGKTSRQSADRMSELLARLSAKVVGVVLVGSGDTPATKRYYYSKDPTSEPLPPPTDGQEQRGI
ESDELDALDAEGELPEVHPADR
>gnl|bykdb|A0A351ETF8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidimicrobiaceae bacterium] (length=569 residues).
MSAAVVGVRPVNVAELQHVRGSFCMAEQPSNQDSSSLAVLDLRAHLAIVRKYWWFTVLVVVCAVAVAFLLTQRQERIYST
SAQVLLRSSENSFLFPFPATGPLALNREGEIETLYVTSPAFTEAALLKSPPEVKVAAAGTGSTLTFNARGAVPEDLAAAA
NVWAQTYVTARYAETLAQNVESIEFLQALIAEIAEDRDAIRVEVDFYDDLLAETTDPDEYSRYLSQMVSIETLLQPQLAP
LEAQISEYQRQITEFESVARFLDSPDVSAQVSQLAEVPTIPVSPNVTRNLVVAAAFGMALGIALTYLREVINDKIEGARS
VEQATGLAILGTIPGYQLNSDQVVEVIERPKSLAAERYEAVLTAIEFASIGEPVSSVLFTSAVPGDGKTTTAVNVAALAS
KYMNVLLVDGDMRRPRVHRMLGVSNSVGLSDVLAGEATRRDARQVFERDGIRFDVITSGSKVQDPALLLRGDRWTSLADE
LFLYDLVIIDAPPVLAVTDAVLIGRAVNGQILLTRLGATKRSDLAEAAKLLATNGSRSLGVVVNRDQESPDKYSYYGQYA
EQTAETADA
>gnl|bykdb|A0A357ZCV8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Coriobacteriia bacterium] (length=243 residues).
MARHRKVGREQESPGSRSEVQNAAKTLYANIRFLSPDKPIKSIAITSSVPNEGKSTIALSLAQAIATSGQTVLVVDTDMR
RRSLAHYMRLKPSVGSYAVLTGLAKLSDAVVSTPIPNLFFLDTEPNIPSPTDVLSSKSFAKLVEVLESNFEYVIFDTPPV
GTFVDAAIIGTLVDGVIFVVRPKHTKRKEMAFAYDQLGKADVHILGACANYRESVASESYYAYYSADGKRVKDRPAADAA
SQL
>gnl|bykdb|A0A357ZDL3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Coriobacteriia bacterium] (length=286 residues).
MSKKNNKSFSNNHEIQNAIKTLYANIRFLSPDNPVKTIAITSSVPNEGKSTIALNLAQAIAGSGKTVLLVDTDLRRRSLA
MYLNLRAPSGLYAVLAKQVALNDAVMTTQAGNLFFLDAEAGIPNPVDILSSNRFKALVKTLREGFDYVVFDSPPLGPFVD
AAIVGALVDGVVMVVRPRHTKRKDLLFAYDQLKKSESRILGACASYNDRASADSYYAYYTVTGHRVRDKYNEDGAYEFLG
GEQESVKVEGLSAAVALDTAAPDPAADYVSLAGKGGKKKSKKSRRA
>gnl|bykdb|A0A359IQX7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium] (length=496 residues).
MLRVGTLETGRPMTLLDFVRMTRHNAWLLLASVVLGLVAAAGYSLTQPTLYGSVSTGIVVAGNSNSIGDATAGMVLAEQK
AAAYTILTGTRQVSQDVADGLRSKYGKDVPFSLSPGVTGGSVLFTVTAIAPTPSEAKDAADLGLTATADAAARLESLTTT
GTPGQSVVKLQPYISAAESPNPVSPNWKANLPIGAIAGLVIGYGIAFIRRSIDGRVRTQAEVEELTGAGVIGVIPKVAEL
EQQRVEEGQVSLGEASEAFRHLRTNLRYVNVDSPPKCIVVTSANASEGKSTVAANLARVLAESGQITLLVDADLRRPSQH
RTFDLDGSVGLTQVLAGDVSIDDAIQNSELANLKVLSAGRIPPNPSELVGSQRMHNLLIALSENRTVIVDAPPLLPVTDG
GLLTAAADGAILVMATGRTYKEQLRVCARILKQVNGRLLGSVMNLAPLRGIGAVVYGYGYGTYTYSSKYYRYARDTAQQR
GRRAGKPKADRPARAK
>gnl|bykdb|A0A372P1T1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbispora triticiradicis] (length=468 residues).
MELLYYARLMRRYWPLLLLSVLAGVGTAHVVTVNTPPKYLASITMLVSADARDGGLSTALQAGALSQQRVQSYATLLTSR
QVVGRIARGEDVTDLQARITADAIPDTTLLRATVADSVPVRAAARANTLGATFAALIDRIERPTPKSPPTIRVTVIDEAE
VPREPVAPQPLTNMALGALIALFAAVSGLVLRDRLDTTVKTAETLQKVARSSILGVIGYERDAKRHPLILRDQGRSSRSE
AFRSLRTNLQFIGVDRQPKSLVVTSCLPGEGKSSTSANLAITMAQAGWRVVLVDADLRRPSVPRYLGIEGGTGLTDVLIE
RARLHDVIQTWGQQGLSVLPSGRIPPNPSELLGSRGMRTVLAQLTEEYDMVIIDAPPLLPVTDAAALGAICDGALLVVRH
GKTRREQVLRAAELLSSINARLVGTVLNFVPAKHGSYYGYGYGYGYGYDAAAQEATPETPQPQAPIPV
>gnl|bykdb|A0A3E2DN22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium avidum] (length=523 residues).
MTIVDVVRILRRNLALLVICTLAGGLLGAVYQLTRSETFTAKATGMVVAGDSTSVGEAMSGNAIAQQRAATYTKLVETRT
MAQKTSEILKKHGMPEAANGQVSASVPGDTAFIDIKATGGTAKNAQALANAGLEALISEALRMETYGQIAASDHKSDAQL
AKMTSVHVLGYESAGLPSGDRGKSVALYVVAGLAAGFLIGAVVAVVRKQFDVKVRDQATIEELTGSGILSVIPDDKKLAE
QREKSIVHISGVTGEAFRHLRTNLRFANVDNPPRAVVVTSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
FGAEAGVGLSQVLAGDVTLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLTELRKRGYFVVIDAPPLLAITDAG
LLGAIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLTRVPRKKMGDVLYGYGAANYGYGSYYGDYGKRGYSSYG
SEEQESRESIAVVQEAQPAEGLVRVPKKDRADTDTEITPRRAK
>gnl|bykdb|A0A3L7ADK2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycetocola tolaasinivorans] (length=528 residues).
MDAETNPDIVNDNDRSLRDFVRMIRTYWMGALLIIALSIASGAVWTLFQPQVFEAKATGIVQAPRGNDPSNAYSSEALSK
SQAASYATVATSLAVAERVEKAGVVKQSAGVLLGRITALQPQDTVLIEITAKGPTGDSARTLADAWITAMSEQIEAIQGN
DGVIGAQNTKFVSVSKAATPNSPVSPNVIIALVLATITGTLLAIAYAVIRQHLDRRIRSADVLEQRYGTSVLGTIPMNPF
LRKGSQLLSQLTETSTESRHASFAMAESLRELRTNLSYVDVDNPPQVFVVTSPNPGEGKSTLSANLAETLAVNSGKNVVV
IDCDLRRPTLSKIFNAVEGAGLTDVLSGRAELQQVIQPCGDSEKLWILGAGRIPPNPSELLGSRAMKELLAALGEQSIVI
LDAPPILPVTDAVVLANSADGVVLVASARNTTYEQFGRAQQLIKRGGAHLLGTVLNRVPTSGQDAHQYGYYGGTYYANEE
TPATTATAQPSDESTVVEGDSATPIAAATPLAAPEEATSRRTVRRSGH
>gnl|bykdb|A0A3L8NYD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola sp. 4Q3S-7] (length=533 residues).
MEAARVTVVDFVRLTRVNWRVIFATFSLGLVAALLYTLHQPVVYTATSKGYVAVDSGDSVSDVYSATSLAQQKLSVYVGL
VSSTAVAQDVIDSLKLDETPSDIASRFSAVGDADNPQLTIYATASSPSQARDLANAVIGAMSTEAAKLESAARPSGAPVS
TLVKLVATQQAGAPSAPSSPDYRINLLAGGIAGIVAGYLLALVRRQLDSRIRTVDDMESLVGTSVLTILPESDELDRVGD
DGLVGSQTGPAAEALRQLRTNLRFVDVDKPPQSIVITSANAGEGKSVVTANLARVLAAAGQKTILLDGDLRRPMVSTIFE
LDPVVGLTQVLAGDIDLRATIQDPGLPNLDVIAAGRIPPNPSELLGSQRMQSVIEELVAADYMVLIDAPPLLPVTDAGLL
SGIVDGSILVLAVGKTYKEQARLAAKVLQQVGGHVLGSVLNRAPLGGIGGVVYGYGHATHSQDYYSAYDRTGGDRSNGNT
LRARFLYRRMRRREEREQAQREQTLRERTAARENEHGQPPVELTSIAGKRRSS
>gnl|bykdb|A0A3N1NLD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB93] (length=540 residues).
MTVVDFIAFIRRNWKILVVAVLVGVSAMAAFSAVSPKVYDSSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA
VYERIESDPEANPGGEPLNGRLTAAVAPGSTLIEVTASASTPENAAALANGALAALADVIADIETQSTADRTPQITVVPL
ENAEPAAAPTSPNWLRNLLLGAAGGLVLGFVLAILRRALDIRVRTVDDLTQLFGVGVLGRIPKMGKGRVGRRGDARAVDG
ITAEAFRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVTADSGQRTLLIDADLRRPTVAKLLGIDGAVGLSE
VLSHQIPVEDAIRPTATEGLFALPAGHIPPNPSEMLGSSAMRALIERLAEDYFVIIDAPPILPVTDASIVATVVDGVVFV
VASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVSAQDGDAGYSYYYDRKNPYYAEPDGGRSRGRSAGRRAAAEEPARSLP
AVRPAEPARAVEPERTRAAEPERTRVAEPERAVEPARSLEHVVRAAPKAEVPSSFRRPAR
>gnl|bykdb|A0A3N2FVI8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB127] (length=564 residues).
MTVVDFIAFIRRNWKIIVVAVLVGVSAMAAFSAVTPKVYDSSSAGFVIAATDGSSADAISGAQTAVTRANAYLPLISSSA
VYERIESDPEANPGGEPLNGRLTAAVAPGSTLIEVTASAATPENAAALANGALAALADVIADIETQSTADRTPQITVVPL
ENAEPAAAPTSPNWLRNLLLGAAGGLVLGFVLAILRRALDIRVRTVDDLTQLFGVGVLGRIPKMGKGRGGRRGDARAVDG
ITAEAFRALRTGLRFSSVDDETRSVVITSANQAEGKSTIASGLARVMADSGQRTLLIDADLRRPTVAKLLGIDGAVGLSE
VLSHQIPVEDAIRPTATEGLFALPAGHIPPNPSEMLGSSAMRALIERLAEDYFVIIDAPPILPVTDASIVATVVDGVVFV
VASNRTRRPEVTAARRIVQQVRGRVLGTVLNMVSAQDGDAGYSYYYDRKNPYYAEPDGGRSRGRSTGRRAAAEEPARSLP
AVRPAEPARAVEPERTRAAEPERAAEPERAAEPERAAEPERAAEPERTRVTEPERAAEPARSLEHVVRAAPKAEVPSSFR
RPAR
>gnl|bykdb|A0A3N3ZPU0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria sp. M5W7-7] (length=504 residues).
MPQQDTSDEQYLDAPVHIAHRLRAVARAAGWYWKVALALIVLSVAAGAAIALLMPKVYSSTNTVMVVTGNSNTLGDYMTA
DSVSLSKADSYMQLGGSPEVAQIAAESLDGTPVHDVAFSVVPGTSQIKVEGRSDSPEGSAKVADAYAGALTQEVQRIESI
ATEGNNYEPPSPSPSEDGGEEASPESSEDGTGLVQVVPVSSASVPESPVSPDLRLNLLVGVGVGLLLAALYVLARSLFDR
KVRSSEAVANATGLAILGTIPLDKRLTAKRGVIPTAPPRKDREAWATSEAFRQLRTNLTFANVDDPPRTVVVTSSVAGEG
KSSVAANLAVTLGALGQPTVLVDADLRRPVQTELFGLTEGAGLTDVLAGAAELEDVLQDWEPGSNVHLLGAGRTPPNPSE
LLGSKTMRNLLARMGQDYMVVIDSPPLLPVTDPSVLAKGADGVVIVTQANKTNLDDLTKAVARLHTVGATILGAVLNQVP
RKGSGANEYGYYSDAYYYSSSSRH
>gnl|bykdb|A0A3Q9IY80 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium lemovicicum] (length=536 residues).
MELRTYLRILRAHWLGLIVLVVVGVVSAFGWTLLQPKVYSADASGIVAPVRTELSGNDAGSALVAENLAKAKVGSYLDLG
SWRAVAEHAIAELGLTSSPESLVNRVQVSNPTDTVNIRVVASASSPEGARDLAQAWIRAMATEVENLETSGGVSLATVQL
VPGDTARLPSSPSSPNVRIALALGALAGLVLGIAYAVLRYTLDRRIRSADAVEKETGLSVVGTIPDEKSFTADNRLLPVD
GISSGSHADLFGVSEAMRELRTNLQFMDVDNPPRIIVVTSPLPGDGKSTTSANLAITLAANGSKVVLIDGDLRRPMVATI
FRLVDGVGVTDVLAGRATVEDVAQRVGRKGNLLVLGAGKLPPNPSEVLGSERMKNLLRTLAKDYTVIVDAPPLIPVTDAA
VLSHSADGAIIITSVGKTTFEALTKALQNLERAGSRALGVVLNRVPRKGRGGYHDYRYAGDYYRSKGGEDGFDIDLTEDT
AGTMVSAGAPGAASTPSPSSATRPASGVTGSPAATGTATPTVVATDSTRRSRRSKR
>gnl|bykdb|A0A3Q9ULZ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium jensenii] (length=557 residues).
MTVIDFVRLLRRNLLLLVICGVVGMGAAAAYVFTRPVQYVAQSTAMVVAGDSSSVGGAMSGNTIAQQRASAYSTLIGTEA
VDNRVQKTLGSKGLSKAADGTLAAKVVSGTSFIKITATGSSALNAQSLANAALVGLQAEALRMETYTQAQANPGYTQAQL
EKLTAIHVLSYEPAGLPATPKQDNLLLYLALGLVAGLVVGSVIAVIRRMFDVKIRSQNDVEELTGRGVLAIIPEDRQLSK
QRKTGDLGLSGITAEAFRQLRTNLRFINVDHPPKAVVITSANPGEGKSTVGSYLARAVARSGQATVLVDADMRRPMQHTA
FGIDSRVGLSQVLAGDVSLSDALTPTDVPGLRVLVAGRIPPNPSELLGSVRMHNLISRLTKAGYFVVLDAPPLLAVTDAG
LLATSTDGVIMVHVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAPRKAMGDVLYGYGAGSFGYSSYNSYYTDKNGKKKR
RKKKMSLEEDYFGAVEPAPLGSHPTQDQPSSEGEQEDATSGGSQPSRAVRTNGSDTDQIPAGLRPVGPQPKPARRAR
>gnl|bykdb|A0A3R8RWC7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium paraconglomeratum] (length=575 residues).
MTIEDFLRLLLRNLLLLVAGLVLGAAAGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMAFQYQKAQSYLPL
FNTRAVGQRIVDELGLEASPDAVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEATAAEARELETGGNENAAVGV
QLTNYQNAVVPGAPVSPDREKFLLAGAAFGLLVALGLAWLRDRNDSRLRTADDVTDVVGLPTLGALPDAKELARGKDGVL
PEPASFPSREALRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTAYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYGALGGYDESAVVPDSE
EVDVEQAGGPAEPGPVSAPAAAVAAPDAPRPADTEAPRRAAQASPRPEAQPVAHPARAADESAPVEHDENEPEGDSAPAA
RTSPRGRRAASTWGR
>gnl|bykdb|A0A3S0V9U6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria sp. HSID16901] (length=470 residues).
MTLLDFIRLTRANIILLVVGILVGALVGYGTTLIQPKTYAATSSGYVTLGKSEDPTTGSAGEILSGDAAAQSKAKAYLPL
ITSAPVAQKIASSSKTSLDAAAIPSHLEPSVEDGSTLIRVRATASSPEDAVALANASLKATADTVNEIDGSRSVRVIPLD
DAQKPGSPVGPNVKKYVLFGAAAGLIIVYLVVFIRRFMDVRVRTTKDMEESTGLGVLGVLPKTNALDQNSFLEDAADHQS
AESLRQLRTNLRFVSVDQPPRSIIVTSPNPGEGKSTVTSSLAHAFAKAGQPTVLIDADLRRPTIAKIFGIDSGVGLSQVL
SGQVGIEEAIQRFHESELYVVPAGRIPPNPSELLGSAKMRKLIEELAREYLVLIDAPPLLPVTDGSLLSTSVDGAILVTK
VGSTRRDQAEGAKAMIDKVQGNVLGAVMNMAPAKGIGSQYYGFGYGGYRSEYKSYYGRSGQGSESAGTKK
>gnl|bykdb|A0A3S9JFL2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium acidipropionici] (length=544 residues).
MTVIDLVRLLRRNLALLLVCGLVGIAAAAAYVFTRPVQYVAESTAMVVAGDSSSVGGAMSGNTIAQQRASAYSTLVGTAA
VDNRVRATLNKQGLSKATDGTLSAKVVTGTSFIRITATGSSAQNAQALANAALVGVQAEALRMETYSQAQANPGYSQAQL
EKLTAIHVLSYEPAGLPATPKTANLPLYLALGLLAGLVLGGVISVIKRMFDVKIRSQKDVEDLTGHGVMAVIPEDRQLTK
QRKSGDLELAGIAGEAFRQLRTNLRFINVDHPPKAVVVTSANPGEGKSTVCSYLARSVARSGQATVLVDADMRRPMQHTA
FSIDSHVGLSQVLAGDVSLEDALNPTDVPGMRVLVAGRIPPNPSELLGSVRMHNLIARLTKAGYFVILDAPPLLAVTDAG
LLATSTDGVIMVNVVGGTHKEQVTLCTKRLEQVGAVLLGSVLTRAPKKAMGDVLYGYGAGSFGYSSYNAYYTDENGKKKR
RKKRMSLEEDYFGRVELAPVNSRPTEDEPTPSRVTSSSASRSQENRPADLTPVGPRPRPARRAR
>gnl|bykdb|A0A412JBM5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Olsenella sp. AF21-51] (length=274 residues).
MMGMAMSHELKRESGHMRPACDRKLLTYDSPFAIREAYVRLRTNLMFCVNGDGDPCTTFLVTSGSPSEGKSLTAANTAIS
FAMLGKKTLLVDADVRKPSQQRLWAGRNTSTGLCKYLVGLGELGLASIEGIPLDIAFCGVIPPNPSELLSSTRMKRFLEA
SRKAYDYVIVDTAPINTVADAQILSPLVDGVILVALSQKSTRGELNAAIDSVSRAGGNLCGVVINGMDMKATKYSYRYKY
EDKYGGAKDYGYGYGYGYGNSGHRRQARGRSGQS
>gnl|bykdb|A0A419GS64 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gaiellales bacterium] (length=228 residues).
MAMKTKSRGSKYLYTKDFPASVLAESYRTLRANILLTNVDSEIGSVVVTSPDRGEGKSTICANLAIVMAQAEKRVLLIDC
DLRLPTQHELFQITLDHGLTRMISTYDEGDDPFAFGDQVMDGLTVIGSGPPPPNPSEIISSRRFRKFIKNASAAYDTVII
DTPPVGIVSDAAIISTMVDGTILVLDLKGGHRNMSVRAKKTLEKVNANILGLVMNNLKIDKDARPYQY
>gnl|bykdb|A0A420ZS11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinophytocola xinjiangensis] (length=236 residues).
MARKNKTNQPDMSEKQRSLITEFDQRSPVSEQFKTLRTNIQFSSIDRKLKTIMVTSSNPGEGKSTTVANLAVVMAQQHNR
VLLVDTDLRKPTVHFTFQVPNHVGLSNVVTGQSTLDEAALETSIPRLDVLPSGPVPPNPSELLASKAFERFVKSVSDAYD
YVIFDAPPVNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVANLKKVEAHLLGTVLNDRAVEKSNYYYYYTEGN
>gnl|bykdb|A0A433ECD0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HSID18069] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A433EDP2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HSID18067] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNAENGNTAGANASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A439DNZ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium elephantis DSM 44368] (length=423 residues).
MISYTELLMGETLAQRTIDKLDLEMSAGELQNKVKASSKLDTVLINVSVLDESPVRARDIADALSEEFVVMVRELETPPD
GTRPDARVIVEQRASIPKSPVIPKTARNIALGLALGLALGIGLAILRDLLDNTVKDRQNLEEITGVGVVGSIPLDKERKR
SPAKSLDNDNSAFAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPGEGKSTTAINLALVLAEAEHNVVLVDGDLRRPRLDKY
LGLVGSVGLSTVLAGRASLEDVLQETAFPGVTVVTSGAVPPNPSELLGSLAAKKILDELRTGFDYVVVDSSPLLAVTDAA
ILAAASDGVLIVARYGETKREQLAHAVGNLRSVGAPILGAVFTITPTRGGASDNYSYYGYSYGDGTSNSAVATTPRMKVM
RRLRRYRPAYQSPGTDPASENEN
>gnl|bykdb|A0A444BL03 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Phycicoccus sp. CMS6Z-2] (length=473 residues).
MTLLDFVRLTRTHLLFLVVLTLAGGAAAYGLTLRMPSVYLADASGYVRIDGAGASTGESIAANSLGGSKADSYLPLVTSR
AVAQRAITATGIDASPEDVARRVTGTVAENSVIMQVTATGPTPDESRRLADAVIKATAQEANRIETTGSNAKNIVTIVPI
ESALPGRRIAPDPPRNVLIGIGLGLLVAYLLVFVRRQLDTRLRSAQDVEAATGASVLGVVPVTSELRVQGGRGRLDHLGI
ASESFRQIRTNLRFVGVDDPPRSIVVTSANAHEGKSTVSSTLARVLGEAGQRVVIVDADLRRPTLAKVFEAPGSIGLSHV
LTDQVDLEDAFQPTDQENVRLITSGRTPPNPSELLGSARMHELVRELTVDNIVILDAPPLLPVTDAGVLSASCDGSLLVF
AVGRTHKEQAELAARMMGQVGGRVLGVVLNMAPKRRAGGVMYGYGYGGYASYASDTKTRKDYAKAASRGKHAE
>gnl|bykdb|A0A448PRK6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=510 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAASSNGGN
NATPNAENGNAAGASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRTRD
DAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLARSM
AESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLVRE
LSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGFGY
ANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|A0A448USF4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVRASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|A3TMH6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter sp. HTCC2649] (length=516 residues).
MTLNDYLKAFRRRWLVIALCAVVAGAVMWTVTPAHPEVTRSTGSYTATATLLVERTEDVNSQLGRIALFLTTGDIPRGAA
KRLGYPGDPALLAAGLTVKPEFIATALTVSATASDGARAAAVANAFADEAVSFFDTPRPGTGTVGITVLQSASPIPNADG
GGFVVPPSRPVRAALSAVLGLLLGLALALVLDRLDSRLRTREEIAAALALPIVAEVPRLGRTKRRDKTIGVAEQPLSPYA
DAYRGARTAIVHTASQRLSVGSAPRHLLDGPATQLEGARVVLVTSAHPAEGKTTTVANLAVSFAESGQRVLVLDADLRSP
DTHTLFDVPQGAGISDYLSRHNESSLEALIRPTSIDGVRIMTAGTRLSHPASLASLMGGLIAELRDLADVVLIDTAPLLA
ASDVFDVLPVVDTVVVVVRHGRITDVAGRRVAELLGRFHVPVTGVVIVGAPTRGAGRYGYGYGSGYGQGYDAERSKGIRR
VLPGRRGTTDGSSTPPHPAESEPGAESRRDRRTTSA
>gnl|bykdb|A3TMK0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter sp. HTCC2649] (length=518 residues).
MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYTATATILVGSKDPEATGSNLGRIALYLTTGEVPKR
AAAVVKFEGDPALLARGLTVTPDTVSQALMVSATASDGKQAAAVANAFANQTVLFIEQARRPGAENATLSVLQPATPIPS
ATTDGGFVVPPGRGPRTAMATLLGLLVGLGAALVMDRLDSRLRTRADIHSALRMPIIAEVPRLKRSQRNRATLGVLEDPL
SLYADGYRAARTALTHTAGQVMPGDYSPRRSAIEPRRPANTARLVLITSAHASEGKTTSVANLAASFAETGQQVLVLDAD
LRSPDAHNAFDVPQGAGISDYLTDPGEGSLSAVVRPTSVPGVRIITAGTSLAHPASLASRMGHLLEEARDMADVVLIDTA
PLLEASDVFDILPMVDTLLLVVRHGRLTEVAGNRVAELVGRFQVPVSGVIIVGAKAKLGDTYGYGYGDARKTKKKVKRGR
RLADQRRPAAPVVTESEPDDFLDDASRESRRTRRASSA
>gnl|bykdb|C6R548 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa ATCC 25296] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTTNNTVRVIPLNNASVNPPLVAPNYQQNVLVGAVAGLALVYLAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LSEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAASTLKKVNANLFGMVLNRAPRKGLGNSYYGFGYASSYVGYSTYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|D2NP38 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNNPELSMTTGQIRASLTATAGDNAALITVSAQASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGENTG
ASPTGGNTVRVIPLNNASVNPPLVAPNYQQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEENIVNGNTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEAANILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKDGDK
KSSKKSSAKK
>gnl|bykdb|D8USQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa M567] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|E3B8H1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Dermacoccus sp. Ellin185] (length=558 residues).
MTILDLVRIIRTNLKLLLLSMLLGIVVAAGYTLTRPVEYQATSTAQIMAGASNDASAAMVNQQLANQRSGAYAQLASGSG
VADRVVALSKGALSPGDFVLAGAGSEGTSNLSLTASSSSAAKAQQAANLAPAALSQEIKHIETLNGAKSTVYDAYPLSRA
GLPASQTSPKWPVNLLIGAFLGLVAGTVLVVLRKQLDSRIRHTSDLEKVTGVGTLGVIPKAKNLQTKSRGGLGALGSTSE
AFRMLRTNLRYVSAEQPPRSLVITSAVQSEGKSTVASNLARVLAAAGQHVVLVDTDLRRPVIHETFDVDNAVGLTEVLTG
QASLRQAIQPGDHKNLSIITSGRIPPNPSELLGSRRMSAVIDALEEEYFVVLDAPPLLPVTDAGLLSVAASGAAVVYHHG
TTHKEQIALCTKILDQVGAHYFGSILNMTPPRSMGSTVYGYGAGNYATAGYGYGYGYGYGHTDESDEASALTPAHELADI
TLHAPESTPAAGPQVDRGNAGVPLDTTRHDPMRGESSQAPSASANVERAPRQATPATSDSDGAPPSRRARRFRANDDA
>gnl|bykdb|E3H5W1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia dentocariosa] (length=502 residues).
MTILDFVRTTRANLLLLIAGIVIGAIAGLSYSLLQPKVYAASASGYVTVGQSGTIDVLSGSNAAKERARSYSAIVSSEAV
AKIIQEQNSDLSIGTIRGSLSATTEENSSLIKVRATASSPEQARVLANSALHATAQYIENIEKNGSGNNSTATPTPAGEE
NQESAQNKVSSTNPSDTTNTLIRVIPLDNASVNPPLVSPNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRIRTRDDAIKAT
NSNILGVLPVSDDLAEENIVHASNDDHIAHESIRQLRTNLRFVNIDNPPSSFIVTSAVPGEGKSTVSLAVARSMASSGQP
VILIDADLRRPTVAKKLHINAKIGLTQVLAGQVDIAEAVHQVEDSKLFVLPAGRIPPNPSELLGSDKMRQLIEELSKEFL
VIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLERVNSHLFGVVLNKAPRKGLGNSYYGFGYANSYVG
YASYYGYSKDGKKKVSSGAHGA
>gnl|bykdb|E6S8H2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Intrasporangium calvum] (length=519 residues).
MTLSEYLKVFRQRWLIIAITTLVAGAVMWVTSPAVADTSQKASSYTATATLLVTSTETDSESPMGRIALYLTTGEIPQRA
AAELGYTGDPAVLASGLTVTPDFSAGALTVAVTDAEGKRAASIANTFADETVTYFKKNRPGVGRANVSILQRATPIPNVT
GGGFVIPPDRTTRTALAAGLGLLLGLGLALVLDRVDSRLRTRSEIAAALRLPIIAEVPKMSRSLRRRRSIGVADEPLSPY
ADGYRGARTALVHTSSLLVQGDDRRPTSPPEPVSAASASLILVTSAHPREGKTTSVANLAASFAETGQRILVLDGDLRSP
DTHNIFDVPQGAGISDYLTGPDDTPLGSLIRPTNVPGVRIITAGTRLEHPASLASRMGGLLTEARGLADVVLVDSAPLLA
ASDVFDVLPLVDTVLLVVRSGRLTEVAGHRVSELLGRFQVPVAGVVVVGAQSKRSAGYGYGYGYGYGYGDKKKGKARKRL
PSSAVQGPPELSEERVPESRSARREASRKRSSRRTSSSA
>gnl|bykdb|G5ET14 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia mucilaginosa M508] (length=490 residues).
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSITAAAGENAALITVSAKASSPKNAQLLANGALQATADYIKEIEQNPGNAQALVNGDSTA
ASPTGGNTVRVIPLNNASVNPPLVAPNYEQNTLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPVSDD
LNEDNIVKGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
AKKLKLDAKVGLTQVLAGQVEIANAVHQVGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
KSSKKSSTKK
>gnl|bykdb|G9PHS6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces graevenitzii C83] (length=639 residues).
MTRVNLGFLILCVLLGLAGGFGYASAQPWTYTATSQAMVVVPGTDAFSQNSISGQKASVYAVLAGSQNVANRVAKTLKTS
NMEGTLSGSADAVPGLFTLTATASTPERARDIANAGIKAVSDEANAITTLNAPTVQPTTKTTTNPDGTQVTTTTQSVDGT
TNVTTTDNSYRETRVTQTLQAVAPSAPSSPDFYKLSGMGALAGLVIGYLVVFMRRLMDNRVRHNSDVEELLGSSVLAVVP
KSTELNAKGRQNVDGLGQAAEALRHLRTNLRFVDVDNPPRAIVMTSANPGEGKSTMSAVLAQMLASSGQRTVLIDTDLRK
PVVHKIFGLDGSVGLTQILAGDMQLSDVAQKIEGQPNLRVVPAGRIPPNPSELLGSQRMKALMDYLKDDAMVIMDAPPLL
PVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASRRNLGSVYYGYGYGGYGQNYYYYEEDEK
RKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRV
STVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
>gnl|bykdb|K6WHS4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia namibiensis NBRC 108229] (length=411 residues).
SASYQNSLASAQRVASYAELVDSDVIVSRALESTGVGLKQDEAKDSLSVSTSPDTVLLVVTAENANPDLAARLASGVSQA
LIEYVEVLEVPSAGGDPLAKLTVVSPATVDDAPVSPRYGRTVLIALTLGICMGIGIVVLVERADTRIRSEDSVLEVTELP
ILGDLPDDPAVDRNVVNFGVGGSPAAEAFRHLRTNLSFMDVDSPARMIAVTSPSPGDGKTTVALNLAASLAEAGHSVLLV
DADLRNPSVAGRVNLTGSVGLTTILSTGATLTDCIQHSSVAGLDVLPSGPIAPNPAELLGSRKASDVFGSLRDSFEYVVV
DTPPCLPVTDAQVVSRLVDGVLVVVRIDKSAKHELSDTTRQMDTAGVHAMGVVINGTPVRQSPYRFRYYGVNVENNADDM
SVDKVGTSSAS
>gnl|bykdb|N0E4U7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera elongata Lp2] (length=531 residues).
MTLRDYLTIARRRWPIIVACALVAAAVTWFLTPAQTDEAEVAPSYTATATLLVGSGGPPELVSIDRLALFIKTGEIPSRA
AKVLSFDGDPALLASQITVTPDPAAAALTIAASAPDGERAAATANAFADETVAFFEKGAPGTGGAAVSVLQVATPIPDQI
GGGFVVPPSRPLRTAMAAFIGLLLGFALALVIQRVDSRLRTRDEVHAALRLPIIAEVPRLSQAQKRKASIMVAADPLDPY
SDAYRAARTALMHTVSRKMTGDYTGRRAATAERGGTATGARLILVTSANAAEGKTTTVANLAASFAETGQRVLVLDADLR
SPDTHSLFDVPQGAGISDFITDPGDVPLEALVRPTSVPGVRIITAGTRLTHPASLASRMGHLLEEVRGMADVVIIDSAPL
LAASDVFDVLPIVDTVLLVVRSGRLTDVAAHRVAELLGRFQVPISGVVLVGARGRRADGYGYGYGHGDTKKRKGARSARV
EADRSLRPTRADASTQFAGSEDGARPFSPQADGAPDDAALSRRARRTSSSA
>gnl|bykdb|Q6ADE8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia xyli subsp. xyli] (length=250 residues).
MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLREVLQDPDVSLHTHIRVLTAGR
TPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTG
VVLNRVPRRGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPA
NRGRRAARHG
>gnl|bykdb|R4LD52 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinoplanes sp. N902-109] (length=468 residues).
MLAALVLGALVTVQTAPRYATSVTFFVTTPNTGVTDAYQGGLFSQQRVKSYASLLVSDRLAQLVAAEPGVGLDARHIRER
VAAQAVPETVLLQATVTDTDRDRSARIATVLAGQFKQLVESLETPPGKQVSSVKVEVVAGPELADAPVSPRPVRNLVLAA
LLGLLTGAAGAVLREVLDTTVKTVEGLQALAAAPVLAAVPFDDDAKEGPRALLGTGHSARAEALRQLRTNLQYVDVDRPV
KTLVVTSAVPGEGKSSTACGIAMLFAQAGQRVLIVDADLRRPRIAEYLGLEGAAGLTTVLAGKAAVDDVLQRYGDHLWVL
PSGFLPPNPSELLGSQHMALLMDELRTAFDTIIVDCPPLLPVTDAAVVAARADGALLLARSHKTTTAQVSNAVTALQSVD
ARLLGCVLNMVAAKGPDAYHYYDEYSTRGRGSRRAGPVAPVRVAVGRLPELMGAGRPGKERSKVGSAS
>gnl|bykdb|R7Y679 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia terrae C-6] (length=265 residues).
MFGRSRLGTRIRDEGDLDDAIGVHSLGVVASDGAFADRSLIDFRAGGSSTAEQFRKIRTNLTFANVDNSVRKILISSPSQ
SEGKTTTSLNLAASLAELGKSVVLVDADLRRPAVASRLQAVSPDIGLTDYLRGSAPVGDVLQRSGVGGFDVLAAGALPPN
PAELLGSRRTGQLLDELCELYDYVLVDSPPVLPVTDAVVVSQWVDGGIIVVRAGGTTRQELVASLAQLHASRVSILGVVL
NGVNLKARDNRYGYYAQASREGVTA
>gnl|bykdb|S3X7T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium sp. HGH0353] (length=426 residues).
MVLGGAVGEDGIAGGVLGIGRLHGYFHPIRDGLAHPSNTLDPTQPLATAHSYRLFRDPATTIARNIANSVISESSKQVKS
LEGKNSPVQVVMMTPADLSQAKKAPSPAKYIIAGLLAGIILGYAIALIRHLADRRIHTTDDITDRIEKPIFATIPTSSTI
ETLSTDLTDDFKAAEAIRKLRTNLRYALIDSTSKVILVTSSVMGEGKSSVAGNLAKVMALAGDDVILIDADLRRPKVQKN
FDLDDGLGLPEVLIGAAPLDQALRTTPTTDLSVLPCTDTPPNPSELLGSEHMSELLSFLAQDHVVIVDAPPVLPVTDSVI
LSQLADTVIVVAQVGHTTVDQVESAVSSIENAGGMVSGIVLNRADSSKLSHLRYGESAYGYGYTKYDSDYSSSPATASQP
TPQKQETSGSKSIPRRATSKHHNAHV
>gnl|bykdb|U1PLM7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces graevenitzii F0530] (length=638 residues).
MTRVNLGFLILCVLLGLAGGFGYASAQPWTYTATSQAMVVVPGTDAFSQNSISGQKASVYAVLAGSQNVANRVAKTLKTS
NMEGTLSGSADAVPGLFTLTATASTPERARDIANAGIKAVSDEANAITTLNAPTVQPTTKTTTNPDGTQVTTTTQSVDGT
TNVTTTDNSYRETRVTQTLQAVAPSAPSSPDFYKLSGMGALAGLVIGYLVVFMRRLMDNRVRHNSDVEELLGSSVLAVVP
KSTELNAKGRQNVDGLGQAAEALRHLRTNLRFVDVDNPPRAIVMTSANPGEGKSTMSAVLAQMLASSGQRTVLIDTDLRK
PVVHKIFGLDGSVGLTQILAGDMQLSDVAQKIEGQPNLRVVPAGRIPPNPSELLGSQRMKALMDYLKDDAMVIMDAPPLL
PVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFKQVDGRLLGVVLNRASRRNLGSVYYGYGYGGYGQNYYYYEEDEK
RKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSRRSSRRAARSEAPAQVPAQLPAATITSSPVSSRTSAASPRVS
TVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMPVPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
>gnl|bykdb|U7V3Z1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia aeria F0184] (length=512 residues).
MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAV
AKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGN
NATPNTENGNTAGASASANTAVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSFLVTSAVPSEGKSTVSLSLAR
SMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQVDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLV
RELSEEFVVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYGF
GYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
>gnl|bykdb|W6JTW4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera australiensis Ben110] (length=529 residues).
MPLREYLRILLHRAPLIAGATVVAGLLSWFLVPAGTQNAPRSYTATAQMTVDGGEERVTVGLPRIAFFITTGDIPQAAAD
KLKYADGPFALARRIVVAPDPAASTISISATDPHATTAESIAQTFAEAAKAYFAKASPSGGTRLTIVQDAVAVPDANPGS
ILPPGRPTRTALAALIGLLFGMALAVFVDRIDSRLRSRTEIQAALGLPIIAEVPKLPRAKRSDAYHMVLDQPLSPFADAY
RAARAATTHSVETSRAAAPRGPRENDPEPQAVAVLVTSAQPSEGKTTSVANLAASFAESGRRVLVLDADLRSPDAHNLFD
VPQGAGISDYLVDSALEHLQQLVRPTNMPGVSIIVAGTQLDHPTSLASRMGPLLEEARGLADVVLVDTAPLLAASDVFDI
LPLVDTVLVVVRSGRITHAAGSRLAELLGRFKVPVSGVLLIGSKASRSRSYGYGYGYGSPRSTSKKPRSGGHGPRSAHGT
SASRRDRLGRAEAPSTIRGGGEARHDAAGPRPAVVEASPDDSVSDRSGG
>gnl|bykdb|A0A3C0CSI4 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=450 residues).
QEIDKLNSTRAELLQEYIPSSREVKKVDGQIEDAEQRLKKVAQTVLSTTTNSRNPLWENLLKDFSGSIAESSALDTKVQV
LNRCLVQREMDFKVLPELERELTTRIQNIAILERTYDMLSQKYYTLLLSEQSMLPNGILISKPRVPEAPSYPRTDRNIAL
FAMLGIMLSVVVAIVVDRMDIRVHDPSVMAGIADLPSLASIPFMDNEDAAYKQIGKLKHNSIFLESFRILRNNIMFSAID
NPLKVLAVSSPGPGEGKSTLAVNLAIAMAMDGKKVLLVDCDLRRPSIHNWMSLSREIGLTNVVKGLSNIKDAVCSTDIEN
VFCLPSGPLPPNPTEFLNSKHSRNIIKELSGMYDMLILDCPPCTGLSDVQVISTMADGVLLVVTINRTLKTYLHMALSTL
SQVKAPIIGYVLNMVDSRRQGYGYYYNYDYDEQGGRNKSKRRCCMPKSKN
>gnl|bykdb|A0A402CP56 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Capsulimonas corticalis] (length=713 residues).
MQSEPLLIESEESQPVMSPQDYVSILRRRRNTIVTTWILISAFGIIVTMATRNVYQATAKLLVDGPSMMVSQVESDNNLA
SLFNIGSEQTVDTKVEELQAGPLINTVDKLSNHAKLTVTAVKGTNVIDIVGESTDKVAAAAAPNTLIQLYLQTTAETDLQ
EVHKAQKFAQKQMTDAQARLDKANRALELLKQKHGFVDIAKSRDDQIARVSSLTQQLQQARAELAGARAQVSGLSNLVSA
EPATLDVQLRQTNTEIAEIKSKITQRELDRRQMTLPGGFTAKAPQVRALDSEIAGLKSQLAALPAVSTTMTSNPNTVREN
LRAKVASSEGDVASLEARVLETQTLLEQAKSELATYPSLEAPAEQYQNEHDTALASYQMYATTLQNLNLREQARHVSAHV
IEPAVVPTEPIRPKRLLNFLFAIIMGGVIGILMALLQEYLDDRLNSTEDAERLLGLPSLGRVPQLSRDDALLLSNMSGPH
PELEAYKTLRTNIHFAAIDTPFRSLQVTSSSPGEGKTTTATNLAYAMAADGKRVILIDTDLRRPSVHKHLDLAQTPGITE
LLVGDATLHEALQVSPNFPNLSVLAAGTIPPNPSELLNSQKFRTLVDQLSARFDIIIFDSAPVLAVADAQIVASQADGVV
LVVANGETRKAAAKQGLNLLRRARANVIGVAFNKMNVKDNMYYYRYTAETSTEALPGRNGHSTRQIETEGTKK
>gnl|bykdb|A0A015VNG0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3996 ] (length=702 residues).
MAEVVKRLNLDMSYFQSGKFHRQVAYGLTLPVTVSMNDFPENESAEFILEVKPDRTVILSDFTRNDETLDSDEIKGILLD
TIATPLGKIIVEPTLNFNEEKTCLLHVFRNKLYDAINNYSENLSVTLNNEKASVIDLSFKDYSIQRAEDVLSMLISVYNE
NWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQSSQTNAQILALNNQLYMTRYIRS
YLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQALASMRGAIIKSIDNQIVTLNAQI
KSLQQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTRIVTPSHGSMLPTSPVRRNIF
MVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFARKKKGLFGKKPQEVKAIVVKEGSRDIINEAFRVL
RTNLEFMTGKDKRSNVIVVTSFNPGSGKSFLTMNMAVSFAIKGKKVLVIDGDLRHGSASSYIDSPAKGLSDYLGGRIDNL
NEIIVADSKHESMDILPVGTIPPNPTELLFDERLKQVIDTVRERYDYVLIDCPPIELVADTQIIEKLADRTIFVVRAGLL
ERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGYGYHYGSDEKRGG
>gnl|bykdb|A0A069ZM60 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. KLE 1280] (length=796 residues).
MSTQTNRSNQAGEKAAEVNLLDIFFYLLRFWWLYLLSVGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDTEMLRY
ARAARLNMDNEHVQLVSRRVLERTVKMANANVFYNVKSGLRTLELYSDAPFSMKFLDTTERKSTYEVAFQDAGHVRVTPV
HTGKSQVVPLNVPVQLGDERFIIEPHQNFNTPWEYKHIEVNRMPFTQTVRYYQHAILVAEPENRASTLTLRLQDRTKKRA
LDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDIQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPISPNTLRVVLIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPREEKRGGKKSQPRGVREQGGD
ETSEAFRVLRENMRFMIGTGGKKAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|A0A076IRY8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A078PL82 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3725 D9 ii] (length=789 residues).
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A078QKV9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides ovatus str. 3725 D1 iv] (length=789 residues).
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A081PBV5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter antarcticus 4BY] (length=794 residues).
MDNLNNINLMPKAKEEKSINLLDILKYLLFQWKWFLLSIFIFGGYYLYQYSKTPFIYSRSETIMIKTPLNTMPGTRITRA
NYYNTVNVASEILQLRSKELMRKTIDRIEGDISYTVKKGLREYELYKDAPVKVQFIDAKPEVGFSLQIEAVDQDHVALSS
FSKGNTSQVLKIKLNQTVRTPIGLLKVTRSPGYKVSDFDKPVIVRKYPREAMVGYYMANLKIQQMEEDASLLQVFVEDSS
LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQSELGSVESNLENLKVSNQGIDVNAASQMYVSEGMMHES
AGNDVQTQLKLVEMMQNYMRDADKKDDLIPNNTGLVDVNIENRINEYNTASLRRNRLLEGSSSENPIVQDLNITLAAMRK
NIYRAMENAVSGLQIKINNLKKEQTQARNKAMAVPAKQRMMLSVERQQKVKEELYLLLLNKREENAINQAMTEDNVRIID
PASGSDAPIYPSRIKKLALGVGIGIALPAIVFLLMLMLDTGVRSRKDIEEVLSVPFLGEIPFTLKDKGGEAVVEEKGRDY
TSEAFRILRTNIGFMAAGKEQRVITFTSFNIGAGKTFTAINLAASFRYLNKKVLLLDLDLRKGTLSNRVNAQKEKGLGVT
NFLANPKVTVDDIIYQGLVGGIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYDYIIVDNVPVNLVADASIVDRISEL
TIFVVRSGKMDRRQLPEIQSLYDQRKISHMAVLLNGVRLNKGGYGYGYGYGYGYGYGYGNETKKTIWDKLFGKR
>gnl|bykdb|A0A0A2DQN2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. COT-239 OH1446] (length=789 residues).
MIRQVSDVNLLDVLRYLVSYWKWFVLSVLICAGYMYYRSAQQPYTYMSEVTVIIQDPSQRTSIDFDFINPRQRGRANIEN
ERLILRSQRIIENALKKIDAQVSYKYKKEFRMIELYKASPIRVSFVDSLELYDSFFVSYKDENQVSVSYNEEEHIFLLGD
TISIGKNRLIIEPNPNYTSPWIARQIQVSRVPVPALAVAYQGSLSIGQPEGRATILSLSITEASKQKATDLLGALVEAYN
EEVNTLRTQISVNTTEFINNRLISLEEELESMENNREELLIENQFINPASLAESYMNRTQTNQNGRIELEAQERLIAYMQ
SYLKDASKTNEFLPLNIGIMSPALDESIGQFNQIKQERDLWMQATGASQDNPIVERYNQSMHVARAAVARALKDAAAAIS
IKLKEMRYQDNQAYAELVTLPPKERQWLDAERQYKMKEALYTQLLSKREENLFAQTITNNNAYILDLGVGTSAPISPVPS
RSILLGIVLGLFIPAAYAILKLLTDTKIHSRRDVVDQVSLPFLGEIPLNTTKKGGEGIGVSEQGTDLTSEAFRILRSNMD
FMGQNGVMPKRIVLTSFGAEAGKSYISYNLAKSLVFAGKSVVLIDIDIRKRTLTRKLNFEHNMGLTSYLSGMDVSIDELI
QQDPNCEMLSIIPAGTIAPNPTELLLSKRLDSLIDELGRRYDYVIMDNVPFGVVADASIVNRAADLTLFIIRAERMDRRM
LPELERLYQEQVLTNMAIILNGVNHNSSSYGYGYSYGYGYYGYGYGYGHLGKKSLRKRFVERMKMFFVS
>gnl|bykdb|A0A0A2EYC8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium COT-184 OH4590] (length=813 residues).
MENTNNIPNIQTFSEEEASSFNLMEWVMRFLKYWYLFAIGVVIALTIAYYQNRSFVPIYNSSLRLLLKQESGSFLSMQNF
NSGFSRQDQTNIENQILLLQSQDLIGRTIDSLPNFKIDFYRKLKFKNRPMYGRSPIDIEIISTPDAGFWQYYLYQKQNDN
EFTIKIFDNEDVELETVKGRYNEPVGCKYFLIKVTKNSNYHSANSVNFVFRNRDNLVMEFASKLQINLLPNTSVLNISVA
SDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVISDSLSRSESNLNSFKIANKMYGQNNSILLTNKMEAL
EEQGKIIKLRDEYFKYLRNYLKNNIDSESLASPTTIGIQEPRLIALVDKYNELQIKLLDLGVKNPQYDIVFNQISQTKAQ
LNELISSVSDIYKIESDAYQKDLNELNNLLIAAPNKELRMLDYERRYKINDSYYTFLLQKRSEAQIRKASNSPDNAVMQK
ARTMSLINAKEKQNKYIVFLLIGLAVPAALIILKELLNNAIRTEKDIEKAIKNKFQIIGTVRHTKHKADEKVIAAKYPNS
YFVEQLRVIRTKIELILKRKERITMLVSSTESGDGKTYISLNLAGVFALQKKKVLLIDFDIRKPNLTRNLGDIIKTKSGF
VNYMIGDCTIEEAIESTPYGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYDYVVIDSSPLGLVADAYALFSTVDIKL
LIVRSLKTNKVEFTDLAKRLYADNVEDIYVILNDVDKSKVGYGYGYSKYKKMGNYYVTEEFEQDDISMLEKIIDKIGEKT
KRIRNIHSSRLFK
>gnl|bykdb|A0A0A2F2N5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. COT-290 OH860] (length=792 residues).
MTPQSSSKQTKSAGTVVADINLIDLFFYLLGYWKWFLLSILLCTGYMYYKSAKQAYTYESVVTVIVRDPAQRTSIDLDLV
GRRSRVNIENERLQLRSRVVIANAIKAINGHVHYGIIDGLRPIELYKSAPIQVTFADSLDQYHQFEVTYKDASSIVLSRE
GGETKQVQLGEEVTYEKSRLIVVPSKGYNEPWPNKAIKITRLPVKDLAASYQGRLFIGQPENRATVLSLTLTDNSKQRAT
DLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLSEELDALASNIDSFQRANNFIAPEVVAGAYTSRAQTGHEASFEI
DAQKRLARYFLDFINNPSKRSEYLPQNIGLNNAALETAITAYNQVKPEYDRWLATTGGMEDHPMVQKYAKAMEQTRMSIS
HTLEGYIKSLDLQLREIEIRNRQGLAEMMAVPNKQRQWLDIERQQRMKEALYTQLLSKREENTLAQTAQSNNAYVMDFDT
GSNSPISPNTTRTLLISFAIGLFIPTAFFLLKLLADTKVRTRKDVLERVSIPYLGDIPQSDTNLFVAVEPQGSDAITEAF
RVLRTNMGFMKKYGRTSGQRIMCVSFGANAGKTFTTYNLARSLIFADKKVVIVDLDLRKGMMSKRLEMSGRGMTNYLSDD
SIKIEDVLRQDKNCPSLHVIPIGSSAPNPAELLMSERLDALMDELSARYDYVLIDGVPFGIVADATIVNRVVDLTLFILR
SGTVDRRVLPDLQLLYDEKILNNMAIVLNGISSQNKGYGYGYGYGYGYGYGYGYGYGNKKERSGIFSRFRKS
>gnl|bykdb|A0A0B8T471 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium deserti] (length=795 residues).
MDNTNYNPYIESREKEGKSLNLIDLIKYLLLHWYWFVLSVLLFGGYYYYQYSKTQFLYSRSQTVMIKSTTNTLSVSRATR
LNSYYNTVNVAGEILQLRSKELMRNTISSLRSDVSYSVQHGLRTVELYRNSPFEVKFLNIKPESNFSFTLTAIDSTKVRF
ATVDGDVENYTTIPIGKEIKTPFGNMVVDTTAKFTSSYYGEQVTVSKNAMESMVGYFLSRMRIEQMEDDASLLQMSLEDV
SAERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIETELGGVETDLEQMKARNEGMDVNTATGVFWGESREYQ
STTRGIETQLRLVELMRQRIDNTESRNDLIPSNTGLVEDNIEAQITEYNEVLLKRNRLVGGDNSANPIVKDMDAALRAIR
DNISRSVDNAAMGLRIRIRNLQQEEAASRAKAQSLPAKQRMMLSIERQQKVKEELYILLLNRREENALNQAMTDDNLRVV
DPPSGSEAPIYPSKARKVMTGVGFGVVLPTVVLLLLLLLDTKVNGRKDIEEAVSVPFLGEIPFSKQTIRANDDVVVNEQG
RDPATEAFRILRTNIGFMSSAEREIRVITFTSFNVGAGKTFTAVNLAASLTFLLQNVVLLDLDLRKGTLSDHLKLGSVKG
VTHFLADPAVSLDHITYKANVGNGVDVIPIGVIAPNPVELLLSKRLDVLIAQLKERYRYIVVDNVPIDLVADAAVVNRIS
ELTVFVVRAGAMDRRLLPEIEKIYRKGKLNNMAILLNGIRKLKSSYGYGYGYGYGYGYQKEKAGLRGFFNRLFRR
>gnl|bykdb|A0A0D5BSQ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=787 residues).
MINQNKQNVQKDGIINVLDILKYFLFHWKWFALSVLIFGGYYYYQYSKTPFVYNRSEVVMIRTPSNTPTTARITRSSSAN
VISVKDEILQLKSKELMRQTIDRIGADISYKIRKGLRDYELYKKSPVQVKVEGKSSEDNYAFTVIPVDMKHVVIKNWSNT
NKNEEFKVVLNQSVVTPIGKVLIKPSKFYKKDYYGTEIQVTKSPRESMTGYFVGNLVVKQMEEDTSLLQITLSDNSSERA
SDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIEAELGAVESNIENLKVANQGIDVETAGSMYLAEKNQYKTDRTK
VETDIRLAEMMRSYLGSRDQKNALIPNSTGLVDANVETQITEYNTALLKRNRLAEGGNTSNPVVLDLDEALKAMRNNIGR
AVDNTLRGLNVRLNNAKQEEATAQSKTLQIPQQERAILSIERQRKIKEELYLFLLNKREENALNEAIAESNLRIVDPPTG
LDFPVSPNKLKKLSIGVAIGAVLPAVVLLSMLMLNTGVRGRQDLEDVLSVPFLGEIPLMRSRKQGKSDVLVSKSGRDPLT
EAFRILRTNINFMAKNGEPPRVITFTSFSAGVGKTFSALNLATTLSYLEKKVVVIDLDLRKGTLSSRIDLLHGKGVSHYL
SSPSVSVDEVLHKSEVANGVDFVPIGAIAPNPVELLLSKRLDELINELKERYDYVIIDGVPVGIVADASIIDRVADLTLF
IIRVGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGYGSYGYGYGEEKKKSVFDWFKRS
>gnl|bykdb|A0A0K2HKS3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDA
RVLDPAGGGDTPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|A0A0L8VEV2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sunxiuqinia dokdonensis] (length=793 residues).
MKTMEDFSKSLEREDMLAIKKFFHKLKRNWYWFMIAGIIGGAGGYLLTQVTPPSYELNSLFLIKKKDNAQVQLDLPFSNA
MGGNINLLNHIGILTSHSINRQVLENLDWTTSWYEELLLRDDEMYGNEPFEILYDRQAMNLEGIPIHIQMLDTSNFQIEV
KGKKMVYGKEVEIEFSQKGKFGELFSNDYFNFTLYPKYAKRGNQYYFTFNNFENQVKKYMNRLVIEEPEDKADLIYLSLI
DQVPQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVIDTLQVAGNKFTSFRSQNQIVDIGQEGGIIVQRLVD
LDKERSLAQSHLDYYRNLQKYLSDTEKMQEVVAPSVVGIVDESLNNLVTQLSDLYRQREVFSYTVQEKNPKLILVNNQIE
MVKRNLQENLKNLINNAIVQIQGLDRRVDQVNRQLSAHPKTEQQMMNMQRMYDLNNELYTFLLKKRAEAAITHASNVSDT
EVLDEARPELAELMGPYLTFNVAGGLLAGLFVPFMVIMLATYFYDRIKSAEDIEEYTDIPVIGNIVNSGIGSEYLAAIDN
PRSAIAESFRELRTNLQFIVPGLKNKSLVIGVNSVIPGEGKSFTAANLASMIALNNKRVLLIDCDLRKPSLHNRLKYKNK
EGLSTYLTDFSSFDDIFRQTRVENLQFVSAGPIPPNPSELLENGKFEELIERCRDMFDYIVFDNPPLSLVSDGIVIGQKV
DINLFVTRQDYSKKNEVRFIDHVNKKKAMKNAGIILNDIHLSKHAHVGAYGADYSHRKNSSYYYFDSSPSYTG
>gnl|bykdb|A0A0M1W1I6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 9_1_42FAA] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRIQNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDVVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|A0A0W8EPA0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=794 residues).
MDTINQKNQVIGNKKEHSVNVLDILKYLLHNWKWFALSILLFGGYYYYQYSKTPFVYNSSEIVIVKTPSNTPTTARITRS
FGANSISVKDELLQLKSKELMRLVVDKIEADKSYKVHKGLRDYELYKKSPVQVKVEGKSSEDSYNFTVVPVDANNVIIKN
WNPASKDKEIKVALNSLTSTPVGKVLITPSKYYKKDYYGVEIQVTKFPREAVMGNFVGNLSIKQMEEEASLLQVTISDDS
PDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKSQYKS
EGAKIETDIRLAEMMRSYLTNKGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNSSNPVVLDLDDALGAMRT
NISRAVDNAVRGLNIKLNNTRQEESIAQGKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAIGAVLPAVVLLSMLMLNTGVRGRQDLENVLTVPFLGEIPLARGRRQGNGDVLVSQSGR
DPLTEAFRILRTNINFMTKDEHPPQVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNSSIKISDILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGSYGYGYGEEKKKTIFNWFKRS
>gnl|bykdb|A0A134B4F8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium KA00676] (length=796 residues).
MSTQTNRSNQAGEKTAEVNLLDIFFYLLRFWWLYLLSIGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDADVLRY
TRSTRLNMDNERMQLVSRRVMERTVKMANANVLYNVKSGLRTIELYTDAPFSMKFLDTLERGSSFDVAFQDASHVRVTPA
STGKSQVIALNVPVQLGEERFIIEPRQNFNAPWEHKHIEVTRMPFTQTVRYYQHAIMVAEPENRASTLAIRLQDRTKKRA
LDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDAQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPVSPNTLRVVLIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPREEKRGGKKSQPRGVREQGSD
ETSEAFRVLRENMRFMIGTGGKVAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|A0A134B8C7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas somerae] (length=796 residues).
MSTQTNRSNQAGEKTAEVNLLDIFFYLLRFWWLYLLSIGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDADVLRY
TRSTRLNMDNERMQLVSRRVMERTVKMANANVLYNVKSGLRTIELYTDAPFSMKFLDTLERGSSFDVAFQDASHVRVTPA
STGKSQVIALNVPVQLGEERFIIEPRQNFNAPWEHKHIEVTRMPFTQTVRYYQHAIMVAEPENRASTLAIRLQDRTKKRA
LDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDAQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPVSPNTLRVVLIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPREEKRGGKKSQPRGVREQGSD
ETSEAFRVLRENMRFMIGTGGKVAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|A0A136LSC7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium OLB12] (length=772 residues).
MLQPKEIGPQVQSIDTEKLSAVIRKNLVWIVLIFIAVNLAAYLTIRYTKDLFESESEMKLDIKRDATELGIKTYMEDQNV
NQVSGEIEQIKSKIFFNQVLDSLDFEVSYYSLGKVLTDEMYKRSPFRIKASHINPKHYDQPIYFDFLDNNEVSLRLKGAV
STRGSMGNPVEFDGTVLTITKTNYFTENDGNNYYFVLNSRKSLIEYLSKNIQVDPLNFNANTIRVSFRDHNAHKAYDVVN
KIDSLYIVYSNQQKNLANKQKIEWLNNELVQVEEKMEGYENYFESFTLQNKSSDLTLDLKKTIAAINVVDSQRYSLNKQL
AELNTLIDQITASDFANAIRPANSFPESILQRIEELHKKTRERDKLALAYNENTFAFRQKEREVSLVKDELFNQLSTLKK
EWLADMAELGKRKEKLERAFAEMPDKNTQFSKNQRYYKLYEEFYLTMMQSKAEFEIAQAGSTPDFKILSPATLPIKPISP
SKVMVLGIGFVAAIVLCLFFIGLVYLLNNKITSVKEVERGINLPMLGAIPASHHTVQSLFHVIDNPKSIVSEAIRTLRTN
LEFFNTGEKCKVITITSTVSGEGKSFLAMNLGGVLALSRKRVILVDLDMRKPKSEKYPTGNDSSMGMSTILIKKNNWQEC
VLKTSLENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYDYVVIDTPPVGLVTDGVMAMKRSDLSIYVFRANYSHKDF
LQNLARVVTLNKLTHVSSVLNAIPLSGNYYGYGYYEDKTPRRKRWIKIFGLK
>gnl|bykdb|A0A139L1N2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVNAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A142HHS5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. PAMC 26554] (length=831 residues).
MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLSTLVLVARRSLPWVIFLLTLGITSSWLYMRYTKPIYE
ATSILKIDDHSDASALGLGMAMGGAENNQASQLAGEVELIKSGLTYKRLKQTVPLDINYYTQGTVLETELFGNCPYRVTY
VISDPAYYNHKFDVEYIDAKHYRLNVTVGNAKLGGNYEFGQLVKLPGISLRLLSASSPAELDAIYHFVIVDDNTINSYLD
HNLKAEVLNPIANTIQISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENGQNLAKAEDNLKIFVQ
QNGTYDAKGELGTITNKLEKIEEDRFKLEQKLTLLADVSQRAAAERLTPSDEVTVDQTIPGLALLEDPALSQQLNNLNAL
QQNLRRIRRSYQDRLEAVQGPLAQLKFAQATLQHQLVQAQKQLRGQIALLDTQQGKLSNELQLIPGKETELERLKRPLGL
YGNSYQMLLEKKVEYNIKNAGTTADFQILSPAFAPEEPISPKKLLVYAIGLAGGLILGLGLIGTRYLMHNTITSVNELER
NTKASVLGVIPTYDKEQLNISRLIVDKNPKSSVSEAIRSIRTNLDFISPSNKKRLISVTSTISGEGKTFVTVNLGGIIAL
SGQRVVILDLDMRKPKVNLAFDAENVRGISTILIDRHTVAECIQHTSIESLDFISAGPTPPNPSELILNPRFDLMIQELY
RTYDVILIDTPPVGLVTDGILIMRKADVPIYIVRANYSRKTFLKNMNRLMRNNQFTRMTTILNDAKAQGSYGYGYGYGYG
YGYGYGTKGMGYYDETEQKPTLGKRIKSLFS
>gnl|bykdb|A0A161LWY6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter jiangxiensis] (length=796 residues).
METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFKILRHWYLFVIALAISLSISFIANRTWKPSYQVSARVILGGGQASAS
QQMVMQGVNLNMAYKNNDNQMIMFTSNDLVERAINKINANVDYYTTGHFKVSNLYGYAPIEIKGDNISDAVSGLEFDFRD
IDGVTYEIAHQKDKQLDELRYTGRYGSLLNTPYFSVVVNKTDNFEPRKKINFAFLSNAYLIDYFTPRISLSFVTQNSTVL
AVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDISDSLRTSESHLQHFRKANQILDLNAYGSTIL
GHLTSYDEKRLQYNLKESYLNYLADYIKKNVNNQELLTPSSLGIVDPVLTGLLTQYNETIRKLLQTTPQNPFYAKYQEEL
NKLKGSLTDALRNVRAAFSIEKKDIDTQSRKASGQLATLPDIETQMNSFERQFKMNDTYYTYLLQKRAEAQIQRASNVPD
NTILERARMISITNGGDKKKSMMMALALGLIIPLLIIILKEYLKTKVMDKRDIEKLSPFPYIGSLPHATHDDATITVLKR
PKSAIAEAYRMVRTRIKFVSRQMDASCVIVTSTESGDGKTHFCLNYASMCAMTGEPTILVDMDLRKPSVSKRLSLENETG
ITNCMLGQVSLDDAIIKKSPEINFDLLLAGTIPPNPGEMIRSPKLLELINELKMRYHYVIIDTSPVGIVSDAYPLAPISD
CVIYITRSRKTNKKFFKSVINQLKTDRMQHVGVVLNDIDANTGGYGYNYSYQRYGYGTYGNNPVTKDYIKDYYEEE
>gnl|bykdb|A0A174C2Q8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides xylanisolvens] (length=781 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINLLPERHISFVVTPKDDATVTLSGFGGL
PAAGESYEVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|A0A174SDD8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFIYLLVHWKWFVLSILLFGGCFWYIYCKTPFEYSRVAIVMIKTPANSRSTMQLNNSDFA
GQVNVASEILQFKSKELMRKVIDRLQANICYTVHEGLRPVELYTESPVRVAFLEAGTDEAHSLSVTPKSNVQVELSDFSR
GMEQRKVVKLNDTIQTALGKLVVFAAENYGESCFGKPIVVTCKPLEEMVSFWLNNLSIRQMSGDAALLRIAMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKKANNGVDINMAAGMYIQDSRQYESSIKE
LDTQLQLVTFIKQYLQDSSKDDELIPSNIGLEDLNIESQIARYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKQNIYR
ALDNLSTTLRLKKQDYSLQENQVRQKVQAVPRKQREMLSVERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLMLGVGCGVIVPSVILLLMLILDTGVHNRKEVESIVSAPFLADIPQTPKAMANVHEVVGRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMSHCTQVKGVAHYL
SNPSIEVNDIILRDAFGEGLDLVPIGVIAPNPTELLLSKRLDELVDKLRERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A174TVL8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A1A6CF06 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=789 residues).
MNQYSKNSVQKENTINVLDIFKYLLFHWKWFALSILIFGGYFYYQYSKSPFIYNRSEVVMIKTPSNTPTTARITRSFSGG
GVSVKDEILQLKSKELMRQVVDKVGADKSYKIHSGLRDYELYKKSPVQVKVEGKTQADSYGFTVTPIDTRYVLLKKWNET
SEEELKIELNRWVVTPAGKVFITPTKFYNKDYYGKDIQVTKSPREAVMGYFIANLKIKQMDEDTSLLQVSIEDVSSDRAD
DMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIEGELGAVESNIENLKIANQGIDIATAGGMYLSESSQYKTEGTKI
ETDIRLAEMMHSYLNNKNKRNALIPNNTGLVDTGVESQIADYNTALLKRNRLAEGGNSANPVVLDMDEALNSMRNNISRA
VDNALKGLNIKLNNARQEGRTAQAKVLQMPQKERTMLSIERQHKVKEELYLFLLNKREENALNEAITEANLRIVDPPVGD
AYPIYPNRLKKVFTGVAIGTVLPMIVLLSLLLLNTAVRGRQDLENVLSVPFLGEIPLARSRRQGKGDILVSKTGRDPLTE
AFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVIDLDLRKGTLSSRVDLLHEKGTSHYLS
NSSISVDEILQKSELLENVDVIPIGAIAPNPVELLLSKRLDELINELKNRYDYIIIDGVPTGVVADASIIDRVADLTLFI
IRIGKMDRRQLPEIEKIYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKRKSIFSWFKRS
>gnl|bykdb|A0A1C5XJA7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Bacteroides sp] (length=778 residues).
MQNNIQSNKNDQNINLLDLLMYLASKWKWFIMSVLIFGGIAWYKYATAPLVYFGSATVIIKDPSSKTTTTGLDRFDNFIN
KVNVANEMLQFNSKRLIREVVSRTHADVSYKMKDGLRNVELYTKSPVAVSFADMLPEQYVAFTVTLLNKDSVEITDFSMA
ENGERQVVELNDTISLNEGKVVVVPTNYMTESWIGVPVKVSKMPLDAVVSVYRNSIAVKQEEEESSILTLALKDNSSERA
EDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIGQELGDVESDLESFKRENQTLDISSSASMYMGESQKYNSSALE
LETQLRLAQYIKEYLTDPKKEADLIPSNTGISDMNIENQIGMYNAAKLKRDRLISDSSDKNPVVEELNSSLRAMKQSIIR
AVDNMIVSINVKRNDAQNREMRVQERLSAMPTKERQMLSIERQQKIKESLYLFLLNKREENALSQAMADNNARVIDSAEA
TKYPISPNRNKILALGILLGLALPTVSFLVIMFMDTRIHSRKDILGAVSVPFLGEIPLDKNYKSSRKGAANAYGYGDNVV
TEAFRILRTNMSFMAKKDRPLQVITFTSFNSGAGKSFVAFNLADSLAYTKKKVILIDLDIRKGSLSHRMHKHGVGMTNYL
ADETIALDDIIHDCGKDYDFINAGTSAPNPAELLMDSRLDSMMEELRKRYDYIVVDNVPVGLVADATIANRIADITIFVV
RAGRLDKRQLPDIEKLYQEKVLNNMALILNGADLERHGYGYGSYGYGYGYGYGNNKNK
>gnl|bykdb|A0A1F0I8C4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. HMSC073E02] (length=789 residues).
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A1F3D6P8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWA2_40_15] (length=787 residues).
MTKETDSGIALIKHYLQDIAYFKYFYIICLVILLTVAFLFNKYSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN
RNLESGISNFISFPTVSSTISSMNLEIGYFREKHHLFRQVSELYLRSPYVVIMDKSHIQPIDVKLRVFILSDTTFRLVID
QNTVSLYNYLDNQIVIENVPLKVDTICRFNETIRGKTFKFSVSFNRDFYTRETNMEDFYYFSFFHLDYLTKDYLKKLEVE
PISPKTSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQVMD
LSFQGKSLYEKLEQIETERANLQIQERYYNYIINNFKSSNDMSGVVPPSAMNVADPIMNQLITQLLLLYSQRSGIASNNA
EKNLFLGQIDNKIKVQKQAIIETVTNNLNTLNLSLNELNYRADKLSREISQLPRTELNMVGLQRKFDLSDVIYTYLLQKR
SEAAITMASNYPDFEVIEPAREFTKKIIVPRPKLSYLLAIFFGLAIPTTFIFIRNFFNNKISSIYDLESLINQSGMGVIF
NNNYKSEAVVLEAPKSAIAESFRNLRSSLFLKLKSEKSKVIVITSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKP
TLHEKFKEDNSSGISNFMVKNATVTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGL
VADATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSYYLKK
>gnl|bykdb|A0A1G1TG88 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter coccineus] (length=624 residues).
MKVTPTQYFGPASLAAKYHFTIQDQGTVNAYLEKNLAVDISSADANTIQISFTDFNPRKAQRIVNKVDTVYQRAKVLREQ
ENTARTLRYLDQQLEVNYDNLERAENRYQGFVEQTKTYDVRSEVAALAAKGEDLEEQRLKLNQNLVLLSDISRMVQQTHI
TRNEEETVEQSIPGLGDINDPVLSQLLGQLNGMQWDQERVRRSYTGATEAVQQKNAQMDYTLSSILRQITQARKALANRI
ALLDRQQNKLDAKQQGLPSRATEQARLQRPLALAEGTYTMLMGKKVDYNIQKAGTTADFQILFPASEPRVPISPVRLMVY
AIGLAGGLFLGLGLIAVRYLLHNTITNTRELERSTQAAVLGVIPTYDKEKMEVSRLVVNDNPKSAISEAIRSIRTNLDFI
SSAKKKRLISVTSTISGEGKTFVTVNLAGIIAMSGQRVIVLDLDMRKPKVNLAFGAENVKGVSTILIDRHSVAECIQHTS
IDALQFISAGPTPPNPSELILSPRFDQMLNELYESYDVVMIDTPPVGLVTDGILIMRRADIPIYIVRADYSRKAFIKNMN
RLMRTNNLTRMCTILNDAQSKGAYGYGYGYGYGYGSGTYGQGYYEDHGSAPPPTLAQKLGRLFK
>gnl|bykdb|A0A1G9B1T9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Catalinimonas alkaloidigena] (length=779 residues).
METSRYSHTQALKSDPIDLSVITKKIIRKWYLLLGSLLLTLALAYVVILTTPEVYKVSSSMLVRDESATGNQQFMEGIGL
FEPQTKISDQTAMLTSFDIIRRTLEKLDFGVTYYKHDQFIQHEIYKRRPFDVELDSLSDQLIGVPIYVRFLSSNRYEISV
EADEASVYQMAEEKFAPTKARDVLIQNVQKVGQPVRTPYLNFTLIRNEQEPLDTLSQYSFMIHPLERVTEQYQKKLVVAP
FEEGSDILVLTTTGEIVEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVADSLSQVEQSLRSFRDRTRTVDI
GTTARDLNTKLDELQKTREDLLIDYRSYQNLFQYLEQNDYTEVIAPSVRNINDEVMSGLLRNLIELNQQRAQLKTSVRQS
LPAIEELDAKVKSIRAQLHENVNNLIATTKYKIESVENQIEELDSQINLLPKNEQELINIERKFQFSDNQYNYLLQKRTE
VGIAVASNASTKKVVEEARLDGRTPVSPNKILILLTAIVLGLALPVGALILADMFQDKISSREEVANIISMPLVGEVPRL
RRKENALVYSRPRSAAAESFRTIRSNLLLQNHVNGASKTLLVTSSVSNEGKTLCSVNLASSFAVANNRTIIIDADLRRPR
VHNILEKTNGVGLSNYLQGTADMSEIIQPTDQENLYVITAGKSDGHPGEILLSERLPQLINKLKMEFKFVVLDTPPVKIV
TDALVLSAYSDINILVARRGVTSKSQLMDVEELHQNNTLHNLYVVLNDVQATKGHGYYE
>gnl|bykdb|A0A1H6CKR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium lactis] (length=796 residues).
MNKDFLIKDKQTQSINVLDVLKYLLSNWRWYLLSILIFGGYFYYQYNKTPFLYKSSQTVMIKTASNTISSSRITRPNNIY
NSVNVNSEILQLRSKELMRNTIGALDANISYKRQNGLRTLELYKTSPFLVKFVDANPNMPQEFTLKSLGKNQLELSEFSN
QEEAGKPLVVALNQTVNTPIGKVIITPNPESKYRVNVSEPIQVSKTPIDAMVGYFLSNLEIVQMEDVAILQMTMEDTSPM
RAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIETELSGVESQIEGMKTSNQGLDVKSAGEQYWSDSRGYDASS
KEIETQMKLVEIMRQRLDDPSKRDELIPSNTGLVDQSIESIITEYNTLLLRRNRLTAGNSSENPIVQDLNTALNALRDNI
SRAVDNVLTGYRIKVRNLRQEENAAIGRARSMPAKQRMMLSVERQQKVKEELYIFLLNKREENAINQAMTDDNIKVIDSA
NTSNYPFYPSLLKKLALGIGIGLAIPTAILLLILMLNTKIRYRKDIEDNISVPLVGEIPFSTDLKTAKSDIVIKEQGTDE
VTEAFRIFRTNLGFMSAGDKSQKVITFTSFNVGAGKTFSVINLGVSLTYLKKRVVLVDLDLRKGTLSNITKFPMPIGATH
YLSDSAITVDEIIYKDRVDANIDIVPIGVIAPNPVELLLSERLDRLFVELKERYDYIIVDNVPLGIVADADIVNRITDVT
IFVVRAGKMDRRQLPDIQKLYSSGSLTNLAILLNGVKFTNTGYGGYGYGYGGYGYGYGYGYGNRKKKSFFQKLLGR
>gnl|bykdb|A0A1H6Z2F8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter sp. SG02] (length=506 residues).
MKQLISRYQKASIGEKNKVADNTIAFINANLARISSELVQVETRIEHFRKRHRVIDMAEDSRQALQNLNTNASEEKQLAV
HLKIVKLLEGHLRAKPSAAIPSALYPQEGNFEALIGKYNEMELSRTRALASLAPGHPDIRSIEKQMEVLRTNLFDAIQNQ
KQELALSISAIHAYGKGFEAEISRLPGHQRALLSQSREQGIQQELYLFLLKKRMETAISRSANIANARVIDPPKASPLPV
SPNRQLTILVAFLAGLLAPACVIYVGQIFNNKITSKDDISRQCDVTIIGEISQQSRADRLSRNNVRSLLREQFRSLRTNI
QFVVGERQNTVVLLTSSMADEGKSFVAMHLAHSLALASRKVLLVDFDLRKPTLASLLNLRPEGVTEHIALEKDLLIQQCA
NGPPFDFIAAGMQSMDDTMLSPKIAGLIPALKAGYDYVLLDSPPVGLVADARLLGPYADMTLYIVRQHFTFIHQLAELQK
ASEQLPDLQIVINGTRDLHRYQYNYY
>gnl|bykdb|A0A1H7RFH3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTTQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDTFGEGLDLVPIGVIAPNPTELLLSKRLDKLVAELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A1H8BJR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AR20] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A1I2A9Z9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sunxiuqinia elliptica] (length=793 residues).
MKTMEEYSNSLEREDMLSVKKFFHKLVRNWYWFMIVGIIGVGLGYLKTQVTAPAYKLESLFLIKTDNKGGLRMDFPLPSA
FGGNINLQNNIGIITSYSINRQVMENLDWSTSWYHELMFRNEELYKNEPYDVLFDRNAMNLEGIPVYVQMLDSTNYRIIV
DEKTMYYGREIEIKIDQRGVFGEIFENDYFHFTLYPKNVKRGETYFFTFNNFEGLVRNYSGRLMIEETEEQADLIRLSMV
DEVPQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVIDTLKVAGNNFTSFRSRNQIVDMSQEGGIIVQRLVD
LDTERSMIQSHLDYYKNLQQYLDDTEKMKQVVAPSVVGIVDDALNNLVVHLSDLYRQREVISYTAQEKNPKLILIGNEIE
MVKRNLRENLKNLINNAIIQVQGLDRRIEKVNQQLTAYPKTEQQLMNMKRMYDLNNELYTFLLKKRAEAAITHASNVSDT
QVLDEARPELASRLGPNLVINVAGGMLAGLFIPFVVIMLATYFYDRIKSAEDIEEYSDIPVIGNIVNTGIGAEFLAAIDN
PRSAIAESFRELRTNLQFVAPKKNNECTIIGVNSVISGEGKSFTSANLASMIALNNKKVLLVDCDLRKPSLHNRLKYKNK
EGLSTYLTDFSTFEDIFRQTRVDNLQFVSAGPIPPNPSELLENGKFEELIDRCRNIFDYIVFDNPPLSIVSDGIIIGQKV
DINLFVTRQDYSKKNEVKFIDHVHRKKSMKNPGIVLNDIHVSKHAHVGSYGADYSYKKKSSYYYFESSPSYTG
>gnl|bykdb|A0A1I2AN85 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter antarcticus] (length=794 residues).
MDNLNNINLMPKAKEEKSINLLDILKYLLFQWKWFLLSIFIFGGYYLYQYSKTPFIYSRSETIMIKTPLNTMPGTRITRA
NYYNTVNVASEILQLRSKELMRKTIDRIEGDISYTVKKGLREYELYKDAPVKVQFIDAKPEVGFSLQIEAVDQDHVALSS
FSKGNTSQVLKIKLNQTVRTPIGLLKVTRSPGYKVSDFDKPVIVRKYPREAMVGYYMANLKIQQMEEDASLLQVFVEDSS
LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQSELGSVESNLENLKVSNQGIDVNAASQMYVSEGMMHES
AGNDVQTQLKLVEMMQNYMRDADKKDDLIPNNTGLVDVNIENRINEYNTASLRRNRLLEGSSSENPIVQDLNITLAAMRK
NIYRAMENAVSGLQIKINNLKKEQTQARNKAMAVPAKQRMMLSVERQQKVKEELYLLLLNKREENAINQAMTEDNVRIID
PASGSDAPIYPSRIKKLALGVGIGIALPAIVFLLMLMLDTGVRSRKDIEEVLSVPFLGEIPFTLKDKGGEAVVEEKGRDY
TSEAFRILRTNIGFMAAGKEQRVITFTSFNIGAGKTFTAINLAASFRYLNKKVLLLDLDLRKGTLSNRVNAQKEKGLGVT
NFLANPKVTVDDIIYQGLVGGIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYDYIIVDNVPVNLVADASIVDRISEL
TIFVVRSGKMDRRQLPEIQSLYDQRKISHMAVLLNGVRLNKGGYGYGYGYGYGYGYGYGNETKKTIWDKLFGKR
>gnl|bykdb|A0A1J5HQM0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium CG2_30_38_12] (length=804 residues).
MEQNKPANPFSEEEESSFDIMEWVNIFLHFWYLFVIFVIISLGMAYLKNRTWIPSYKSAGTMLIEEYKITNNTQAMMQGF
GVDAGYKNTRNQIIMLSSYDLIGRVVDSLPQMRVDYISKGNFKTRNLYNASPIQINPDYIAPEAFNLTFKLDLNANGTFT
ITVDENKQYENFKLNGNIGEPISNNLFFITINNTNSYYAERELYFQFRSRESLISDFASRLTFNFVQEGSSVLEIAMNSE
TPERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVSKSLTVSQGEMTDFRQRNQIINVDTHAGELLGKSNSYE
SQFSTLKLKETYLDYLTKYLRTNMEDGSIIAPSSLGLNEPMLMGLVSQINDLNLKRSELSEKNMYYAKYTRDIDHIKVAI
NEVTKNMRASLEIEKNDLKEKNDKVNKEIEQLPSKEIEMTSIARKYKMDDNYYTFFLQKRAESEILKSSNTPDNNILDRA
RIIAVTNDGTQSKTTLTFLIIGLLIPAAFVALREFSNGTIRSNKDIEKNSKFTMIGSVRHTNSNDPLITINNPRSAFTEM
FRVIRTRIEFIVQRKKNIMVAVTSSESGDGKTYFSINMAGVYSMASKKVLLVDLDIRKPSIHERFNINPSQGITNFLVGQ
ATLDEVIIHIPELEYDFLPGGTVPPNAGELIRSEKLVEMFQELRNRYEFIVVDTSPIGIVADAYAIAHLSDINIFVARSG
KTSKSHFAKISKQLKSDNVEAYCILNDVMSEESRYSRYYSRRYGYGYGYGYGSGYGYGYGYGNTRKKKEASEKYFQYYQD
DREI
>gnl|bykdb|A0A1M3DPL8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium 36-12] (length=815 residues).
MNMEEENKDIKTSDFTDEESSFDIMEWVMLFVSHWYLILISVFVFMFLAYMQNRKWLPSFKSSATVIIDESRGSMNSAQV
LMQGFGIQESYRNVNNQVIMISSYDLMSRVVDSLPEFQIEYISKGRFKTRNLYEWTPISIDADFISPQAYDILFKLNIKP
DGTFTVTEDEESMPKGFNINGRIGYPLQHHLMFITINDISGNNSAKDLYFKFRTKESLIGEFSSKLALNFVMDGSSVLEI
SMVSETPRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVSKSLATSEDNLSDFRKRNQLINVSSLTDELLSK
AASFDEELNQIRLKETYIAYVEKYIQTNLNEGAIIAPSNIGLNEPMLMTIVQQINDLLLKRSELTEKNIFHSKYTREIDN
LKTAINEVIKNTKASINIQKDDLNTRLASVQKQIETLPEQELEMVGIERNYRMNDSYYTMFLQKRAEAQILKASNTPDNN
ILDRARTTSVTNQGTKSKTIMMYFLIGILLPSVFIILKELLNNTIRTSRDVEKMSAFPLIGLVRHTNSTDPYLIVNNPRS
SFTEMFRIIRTRIEFIAKRKTDITIMVTSSESGDGKTYFCINLACIYAMASPKTLLVDMDIRKPSVYQTIGCDNNMGVSN
FLANQCSLDEIIVRPDGAEFDFITAGTVPPNAGELIRSDNLKDMFDELRKRYEYIIVDTSPIGVVADAYSFAALSDINLF
VIRSNKTNKQFVKTLSNQLKEDTKSRFYSILNDVEIESASYSQYYSRKYVYGRSKSYGLGTYGYGYGYGYTSSGRSKHKG
NNTYFQYYQDDEKDI
>gnl|bykdb|A0A1M3LAG1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas sp. 37-18] (length=798 residues).
MDINNKPGADTDPYFEEIKAKTTLSFDFVLWFYRILKYWYLFVISIALFMAYAFIKNKSWVPFYGIQAMIILEDRGSSMI
SGAVPLGSILRNTENQQIVLESYGLTERTVKNLSKKMHIDYFIQTRFKYISLYTDSPIEIVIDSLETDITPQAYSKVFDV
AYVSDSQIRVSYKDGLDGEPEEAFNVVFDSPVENKFFKGTIRKTKNFKHDFLPFSFRFFTNSQLTGMYSGRVSTALKTEN
STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLERFQKETGVYEVSSAT
VRRELDVADVDRDQVAMREKTVLFTTQKIKEGIMGSAELIDPISIGLTDEIKLSRYVEEYNQELRKSKNLGPKSPIYMTA
INKLNESRVQILRELQLIQVKLQDQKDLLVKKYQNLDLKLDNLPPQERDLIKYQREYNVNEMYHQFLTQRQYEAKIQRAS
NTPDNFIWEYPRMVGGAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECEKISGLPVIGTIENISKKLAG
GVVLVKNFPKSSFAESFRNMRVRIEYMAQRENKITILVTSTEPADGKTFIATNVASVYQLMGKKVIIVDLDLRRPSVGKT
LQIDAQKGISNYLIGQVTLDEIIISHPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYDYVIVDCSPVGLVSDAY
ILSSMADTTLFVVRRAKTNKAFFKSVITQLGFDGVENIALVFNDVKGREGYYGTSRYYGDKTYYLKKNSYYHDDYFES
>gnl|bykdb|A0A1M3MEI8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter sp. 47-17] (length=816 residues).
MEQPVKPRERVIPEEEESGFDIMEWVAHFIGHWYLFVIGLVIAFGLSYMQNRKWLPEYKSTGSVIIDDSRTMMNSAQVMM
QGFGIQDAYRNVNNQVIMLGSYDLLGRVVDSLPALSIDYISQGRFKVRNLYGQSPVVIHTDYIAPEAYGILFKLSISEDG
TFLITEEEENLRKGFALRGRLGKTFQHNLFFITVNMAEGVVHGKKEVYFRFRSRESLISDFSGRLRLNFVMEGSSVLEIS
LASATPARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVAEELSMSEDEFTSFRRRNQIIDVGSFSGDLLSKA
AAYDTEINQLKLKESYLDYLVKYVKTNLQDGSIVAPTNLGLNEPMLMALVQQINELIMKRAELPEKSMFHSKYTREIETV
KNAINEMVRNMQVSMDIQKKDLNRRYAEVQQEINQLPAKELEMIGIERRYKMNDSYYTLFLQKRAEAEILKASNTPDNNI
LDRARVINVVNQGEKSKTTLLFLLLGLVVPAGFVVVKELLNVRIMTNRDVEKYSSFPLIGMIRHTNSDNPFIVAANPRSS
FTEMFRIIRTRIEFITQRKDKITIMVTSSESGDGKTYFSLNLASVYGLASPRTLLVDLDIRKPSIHKRLGVENSLGLTNF
LVGQCKAQDIIMRPDGAGFDFIPAGTIPPNAGELIRSEKLRTLFAKLKEYYDYIIVDTSPIGVVADAYSFADLSDINLFI
VRSDKTHKLFLRTLTAQLKSDNVHDFYSILNDVELKSNSYSRYYSRKYAYGNSRRYGTKSGYGYGYGYGYGYTKVSDKKN
SDGTYYQYYQDDAHDI
>gnl|bykdb|A0A1M5DFS8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas macrotermitis] (length=797 residues).
MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVLWFYRILKYWYLFVLSLALFLGYAYLKNKSWTPLYRSGAVLMMESRG
NSGVAMGAVQLGSLVQNSVNQQMILNSYDMVVRTVAKLPQMRVDYFLKTKFKTENLYGVTPITIEAKYVAPSAYSIVFEV
EPIDSDKCRIFYPGSENTAPFSMEVPYNQYVQESRFYIKINKTDRFTPNFTPFSFRFISKEELIGRYTGRTSSGYQREGS
SALAISIYGTSPAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLISDSLEQSEQTFKTFQDETGLYRIQGGDQ
RADRDAVLQGIAENKAQEELILRLTDEINNSILSNTELIDPSAFGISDTKLSQSVGEYNKIVKKLASMGEAHPLYAKSEQ
SMNNLRIKILEDLRNAQDKVQEKKENLNSRLASVESEMSTLPAQEREYARYEKRYQVNDAYYTYLRNKRYEATIQKASNI
PDNFVLEEPRQLGGPVNGDEKKKTYTFYLAIGLAIPLIFVICKEELFNYAISTKEDCERLSGLPVIGTIENISKKMSSNS
TTLVKNFPKSSFAESFRNMRIRLEYMAQKETGISVLVTSAEPGDGKTFIAGNIASVYQLTGRRVVLIDFDLRRPSVAKLL
NLQSKKGVSNFLIGQVSLDEITVTHPEYEFDVITAGTLPPNPSELIKTKKTKDLIEYLKTKYDYVVVDCSPIGLVSDAYI
LSKYVDTSLFVVRRAKTNKAFFKSVVNQMRNDGLDHVAIVFNDVKGREGYYGTSRYYGDKSYYLKRNSYYHDDYFEK
>gnl|bykdb|A0A1M6B6D5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Aequorivita viscosa] (length=820 residues).
MSEEFETNEAGTTFDFKGFLIRLLRNWPLFLIFLAITFSIAYYINVRKLPVYLIENLVSIRDDQNPFFTSNTSLVFNWGG
TSDKVNTSVITLRSRSHNEKVVERTQYYLTYLRDGEYQQEDAYKQTPFFVEVDTAKSQMLNHQIKVVFKDSLTFNLSVSF
EEAKNINLQNYNSKEKKSLFVEAGDFSKDFKIGEPVNTPFFNGIFVPNPDVISKMGTPYYLVFSEYDATVKRYLDINIAP
LSSGSSVLQMRMTGHNKAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKSIELSLVEDELNDFRRNNVIFDL
NIEGAELNEKLNALDLRKEAAARELDYYNTLQEYLVTRSDYRDVPAPSVAGISESSVVAGVGKIVSLAEQRNKLQYSFKE
DAPVFNDIDRQIDAVKIVLLENIRSSKSLMNEEIRTINRDIGRYEAEIRKLPKEQQELLKIERRYNLSEGTYNMFLAKRS
EAGLVKAANVSDVLVIDPAKDTGGGQIGPNTQLNYMMAGLIGFFVPILLIFVRAFFDTKVESVKDLEAITPIPMIGVIGK
NHSETVLAVLSKPKSAIAEAFRSLRSSLQFLYKQQGITGAKTVLLTSSVSGEGKTFCSINLASIFALSDKKTIIIDLDLR
KPKVGAAFNIQNSMGVVNYLINEADLDGIIQKTEIDTLDVITSGPIPPNPSELLLGERLDQLLGLLKDQYDYIILDSPPM
GLVSDALVLTKHVDATLYMVRQNYTHKNMLTFVNEKFRRGEVKHISIVINEYVEKSGKGYGYGYGYGYGGSSYKSYGNGY
HEAIKKPSLWKRMKKSITKK
>gnl|bykdb|A0A1M6MYT6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tangfeifania diversioriginum] (length=834 residues).
MKKQQNDKDILNFYGQLEEESLISKKTLFKCFRNWYWYVVAVIVAGALAWLYVQYTTSVYEIKSSMLVEEGKSGSPLGSG
GANSENIFLGLGMMNSMRNIHNQIAVLSSTPIVSRTLDELDFSVNYYSIGRFAATERYQDVPFMVVWEEDHPQIINADFY
LTIQPDGKLELKIEEEDEVMVFNYKDKTVLDELDSYSYSEEATPGTRISTDEFAFKILLNEHFNPESDNEFKFRFHSPQE
LIRQYQNQLEVALKSDETTILDLTLRDRNVRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASISDSLSVSESR
MEDFQSEHQIVNISAQSEQLLERMRELDQERIAMETQNKYYHYLRDYINTTASRELETVIAPSAMGIEDPLLNNLILQLN
DLINERLSQTSIRQNSEHPTIVRLNAQIASVKNSLRENVDNIISQSDMALENLNQRIRQFEAQVRRLPATERNYVNIERK
YKLNNETYIFLMQKLSEAQIAKASNIPDSQMIEEAKMAGTGPVEPQKRKIYALALLLALAFPTGIIILLDLLNTKILSKD
DVEALTDYPIIGHVFNNRKESESHTLVLDKPNSPASEPYSAIRTKLELITKGKEHAVIAVTSSFPSEGKTYNAINIASSV
ALSNKTAVILDLDLRKSRINEDIGLKIEKNVVDYILGKATLEEITHKTKHPRLKVIPAGPHPPNPLQMLTDKNLSGLIDQ
LKKQYDVVIVDTPPVGMVADFFLLRDMFDAAVFIVRHKSTPKKPLKDILEELESHQIEELGIIVNNVYRTKSNRGYGYGY
GYGYGYGYGYGHDTDSNQKKGKTKTKGRSIFKPS
>gnl|bykdb|A0A1P8E011 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp. B29] (length=798 residues).
MKTTHYNQLQKDKSINVLDVLAHLLYHWKWFALSILLFGSYYYYQYAKSPFIYRSAETIIIKTPMNTPRTARISRTNEAY
NSISVASEILQLKSKELMRQTVTRIGAEMSYTVGDGLRRKELYTASPIKVIVPQTKPEDSFSFTVTPVGGKEVVLSNWSE
GDAALEVDATLDKPVNTPFGQVIVQSALKPNKALPQQEVKVEKFALEGMVNYFISTISITQMEEDASLLQIVAEDTNPLR
ATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIEQELGSVESSIEDLRTQNQGMDASTVGTAYFEDSRLYQSERN
KVETDINLAQMMRGYLSDGSKKNELIPNNTGLVDASVETQINDYNTTLLRRNRLIEGSSDANPVVQDLDRALQAMRGNIG
RAVDNAIGGLKIKAGNMKKEENVARGKAMQVPQKQRVMLSVERQQKVKEELYLYLLNKREENAINQAMTEDNIRVIDPAI
VSFDPVAPSRMRKLGLGMAIGFILPAIVIMTLSILDTGVRRRQDIEEAIDVPLLGEIPLATNKRTSQNNILVSAMGRDPL
TEAFRILRTNMSFMAREGKHPQTITLTSFIPGVGKTFTSLNLSSTLSFLNKKVIVVDMDLRKGTLSERMGIIHGKGLSHY
LSDVNLELEEIIHYNLHGKNVDYISIGMEAPNPVELLLSKRLDQLISDLRNRYDYIIIDGVPTGIVADATVVDRVSDLTL
FVIRAGKMDKRQLPEIQKIYAEKRLSNLAIILNGLKLGQSGYGYGYGYGYGYGREEGQNSWRKIARSIRTIFTRKIKH
>gnl|bykdb|A0A1T3D6S8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis] (length=786 residues).
MNQYNKHSVQKENTINVLDIFKYLLFHWKWFALSILIFGGYFYYQYSKSPFIYNRSEVVMIKTPSNTPTTARITRSFGGG
GVSVKDEILQLKSKELMRQVIDKVGADKSYKIHSGLRDNELYKKSPVQVKVEGKTHADSYGFTVTPVDTRYVLLKKWNET
SDEELKIELNRWVVTPVGKVFITPTKFYSKDYYGKDIQVTKLPREAVMGYFIANLKIKQMDEDTSLLQVSMDDVSSDRAD
DMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIEGELGAVESNIENLKIANQGMDVATSGNMYLSESNQYKTEGTKI
ETDIRLAEMMHSYLTNKNKRNALIPNNTGLVDTGVESQIAEYNTALLKRNRLAEGGNSANPVVLDMDESLNAMRNNISRA
VDNALKGLNIKLNNARQEGRTAQAKVLQMPQKERTMLSIERQHKVKEELYLFLLNKREENALNEAITEANLRIVDPPVGD
AYPIYPNRLKKLFTGVAIGTVLPMIVLLSLLLLNTAVRGRQDLENVLSVPFLGEIPLARNRRQGNGDVLVSQSGRDPLTE
AFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGTSHYLS
NPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVADLTLFI
IRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGEEKKKSVFDWFKR
>gnl|bykdb|A0A1T3EDR4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis] (length=786 residues).
MIRNSKYINIRGTWGENFHILDLFKYALGYWYWLVLSCIFFGGYYYYRYSKSLYVYRDKEVVMIKKQSSAPITSAFLQSA
ESPVNIKDEMLQLQSKELLRQVIPYMGGDKSYKISKGLRDYELYTDSPVEVILLGETSLSGYSLKVEPLDGGSVLIREWQ
SKKLEKPFKLSLNKPTRLPFGELLVKGSPHYGTPYYGKSIRVEKLPLERSVVYFLGQLKIKHLGEDTSVLELSIEDSSSK
RGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVEGELSGVEQKIEDFKLSNQGMDAQSLKSLSLSEQGENKSQG
MKIDMDISLLEMLSSYLKDADKSKGLLPSNMGLSGGNIEQQIQAYNSFFLKRNRLMEGGNNKNPVVRDLDASLVSLRQEI
QRSLDHSIRGLVQRRRQASALEQRALGQMLKVPSKEREQYSIYRSHAVKENLYLYLLNKREENALNAAIGEAKLHVVDHA
VISHVPISPNILISVFTGLGIGFLVWVALLLLRLFLNTTVKSREEIESALNIPFLGEIPYSRSKSESGMGVFVYHTGKDA
LSEAFRILRTNITFMVNSGISPQVITYTSFSAGVGKTFNTLNLAASFSYMKKRVVLVDLDLRKGTLSTRVGLEGKAGVSH
YLSGLLRDINTVIYHREIGLGVDVIPLGAIAPNPVELLLSKHLDELIEALKLKYDYVIVDGVPMGIVADANIIDRISELT
LFIIREGKLDRRMLAELENIYQERKLSNLGIVFNGVRIGAFGYGYGYGQELKGGLWSRFLRMFRRV
>gnl|bykdb|A0A1T3F6P5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia ursingii] (length=794 residues).
MDTINQKNQVVGNKKEHSVNVLDILKYLLHNWKWFALSILVFGGYYYYQYSKTPFVYNSSETVIVKTPSNTPTTARITRS
FGANSISVKDELLQLKSKELMRLVVDRINADKSYKVHRGLRDYELYKKSPVQVQVEGKSSEDSYNFTVVPLDANNVIIKN
WNPSNKDKEIKIALGKLTSTPIGKLLINPSRYYKKDYYGVEIQVVKSPRESVMGNFVGNLSIKQMEEEASLLQVTITDDS
PERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKNQYKT
EGAKIETDIRLAEMMRSYLTNRGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNTANPVVLDLDDALAAMRT
NIGRAVDNALRGLNIKLNNTRQEEGVAQSKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAIGTVLPAVVLLSMLMLNTGVRGRQDLENVLTVPFLGEIPLAKGRRQGNGDILVSQSGR
DPLTEAFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNSSIQISDILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKRS
>gnl|bykdb|A0A1T4NDR5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Anaerorhabdus furcosa] (length=237 residues).
MTNVENKMLKDLISIYDSSNPATEAYRALRTNIMYKNFDAPIKVINITSATQGEGKSTTCLNLAVVFSQLNKKVLVMDLD
LRIPTIHKKLRIRNTMGITDLLNGRATVDNVVKPVFKNIDVITTGTKIIYHSEFIQSTALMNFIERMKDEYDIILLDCPP
VGIVTDALIVSKYSDGTILVCESDKNDKKTLIRVKYQFDEVESKVLGVVITKADFGKKYYSHYNYQYQPKARKRKKK
>gnl|bykdb|A0A1T5IIR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium WCE2004] (length=808 residues).
MKTAPRKVTRNEQVNLVDLFYYLIGNWYWFLLCVLLALGVAYYRYSRMPFVYSSGVTAIIKNPGDELRTARLETYDQMIN
KVSVTNEQLQLRSLTIMTEVVKALDADVNYLDRIKFRDVELYTSQSPVRMAFNREKSDPGSVSVTVIPEDAGHIRLQTSA
GSQLVALGDTVALGRGKVVFLPTARYSPDQYGQSIRIQKIPVNWAAQAYISRLSIAHDKQILTLVEQDYNAQRAADIINM
LVVKYNEAAIREKNRVAVHTEDFINERLAIIEEELGGVEGELARFKSSNKIMDVDYTANMYLGDSRGYNAEIVAVETKLA
LSNYLKDHVVSGAESYRLIPGNMGLEDNSMDEVIARYNDLVLQRDRLVAASSTTSPAVLKLENTLGSLRSNILGMISNLQ
TSLEIQRRDLSDRERNAVAKFSSMPTKERQMLEIQRQQSIKQELYLFLLNKREENALSQAMADDNIRVVDPAVANLTPTS
PQRMKIVMLAILIGLLIPGVILIARLFLDTKIRTRKEIEENIDVPFLAEIPLNGTLRGIVFKQGKHKQGHDDPSPFVYDP
TSHTVFTEAMRMLCTNLSFLDSGKKAPFVIATTSYSSSSGKTFITANMASCLADAQKRVILVDTDMRKRSLSGVFALKHK
TKGLSNYLYDLDLTLDDILFKDVKSGIDFIPAGAVPPNPTELLGRPRLEELIEALRQKYDYILLDGVPIQMLADPIVLNR
VVDINLFILRSGQLDRRILPQLDELNDKHHLHNMAIVFNGPQIKKRRGYGFGSYGYGYGYGYGYGYGYGYGYGDEPKKKR
FLGIFKRK
>gnl|bykdb|A0A1V3N3U3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp. CZ-UAM] (length=796 residues).
MNNILERTGAGAERKNNSVNVLDIFKYLLFHWKWFVLSVLCFGLYFYYGYSKSPFIYRSTEMVMIKTPLNTPATARITNT
NNAVGSVSVTSEILQLKSKELMRETIGRIGAETSYSIRKGLRDIELYRTSPVKVDLAGAGPTSQYNLLIIPLDAQTVLLS
GRIAGKEQQEIRVPLNKTVNTTLGRLTVRPTKFYKAGVFGEEIQVRKYDREDIVGYFLGNLKITQLEEDASLLQIVIEDQ
NPQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQQELGSVESNIEQLRQSNQGVNIETAGEMYLNDSRQFQ
SARTKIETERKLTQLMQRQLHDANKRNELIPNNTGLVDGGVEAQITEYNRALLRKNRLVEGSSTANPVVQDLDKALAAMH
ENISSAVDNAVAGLDLKIRNAQQEESMAKGKALQVPKKQRIMLSVERQQKVKEELYLYLLNKREENALNLAMTEDNIRII
DRASVATSPIFPSKFRKVATGIGIGLILPTVILLFLLVFNTGVRSRQDVETVLSVPFLGEIPLSKRKSEQHAVFRVEKTG
RDPLTEAFRILRTNINFMSREGRAPQVITFTSFGVEVGKTFSSINLSATLSFMEKRTVVVDLDLRKGTLSSRLGLLDKIG
CSHFLADATVTLDTVIYPVKGLEFLDCVPIGLIAPNPVELLLSARLDELIAELRKRYDYIVVDGVPLGIVADASIVDRIS
DLTLFMIRAGKMDRRQLPEIEKIYRDRKLSNLAVALNGIKLHGPGYGYGYGYGYGYGYGNTEQQVWYKRWWRKIKS
>gnl|bykdb|A0A1V5F519 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.BinA395] (length=791 residues).
MNPDTGSINQNFTEEESSFDFQKWLHLFIKNWYLFLIFIPFFLIGGYLKNRSWMPLYQSVGTIIINENKYRSSSQGFMQG
FGLEEAYQNVNNQVIILNSYDLIGKVVDSLPFMKVDYLTIGRFKTRNLYTTTPIIIEADYVAPEAYELLFKISLHPNGTF
TISPHNNNSMPSSPINGHIGVPLQHNLFFMTVNSVSDNVKEFEMYFRFRTRETLIEDFKSRLSSRYVIEGSSILEISLIS
ETPDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVSKSLSVSEDEMTRFRRDNQIIDISSHGSELMSKANSL
DEKKAELKLKETYLNYLTKYLTGNFEEGTVVAPSNLGLNEPLLMQLVQQINELYLQRSELTEKNLYYAKYTKAIENVKTS
IFELIKNMRASLEIEKNEVNRLLADVNSQIAELPKKELEIIGIERNYKVNDNYYTFFLQKRAEAEIQKASNTPDNNILDQ
ARTVSLINADVKSNTMFMFILLGILIPSLIIVLKEVLNNTIRSIKDIEKRSVFPVIGMIRHAKNDLPDLTLKNPKSSFTE
MFRVIRTRVEFVVRRKTDIVMMVTSVDAGDGKTFFSTNMAGVYGMTGHKTLLIDMDIRKPAINRRFNVNHPKGVTNYLIN
ECTLDEIINVVPEVNYDVIFAGTVPPNPAELIRSEKIIEMMGELRKRYDYIILDSSPIGLVTDSFSLASLADVNLLVVRN
NKTHKDFFKNVVNQIVTDKLSNFYVVFTDVETDGNYYSYKYGYSSKYGYYTSKGQKNIDEYRKYYDDNNEI
>gnl|bykdb|A0A1V5S1J9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin302] (length=810 residues).
MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIMLWVLRFLKSWYLFVISLAIFLSIAYVKNRSWQPNYKSSALVIIEENKG
LSGAQAALMQGFSVERGYRNVNNQVIMFGSYELISRVIAKQPELTIDYYTQGRFKSTNLYKAAPILITKTFVSPQAYERE
FTIQDLGNNNFEISAPGTKQLPELKISGKYGIPIQNSSFFIQVDKSAIYRRNFNICFKLLNPENLAITYSAKLSFDFLMT
GASVVQASISGTVPERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIADSLRISEGRLKDYKANNFVVASVGG
SNLMGQYTQLDAMQTDLRLKESYLNYLTNYLKSNVEEGAIIAPDNLGVSDANLSSLVSQFTEMQLKRKEIGVKSPLYAKY
TRDIDAVKAQMYEALKNIRVGLDIQKADMQNRLQKLSAGMQELPYKEQQLLNIQRKFKINDDYYTFLVQKRADAQIQKAS
NSPDNIILDKARLASMTNAGEKNKAYTMFLAIGLLVPVAIIVLLELMVPYIRTESEVISMAPKQYQLLGVIMHTDRKTPV
IVDKYPKSAITEAFRVIRTRIEFLSGKSKGISVMVTSSQSGDGKSYISANIAGVFAMTGRKTILVDLDMRKPSINTGLYL
SVNKGISNYLANQISLDEAIVKHPDYKFDILPVGVVPPNPGELIKSDNMNNLISILKETYDYIVFDTSPIGLVTDAYGII
ESVDIILYAVRAEQTNKSFYKKAMSQLEANNVKKVGLIFNDVNLKKLEYSRYYDSYGSYGKKSGYYYYDKKFKSPRSQYL
NYFDNTEEEL
>gnl|bykdb|A0A1V5S5I3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin302] (length=303 residues).
MIPTAPVKKNIALVAIVLGLLIPVVIVFIRENMNTKVRGRKDLESLSLPFAGEIPLAVSGKGKKKVHNAKKIVIRQGNRD
IVNEAFRVLRTNLEFMLDAKTGGKAGVTLFTSFNPGSGKTFLAMNTAAVFALKGKRILVIDGDLRHGSASAYLGSRHKGL
SDYLGKRENNLDGLIQENPDIPGFFLLPAGTIPPNPTELLAEPMFKEAIERLRGNYDYIFIDCPPIDIVADTQIIEKLAD
RTVFVVRAGLLERDMLPELQRMYDEHRFKNMALVLNGTDGGNSRYGYRYGYHYDYGSKSYYGK
>gnl|bykdb|A0A1V6HYH8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin035] (length=219 residues).
MTSTISGEGKTFVAINLGGILALSNKKVLIIDTDLRRPKMSITFNNLNDFGLSNYLLGECNIEQCIKGTEINNLFYFPAG
SLPEYPNELLTSSKMDELLENLKKYYDIIILDTPPIGLISDTTKFVLLADTTVYVFRSEYSKKEFIVNLEKLKQELNPKE
IIIVLNGFNDKFIKQSKYGKYGYEYKYDIYGYYTDNEEKQSNTKKSMKKYFNYFYKKNK
>gnl|bykdb|A0A1Y3Z9Z6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYTWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFNLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDA
RVLDPAGGGDTPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVIRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|A0A212J9Z9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Dysgonomonas sp] (length=801 residues).
MDNNNKKVIESDPYFEEVKTKTNISFDFVLWFYRILKYWYLFIISVALFLGYAYIKNKSWVPVFYVQALMILEDRNTASV
VAGSVPTGTLLRNTENQQIVLKSYGLTERTVKSLPAKMRIEYYIQTRFKYISLYTDTPIEIEMIDIKPEAYNYAYEVTYI
DQEKCEISYKENPESETKISLIAPFDQEIDYKLFRIKLHKTPNFRKDVKGAFKPDISTFNFRFLSEAQLIGMYSGRIGSA
LQNNSSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLINDSLDISRFKLERFQKETGVYDV
SSQSLRIALDSADREKDALALREKSVLLLTEKMKEKILGTDDLMDPASMNIRNPKLSEFVVTYNELLQKARNLGAKNPLY
NKTIDELNDLRVKILQEIQVSQINLQNQKDALVRKYEVLQLKIDNLPPQERDLIKFQREFRVNEMYHQYLTQRQYEAKIQ
KASNTPDNFIWEAPRQMGGAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEECEKISGFPVIGTIENVSKK
LNNGVVLVKNYPKSSFAESFRNMRVRIEYMAQRENKITVLVTSTEPADGKTFIATNIASVYQLMGKKVIIVDLDLRRPSV
AKTLQIDSQKGISNYLIGQVTLDEIIYSHPDYGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYDYVIIDCSPVGLVS
DAYILSEIADTTLFVVRRAKTNKSFFKSVITQLKYDGVEDIALVFNDVKGREGYYGTSRYYGDRTYYLKKNSYYHDDYFE
N
>gnl|bykdb|A0A212K6G4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Dysgonomonas sp] (length=798 residues).
MDINNKPGADTDPYFEEIKAKTTLSFDFVLWFYRILKYWYLFVISIALFMAYAFIKNKSWVPFYGIQAMIILEDRGSSMI
SGAVPLGSILRNTENQQIVLESYGLTERTVKNLPKKMHIDYFIQTRFKYISLYTDSPIEIAIDSLETDITPGAYSKVFDV
AYVSDSQIRVSYKDGLDGEPEEAFNVVFDSPVENKFFKGTIRKTKNFKRDFLPFSFRFFTNSQLTGMYSGRVSTALKTEN
STALTVSMYGTDPAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLERFQKETGVYEVSSAT
VRRELDVADVDRDQVAMREKTVLFTTQKIKEGIMGSAELIDPISIGLTDEIKLSRYVEEYNQELRKSKNLGPKSPIYMTA
INKLNESRVQILRELQLIQVKLQDQKDLLVKKYQNLDLKLDNLPPQERDLIKYQREYNVNEMYHQFLTQRQYEAKIQRAS
NTPDNFIWEYPRMVGGAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECEKISGLPVIGTIENISKKLAG
GVVLVKNFPKSSFAESFRNMRVRIEYMAQRENKITILVTSTEPADGKTFIATNVASVYQLMGKKVIIVDLDLRRPSVGKT
LQIDAQKGISNYLIGQVTLDEIIISHPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYDYVIVDCSPVGLVSDAY
ILSSMADTTLFVVRRAKTNKAFFKSVITQLGFDGVENIALVFNDVKGREGYYGTSRYYGDKTYYLKKNSYYHDDYFES
>gnl|bykdb|A0A229I3A5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=823 residues).
MARPNQEEDFIRIQDLLYLCLTQWRWFILSLVVTCGIAIYYNLTTPNVYQRTASLMIKDESKAQGIGGDVASMFSDMGMG
NMKSNVNNELIAIQSPAVLLETGKRLKLDVDYAIDGRFHKEALYGADLPVTVDFVGFTDEQSGSFKLQLKGDGSYVISKL
KGVTRDNLPVDDSDEITGRIGQIIRTPLGKIKVDKAPAFTQFVSGEDESVLYVSRSNVYAMTDRIKGSLSASLSDVKSTV
IDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKSSNLLPDVEAAAQQY
MQKSTEVDKQIMDLNSRLAIAQYIRNYLTGKVGKNQLLPTNTGIESPGIEQQITEYNKSQLERNNIVANSSEQNPLVADY
DQSLTSMRKSISASLDNFVVTLKTQLGTLQANEAATTSQIASNPNQAKYLQTVGRQQKVKEALYLFLLQKREENELSKAF
TAYNTRIITPPTGDNTPVEPVRRKILLIALVLGFLIPMVVIYIREKANTTVRGRKDLKKVNVPFLGEIPFSISRKNRPTL
EQRIKFWKKPKEVRMIVVKAGKRDIVNEAFRVLRTNFEFTIGTHPEQNVIVFTSFNPGSGKSHIAANMAMSLAIKKKKVL
LIDGDLRHGSTSMLIHSPGEGLSDYLNGRIADIHDILYKGEENGLVKNFDVIPIGTIPPNPTELLFTPLLEQMIKTMREE
YDYVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLMERSMLPEVNALYKEKKFKNMTLILNGTKAHGGRYGSHYGYGYGY
GYGYNYNKEKNGGGKILNNWIIE
>gnl|bykdb|A0A235E1C0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium cellulitidis] (length=802 residues).
MVNHSTNKPFQGKGKQDQSLYVLDILRYLLANWKWFLLSILVFGGFYYYQYSKTPFLYKKEQTVMIKTATNSMSASRITR
PNNFYNIVNVNSEILQLRSQELMRNTISLLNADVSYTKEEGLRTIELYKTSPFIVRFVNAPANAGFSFNLKYKGNNQVEL
SNFSNTDPEKTVTVKLNAETKTPVGNLIISANSDKKFRVNLSEDITITKSPIESMVGYFLGNLDIVQMEDVEILKMTLED
ASPLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIEKELSSVESSLEGMKTQNQGLDVKSAGEQYWTESRTY
QSSSKELATQMKLVEIMRQRLSDPSRVDDLIPSNTGLVDNNIEDIISEYNTLLLRRNRLMSGNSSENPIVQDLNNALSQV
RQNIARAIDNVISGFRIRMSNMKDEENAAIGKARSLPSKQRIMLSAERQQKVIEELYIFLLNKREENAINRAMTDDNIRV
IDSASGSDAPFYPSKFKKVAIGVAIGIAVPAAILLLMLLLNTKIRNRKDIEDAVSVPFLAEIPFSTEMKSAKSEIVIKEQ
GVDEVTEAFRIFRTNLSFMSSGDKKQKVITFTSFNVGAGKTFSVINLGVSMTFLKKKVVLVDLDLRKGTLSNITKFPMPI
GVTHYLSDSAITVDEIIYKDRTDAEIDIVPIGVIAPNPVELLLSDRLDTLINELKERYDYIIVDNVPLGIVADADIVNRI
TDVTIFVVRAGKMDRRQLPDIQKIYDSSALTNMAILLNGVKFGSSYGYGYGGYGYGGYGYGYGYGYGQPKKKGFFSRLFG
KN
>gnl|bykdb|A0A239K409 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter ummariensis] (length=773 residues).
MVMIDKEAQKMGNRQNEQESFIDSFFKYVRYWYLFLLGLLITVGTAYVYIQHATPLYLISGTLLIKTSGNEGQLSESAAF
SDLNTFKTSKNFDNEIEVLKSYRLMRRVLSKLPVNISYYVEESLKERELYGSELPIKVVAHSLDSTAYGREVTVSFNGGK
SYNLEEGGKTFKFEFGEVVRRPYGTFTILTSDAFPQKSPKQKKIIVVFENINTLAKYYSDWLKVEPINAKASVLNISITD
PVPERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLSAELIEIEKDVEQYKRQNKLADVASQSKVYVEESNTY
QKQLAEWSVQIDVLETIETYISNSKENSYRLVPSTLSIEDPTLQELISRFNELQLERERLLRTTEKINPIILSIDQQLQS
LRVNILENIHNIKGGLVLTRRNLKDRTNLYDAKINSVPLVERELQEIDRQRGIKQQLYKYLLEKREESSLALATSAPNSL
VLRPAIIEGVPVEPKKQTVFLLAFIAGLGVPLASIFIKNAFNRKVQQRADVERATTAPVLGEVSYNDTKDVIVVSESSKT
AIAELFRLIRTNLQFVVQGGERKVILVTSSVSGEGKTFFSLNLGASLALTGKNVVVLDFDLRKQSILADLGLACEFGITD
YLSFNTVTVEEMLNQSDQVPNLFIVGSGAIPVNPAELMMSNRVEQLFEELQKKFDYILIDTAPVGQVSDAFSLSKYVDLT
VCLVRYNYTPKHEIENINDILYNNKFKQPMIVLNGAKKFNSNKYGYGYGYVKK
>gnl|bykdb|A0A239XXC4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium mizutaii] (length=796 residues).
MNKSFQGKGKQDQSLYVLDILRYLLGNWKWFLLSILIFGGYFYYQYSKTPFLYKKDQTVMIKTATNSMSASRITRPNNFY
NMVNVNSEILQLRSQELMRNTISLLNADISYSRKEGLRSVELYKTSPFIVRFRNAAPQSGFSFNLKYKGNNQVELSSFSN
SDPDKTITVKLNSEVKTPVGNLIISANSDKSYRVNLSEQITITKNPIESMVSYFLGNLKILQMEDVEILQMTLEDASPLR
AEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIEKELSSVESSLEGMKTQNQGLDVKSAGEQYWTESRTYQSSSK
ELETQMKLVEIMRQRLSDPSRVDDLIPSNTGLVDNNIEGIISEYNTLLLRRNRLMSGNSSENPIVQDLNNALSQVRQNIA
RAIDNVISGFRIRMSNMKDEENAAIGKAKSLPSKQRIMLSAERQQKVIEELYIFLLNKREENAINRAMTDDNIRVIDSAS
GSNLPFYPSKLKKVAIGVAIGIAVPAAILLLMLLLNTKVRNRKDIEDAVSVPFLAEIPFSTEMKTAKSDIVIKEQGVDEV
TEAFRIFRTNLSFMSSGDKKQKVVTFTSFNVGAGKTFSVINLGVSMTFLKKKVVLVDLDLRKGTLSNITKFPMPIGVTHY
LSDSSVTVDEIIYKDRTDSEIDIVPIGVIAPNPVELLLSERLDQLIAELKERYDYIIVDNVPLGIVADADIVNRITDVTI
FVVRAGKMDRRQLPDVQKIYDSSALTNMAILLNGVKFGNNPYGYGGYGYGGYGYGYGYGYSAQQKRGFFSRLFGKK
>gnl|bykdb|A0A2A4N9A6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=815 residues).
MKENQIQNPLPDLDIGLLIGIFRKSFLLFCLIFAMAMFGVWLFLRYTPPIYQAVTHIRAASNKAVELGTFVNFLEKDKNK
MLLEELQEEIAILKSVFMIKKTLTTMNYGVSYFAEGDLLTQELYKSSNYKVDFMVKDPIIYQVRFNIEILNTREFKLLYS
IDKKYDNIYNFGTWIRTEFADFKVSLKESDAIITDSKSNIYYFLINNLDEQARFKFAPAIQTLITNLSARTMILNFRDPN
PAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIEIQLLNSTNKLMNINLDTKTIANISRVFQSEGKYIINDN
PEFLIAQKINDLKLEINIIDTVNYYLNNNISLENIILLPKEAYVTIIGQLRELELQKKFLAQHETELGPNTKLINGQIKA
NKKILLYSIKAIRATLFAQLALIDKAVRQKQKLDSEVNFDAAIEYLRVSTAYKMEKKYYERLLEKHANLQIHAAGIINDV
VILAEASVPKIQEYPSPVYAMLTGIISFLMLSLITVIFRYMLHNKISHLSDIDRSTNATVLGIIPQFKREEMPISQLVVE
KNPKAGITEALRSLRANLQFISTNPGPKIMAITSTISTEGKTFVAINMAGIIALSGKKVIILDLDLRKPRIHKAFEIDNA
KGMSTILIGKDKVEDCIFKSNIDTLHFIPSGPIPPNPAELIINQRTEELLAVLRKQYDLIVIDTPPIGIVSDGIDIIRKA
DYPLYIFRADYSKKDFVKIMNKLMNDHKISKLALILNESGGGSQYGYGYGYGYGYGYGYGYGYGYGYGYYAEDASRNKSL
WERITNSKFISLLKN
>gnl|bykdb|A0A2E0MDX6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=235 residues).
MQFIANNEGSKIITVTSTISGEGKTFVAINLGGIIAFSEKKVIILDLDMRKPKTHIGFNVQNTIGMSTLLIGQSSLEDCI
QKSHLENLHFITAGPIPPNPAELIISNKMTDVINELKNLYDVIVIDTPPVGIVTDAFPIISKVDYPVYIVRAHFSKKVFL
KNIQMLRDKKKIKNLSVILNGAGGDKKYGGFRKYGYGYGYGYGYGYGYGYGGNHGYYEEKPQKEKTTFNKIFSKK
>gnl|bykdb|A0A2E0VQ27 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Saprospirales bacterium] (length=767 residues).
MTFNKEYKMIIRPLLKASPVLIGLITIAILVTRRAVTYMTPEYRAGGAIKINNLNYTQAAINLFGEENEKNLPRQNENFL
AEVEVFQTRDLIRKTLENLHWELTTYRVGDVRLSEIYEERPFKIDYGVNDDKALDKTIYFDYLGEGRFRFFDGSPKDSAH
ATIVDQGQLIEKNGLLLTIEPDSAFLKLKPNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPVDKEVSIIKVYFNHELPE
KAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVKKRLGDAEAGLAGYRSENQLINSTQETDAVLRELTQLNLQK
VDLDMKTSELKRLQEYLLSGNSLSDFSPNFEALSDPIFRGSYLKAQSYEEQRQDYLQKYTLQHPLILNLDQKIKETRAFL
NESVNSTLENLQQKTLELESQIAEVNQKVERFPEKERQLVVLQRQVALNEALYNYLMRKYTELSIMQQSDLFPHKIIEHA
VRPKATVAPNKSLYYGMAFLLALLAGMFYAYLRSYVKETVSSKDELEEKLPQYPIIGEVYRLTRKTPPGFSLVSGLTANL
RDLPKPETKGQAQLFVLSSNMPNEGKTFVSARIAKAMAAYGYKVLLLDLDVRKPELHEELGMDNSDGFCEAIKSDRHALD
LVQNTSDENLYFIPAGQYDDSLEGKVFSAKALDIIHDLRWHFDMVIVDVAPIGLFDDSIVLMRKSTANLFLIRKGTTRLR
QLKPINELLDSFQIPNLYLVLNGVRQKAKKGAYARYLKKRKPAPALS
>gnl|bykdb|A0A2E3GN39 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Saprospirales bacterium] (length=784 residues).
MLLSSGVAHIFLHFSTRIYSSKGVLIHIAGEEKQSLLGLDKTLPNQDFTPTDFQQDVRVITSPIIVNKAFSQKGLNYVFY
EVGDFRSLEIYPNPYFTIDSFYQDPKMRRVSIDYSVLINQQKDSVRLDYIYQGKSWGGFLKPGKPYSDENIYLAISNLDQ
KLLEGSAESQKSILFKVYTDEQLSNELMAITSIEPNKETFAILVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQS
ISFLDKQIDSIKPLYDDALIAVRNAEAQKGYRNIEALGGGLYKDIKDLQKKLVRIEYVTSVLEWFAVMIQQEEDLSLAST
QLSGEEFDGITRALSVDEILKLEYEKESALMQVTPEHPTVVLIERNLDKARATLIAQVEINIDKFQQEKDAVVAEINKLL
EELDLLPLFEAEYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIVSDYIILEMPKIAEKHVAPDDSFIRFVGLAIGAILS
LILVVFRYVTHKEIINIEDITSQTETSLLGVIQRYSEKLPMSSIVVTNRPKSGISESFRGVRSNLEFLDADKGFRSIAVT
STIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRIHKIFDLPNSAGMSTLLNKRSTKEDITFSTSEENLWAVPAGPI
PPNPSELIGGEPFINFIDEVKTSFDVVIFDTPPIGLVTDSIPVISTVNNPIYVLRADYSHRSFVGHIESTKENLQVPSLS
IIMNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYGYGYYSDSDNTRKKERSSLFSIFRKKS
>gnl|bykdb|A0A2G6H6Y4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=817 residues).
METSNNQIQSMQQFSEEDNTSSLSVMEWIMRCVRYWYLFVIGASIGFGLAFYKNQKVVPNYLSYSQILLEDKKADSFATL
QNYSSRGSGKGVENQIVILKSWDMVTRTIDSLPQFKIDFFKILTFKQKALYENLPINVEILSTYDNSFDNYYRFEVTGEK
SFNISVLDEHDEVLEVVDGEYGEPIGCKYFLVKVLRDERYNEIPQFYFRFRTRMSLIQEFVGRLEVAPIDKTSVLNLSLA
SNNPARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVSDSLSRSEAKLNSYKIEHKIYSSDMTSVLVGQMEKL
KNQGKQIKLRDEYFKYIKRYLNKNIQTESLASPTTIGIQEPRLISLVDKYNELQLQLIDLGVKNPQYEIVIAQIEQIKKQ
LKELIASVSDVYSIETDLYKKDLNTLKSELVEAPSKELRMLDYQRRFRINDEYYTYLLQKRAAAEILKASNTPDNTVLQT
AMISGQLNDKEKRTNYLIFIVLGLMIPVVLIVLKEFMNSAVRTEKDVDIATKNRFDIIGSVLHTKHKTEDKVIAPKYPNS
YFVEQLRVIRTKVEIILGRKEAITMLISSTESGDGKTYMSLNLAGVFGLQNKKVLLIDFDIRKPNLTENLQESLSKHKVG
FVNYMIGECSLEEAIDTTGYGFDFLKAGVMPPNPGEFVRSPKLEQMITELKSMYDYIIIDTSPLGLVTDSYALFPMVDVK
LLVVRSFKTSKREFSELTRRLYMDKVKNVYIILNDVDRSKTGYGYGYGYGYGYGYGGSKKNNAYYVTAEFEKENTTAFQR
VIEFVGDITKKIRNIKK
>gnl|bykdb|A0A2G6R1T9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter sp] (length=776 residues).
MEENSLNQQQFDDSEESGFDFMSWVILLVQYWYLFVIFGVLAFGASYLKNRSWVPVYFSSGKLMIDPNAGQNNPQFMQGF
GVESGHKNMANQVILLTSRDLISQVVDNLPEMRVEYISKGKFKTRNLYKMSPIQIETNYISTEAYGVLFKIEINEDGSYV
ISDDKGVIDEDLEIRGKIGVPVKSKLFVINVTKDIEFSNKTMFFRFRTKTSLVNEFSGLYPEFINKSSVLSISLQSPTPQ
RDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIKQTLKGSENDITEFRRSNQIVDITTHTSEIVEKSTEYNERK
SALRLKEKYLNYLADYIKTNLSSGNIIIPTNTGLNESTLVVLAQQFNELLEERNSTSRKNPVYKKLTREINNIKASINEA
IKSMRKSIQIEKQDIDSKIAAVRSKMNMLPKKETQMTALTRQYKIDDNYYNFFISKKAEAQIQKAANSPDNEVVEQARVR
FVVNGGKKKETTMTYLLFGLMIPAIFLIARELLNNTIRGQKDVEKNSKFPIIGNIRHTKKANPLLTLKHPRSSFTEMFRV
IRTRIEFIVQRKTGIMMLGTSTESGDGKTYVNINLASVYGMTGKKTLLIDMDIRKPSVGDRLGISEKAGVTNYLIGENEL
DDLIIKNDDFSFDVLLGGTVPPNPGELIRSEKLKGMLKELRTRYEYIIIDTSPIVRNEKTNKAFFKRINEQIVSDKFNNF
YIVLNDINITSKAYGRYGYGYGYGYGYGYGYGYGYGVKNKKDNQYTHYYNDDDIDI
>gnl|bykdb|A0A2K8ZAP1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Spirosoma pollinicola] (length=384 residues).
MKNTNAAISENIETIRQQLISNRNQLVANNQRMEGMIRTVPGKERALLNITRQQGIKNNLYTYLLQKREETALSAASRVS
DSRIVDPAHTTSQPVKPVKLMIFALFAVVGLVIPIGVITAKDTVNNHVLRRSDVEEVTQIPIIGEVIKERQLGTESFVFK
SRMHSVIGEQIRALRTNLLFLNGDAQKNQVILFTSSISGDGKSFMSLNLGASLALVNRKTVIVDMDMRKPKLHKSLHIEN
KLGLSNYLTGEADLDNLLHPIIGHENYYIITAGSLPLNPSELLSSPRLANLLQELKERFEYILVDSPPIGLVTDSQVIAP
YADATIFVVRHDHTPKNYIKMVDALYKEQRFQKLSIVLNGVGKGESLSYSYNYGDYMDLTKKFD
>gnl|bykdb|A0A2M7KCE1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium CG_4_8_14_3_um_filter_31_14] (length=239 residues).
SEAFRSVRSSLEFIKNIKESKTIAISSTISGEGKTFIALNLGGIYSFQGKKTILIDLDLRKPRFHLCFNTDNSKGLSTIL
IGKNKVHDCIKKSKIANLDYITAGPIPPNPSELTAGNEILNVINELKQIYDVIIIDTPPLGLVTDALNIFKSCDYPIYVV
KAHYSKRSFLYNLNHLLLEKHIENLSVVVNGIDIEKSRYGGYNYGYGYGYGNSEYHTDYYDESITKKKKNIFTKIISHL
>gnl|bykdb|A0A2M7VVW6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium CG_4_10_14_0_2_um_filter_32_8] (length=304 residues).
MIMATGVLLGIVISLIILILKYVLKNTISTMDEITKFSNGAVGILGTVPTYNREIPISQLVINRDPKSVISEAFRTIRTN
LQFISKSEESKLMAITSTISGEGKTFCAINLSGIIAMSGKKVIILDLDMRKPKIHLGFGVKNDKGMSTILIDKDQIKECI
HHSELTNLDFITSGPIPPNPSELIISGKLDEVIAELKKEYDLVVLDNPPIGLVSDAMEMLKKADYPIYVFKSEYSRKNFI
NNLNKLIVENGIKKLSIVLNGVDYSNKYYSYGYNYNYSYGNKDGYYYDDTQKEKLTKRIFKKKK
>gnl|bykdb|A0A2P8CDS1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prolixibacter denitrificans] (length=824 residues).
MDTQNPLTPNQPTTFSRPRNYRKYFFLLLSHWYWFVIAFILTVTGIWLYYRYSHPVYAVSSTMLIHEQQNQNPLTTQKDP
ESNVFQGFGLFQGKQNTENQIQILKSWTQVRTTLEHFNFEATYYKIGRFRTIELYKDVPFHIELDRSHPQLLDANFDLHF
LPNNRVEMTIQGKKAVRYDYRNEKELQPEKEIEETRTFPIDSFVASDDYAFRIIPAADSKLEGNYRVVFHSLDELTADYL
NRLTVAPISKEGTIVKLSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVSDSLSASQKIRERFQS
RNNLLDVSYQSQQLLDQLVKLEDQKSLLETQHQYYQYLETYLSRNDNLQSLVAPTTVGIDDPLLVNLLQELSQLNIEKTT
LSATVKDPDHPRMRQLNIQMETTKRTLLENSRNIMHQSEITLNDLTKRIDNLQQRTRNLPSVERNYVNIERRYQLNNDTY
TFLLQKLSEAQIAKASNMPDNEIIDPARMEGNTPISPNNMTIYLVALLFGIFLPAGGIILKNEFDNKVRTPEDLENLTKY
PILGHIIHDDQAAISHTALLDHPNSPVGETYRALRMKLKFMLNGTEQPVIAVTSTGSDEGKTFTAMNLAASFALLGQKAV
LLDLDLRNSKMAEMHNYDKNRGVSNYLLGEMRLEDITFRSTHPYMWLIPSGSFPPNPGELLADKKLKELIELLKEEYDVI
VIDSSPLLVADLFQYSHLCNAYLYVSRQGVTPQPAIKSALQEISNQHIRNVGILLNDIRINNQPLGDRYNYSYMYGYGYK
TQKPKNRPAAYWRKVNSKKQAQTT
>gnl|bykdb|A0A2P8G5K0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter jiangsuensis] (length=524 residues).
MSVQDVLPRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARISSELALVETNIEHFRKRHRIIDMAEDGRQALQ
KSATNALEEKELAIRLKIVRLLEAHLLEKPAAAIPSALYPQEGTFEALAGKYNEMQMARIMALATLAPEHPQLRSLEKQI
EVLRNNLLDAIGLQIQELTVNAAAIRKYGKESEAEISKLPAHQRAFLAQSREQGIQQELYLFLLKKRVETAISRSANIAN
ARVIDPPKASRLPVYPNRELTILIAVFTGILTPLGVLYTSQIFNNKITSKEDIQRQCDVMILGEISQQSRTGLLKVADNR
SLIKEQFRSLRTNIQFTTGERPHMVILLTSAMANEGKSFVAMHLAHSLALAGKKVLLVDFDLRKPSLATLLNLRPNGVTE
CIASGHEPLIQQNSSETSFDFLAAGQQSPGTGEIILSPKVADLISTLKIRYDYVLLDSPPVGLVADARLLGAHADMTLYI
VRQHFTFIHQLAEIQNARNQSLLPDLHVVLNGTRSLHRYQYNYY
>gnl|bykdb|A0A2T2TDL4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium QH_6_63_17] (length=214 residues).
LQLGRPDETNTTVLVTSPGSGDGKSLTAANLATVTAQAGHSTLLIDGDLRRPRLHEVFDVSRTPGITEALQNDLDEHAMK
RPLIDNLCVLPAGTEVENPAKVLGSSRFRDFLQRAEQYFDHVIVDSSPVLATADGPLLSDLCETTLCVARAGTTTEAELD
HAMEVLSGIGANVAGVVFNGFDISMAYGYKYRYRHYDQYGPYDQYRSLPEEASA
>gnl|bykdb|A0A2T2UAJ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium QH_2_63_10] (length=425 residues).
GGKGVGYVAEQRRGLAQSRIELNGLQARLDVLNERLRENRQKLEQIPTQSIKLAQPQRERRSTEQIYSFVQEKLQEARLA
EQSEIGYAEIIRSAAPGRPVGPDTRRNLLLGLMLGLVAGGGLVVLREQLDTRIYQPDDLREHGHHVLGVVPSMTPLIDDE
FGGQETIEIDGRSVNTLLAMLVSPMSAAAEAYRRIRTNLRFAKPDDDLQTMAVSSADKGDGKTTTCANLALALASAGKRT
IVVDADLRRPWMHEMLNVDRDLGLSQVLYEGELDPEAYATEVENLFVIPAGDTVPNPAELLGSNRMKEFVEALEAKFDYV
LIDTPPALLFSDVLGLAPRCDGTLLVVAAGETDGRAFDHAAEMLADGEADVAGAVLNQFDASSSVLQSYGYNYGYAYSYR
RLYEYYRDEDKGAPEPSGIRAWWGG
>gnl|bykdb|A0A2T4XEQ1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=356 residues).
DVNIAESIYLTISRQYAETALWEQTQFGLGRPLDYAVAPLSPFKPNKRLFILIGIFLGGAVGVGLAFGREFLNRTIDGLD
KLKGSGYPILAVIPDFTEYVKKKYEEKSKVAVKGRLVSTNWFSLLDNISPVTESYRRLHNNIIYSQPDLEVKTILVTSPG
KGEGKTTTAVNLAGILAESGKRVLIIDFDFRRPNLHKTLGESQTPGILELLFDGVHFDDVIRETAYPGIHCLTTGRRSPN
PASVAQSDKLKSIVEGVKDQYDYVVIDSAPYGIITDAAPMMKMADGIVVSVRFNKTQTNELAQTLENLENIHVSILGLSL
VGYDHKISSDYYYQNKYKYYSYNDYLEYTEEKEEVA
>gnl|bykdb|A0A2T5RP38 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia sp. YR191] (length=793 residues).
MNTLNQKEYRIGERKEQTINVLDLLKYLLHNWKWFALSILVFGGYYYYQYCKTPFVYSRSEVVMIKNSSNTPTTARITRT
NVSSSVSVKDEILQLRSKELMRQTIDRLGADISYKVHRGLRDYELYKKSPVKVVFSNKSPESRYGFTIIPIDAKNVIVKD
WNKNVDGQEVKVVLNQLTKTPFGEIIIVPSKYYHKDNYGESILVTKYPREEMMLGLMGNLKVKQMEEDASLLQVSLDDLS
SERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIESELGAVEANIENLKIDNQGLDIETAGGMYLSESNQYKT
EKTKTETDLRLAEMMRSYLNNKNRNELIPNNTGLVDASVESQIAEYNMALLKRNRLAEGGNTLNPVVVDLDEALKSMRNN
INRAVDNALRGLTIKMRNAQREEEQAIGKTLQMPKKQRAMLSVERQHKVKEELYLYLLNKREENALNEAMTDENIRVVDP
ASGPDVAVYPNRLKKIFTGVALGTAVPAVILLSMLVLNTGVRGRQDLENVLSVPFLGEIPLARGRRQGKGDILVSGSGRD
PLTEAFRILRTNINFMTKDDAPPKVLTFTSFSAGVGKTFSVLNLATTLSFLEKKVVVIDLDLRKGTLSSRVDLLHGKGSS
HYLSSPSISIDEIIHKSDVAEGVDFIPIGAIAPNPVELLLGKRLDELITKLKERYDYVIIDGVPVGIVADASIIDRVADL
TLFIIRIGKMDRRQLPEIEKIYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKRS
>gnl|bykdb|A0A2U0UG39 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides galacturonicus] (length=232 residues).
MQTINIERLRKLDYRANEAYKNLRTNIQLCGSDIKVIMLTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
>gnl|bykdb|A0A2U0UJ71 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides galacturonicus] (length=309 residues).
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
DKSFEKARKASSARKNTNNASKPVKRQAGSVGEVAARKKANVAGNNTGVRKKPSADEFDGDFLMDYDEK
>gnl|bykdb|A0A2V3PNY7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas alginatilytica] (length=796 residues).
MEQNINRPADFGTDPYFDEVQAKTKFTFDFVLWFYRILKYWYLFALSLALFLGYAYIKNKSWTPLYQSGAVLMMESRGNA
GVAIGSVQLGTLVQNSINQQMLLNSYDMVVRAVAKLPQMRVDYFKKSKFKVENWYGVTPVTIEAKYVAPSAYSIVFEIEP
INSEKCRIFYEGSETTQPFSMEVPYDQFVQEPRFYIKITKSPRFAPNFEPFSFRFVSKEELIGRYSGRISSGLVRDGSTA
LGISIFGSSPAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIADSLQQSEIIFKDFQDETGLYRITKSDGRV
ELESVMKSIGEVKAQEDLILRLTDEISNSILNKTELIDPTALGLNEPKLARSIGEYNNLVNKLSSMGSAHPMYAKSEQSL
TNLRINILEELRALQDRVQNKKESLDNNTKEIEDKMATLPAQEREYIRYEKRYQVNDAYYTYLRQRRYEATIQKASNIPD
NFIMEAPRQKGGPVNGDEKRKNYTFYFFIGLGLPLLFVIAKEEIFNLVISTKEDCERLSGLPVIGTIENISKKLSSSGST
TLVKNFPKSSFAESFRNMRIRIEYIAQKETGISTLITSAEPGDGKTFIAGNIASVYQLTGKKVVLIDFDLRRPSVGKLLS
IESKKGVSNYLIGQVTLDEITITHPEYEFDVITAGTLPPNPSELIKTKKTKDLLDHLKSKYDYVIVDCSPIGLVSDAYIL
SKYVDTTLFVVRRGKTNKAFFKSVVSQMRNDGLEHAALVFNDVKGREGYYGTSRYYGDKSYYLKRNSYYHDDYFEK
>gnl|bykdb|A0A2W4RDE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=783 residues).
MEEEKINIKKIFHKLISKWYYFPLGLLITMPLAYAYIQLTEPRYLVRASMLLKGEKDKGPSQFLKGMELFQSATDLEDEI
GIIKSFSNVESAIKRLNFGISYYTEKNFKTAEHYGNTPFTIHLDSSVHQLINVPIYIERLSSSKYMVSVRGKEVPTYDVI
TNTVKDRVPVVDIQEVVDINKPFQSKNLSFSITFNDAFKLEPDSKMFFRINNQVSLAERYRNQLNIEPISKESNIVQLTI
EQAVPQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVSDSLRRVEGTLESFRARSNVIDIRTSAQTLTNNLD
KLETERANLEVKLKYYQYILQSLQSGKNTDIVAPSTFGVDDPLLSNLLIELSKLNQERSGLNYSAREGNPLAQVIELKIT
NLKASITENVSNIIDATNIALNDLNQRIARLNAQLERLPRNERELVKIQRRYDFSDNVYNYLLEKRAEAGIAIASNVVEK
SVVDEAMMVGSAPVSPNKRMIYAAAFILGFGGALGLLILKDFLNDNIVTHEDLEQYTRIPFLGVVSHGSRREQSNVVANA
LSPVGESFRSLRVNLQYLTLGKEVNVIGITSSRESEGKTYCSVNLAAAMANSRRRTILIDADMRRPKVASYFQLENDKGL
SNYLIGEASLKEIINETGIKGYDVITSGPIPPNPLDLIGTPRMAELLNELKQSYHTIIIDSPPIGFVSEYIILMKYTDAN
IYVVRSDYTTKYNLDRINKLYDERKVTNISILLNDVKYSRVNGYSYSYKYKQKKYKQRSYKAV
>gnl|bykdb|A0A2W7QSQ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Algoriphagus ratkowskyi] (length=779 residues).
MRKINKKVNSNEEPINIKLILRTILKSWYLFPIFILLFCGVAYYYIKTITPEYLISSVIIIKEGERNNNVTENSIVSDLE
NMKSTITVENELEKLKSKSLLMDAVIKNKGFINYYNAEDFFKTKIDPFQSSIDITVDSISKSFISPSESFEIQPISETKF
LLILDEDKQKEFEYGQKIKFSFGIISIQKKPASDDFATEMGNVLVELVNPQVAAENYSRVLEFQNPSVKSSTLYIRLYDT
SPEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVKNDLEEFEKSGENFKTRNNITDISMNSKIYLENTAETR
KQVAEVSGKIDILESIELTMNNQSGQFDLIPGGLADLDPSLSGLLTQYNTLQRDKQRIIRIVQPNNPQLLSLNDQIVNVK
SNILANISSIKSNLLISKRNFETTLNENSYKAQSIPGIERELVEISRNTDLKQEQYQYLLRKRDEAVLTLEVTGVSSAQM
VDPPIASLKPVKPNKLMIMAAALGLGLSLPLGLILVNYLVTSKVTSKRVIEKILNAQILGEIAKNDQNGVIAISPKSISP
AAEQLRMIRSNLKFQSGDNNKVILVSSSMSGEGKTFFCLNLAATLSIVDKKVVVVDLDLRRPSIFKSLNIKSKHSLFDYL
NHDIKDLKEIITPSGINSNMDIIGLNKSIENASEIITSQKIIKLINSLKSSYDHIIIDTSPIGLVADAYSLSEIVDLVVY
VVRMNYTRVDNLHALAEIIDENIFKQNFVVLNDSNEYSGSKFGYGYYSGKDTDVVSTRA
>gnl|bykdb|A0A2W7RD29 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Algoriphagus chordae] (length=808 residues).
MNNKSESDPLLLSSQKIDFSVFFKRLGKKWPLFLLTGIICLFIAHTSYKSTVTTYEINSKLFIYTEGQSINFFEKLQNVT
NSQNVLLDNEVVIIKSNPVIKSTLEVLDLKVGYYVPPETTSKNFWSFNKSNLPIEIYEDAPFEIELKENDKSIEEKFFRI
SWVDSLSYSVRFVGDEPTTSMFNSNQDEGSGKSYVCKFNEWCGLPFLTLRTRLLEAKNDGNFLFKIRNEESLISEFSGNL
AIYPATTGGSILDIRLITNNPAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVSDTLGVIENELQNFRAANQ
TTNISSEGEVIFGRLQSMGEELAKEKIKKEYLLSLDRYLRNNDFDNIVVPSLVGITDPTINSLIDELINLQNEKSNQLVT
LTDSSPIVIEQQKRIVISKKNTLELVKSAISNIDISIDDLNYRISEISKDFRKLPFTEQNLIKIEREFTLNEGIYNFLLQ
KRAEAAISKASNINNNKIIEQAKANALPIGPRKLNFYGYAIIITFLLPVIITFLQETVFKKLVDPSEIEKLLNIPVIGSI
PVAEGKTNVQLVDYPNSKVAESFRLLRTNLNFILPNSESTVLLVSSVLPAEGKSFTSVNLATAFALTELKVLIIDCDLRK
PKVSDYLGVDNTAGLSNYLSRRVDDESTIVKATSIPGLSCITSGPYPPNPSELIANKEIIKLLIKMKDQFDIIILDTPPL
GIVSDSMSLFPLVDVSLLAFKCGYNNHKGIVELNKLKSNDFIKKVYCILNGVDSHYHIGSNKNYGYYEVYKDNKGLVNRV
KNYLRSSK
>gnl|bykdb|A0A2X2J8S4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium multivorum] (length=796 residues).
MENRPEVVNNQFFGAKNNSTFNVLDIIKYLLFHWPWFLLSVCIFGGYYYYQYSKTTFSYRQASTVMIKTPANTPSSATLT
RSGMSYNTVNLATEMLQLKSKELMRETVESIKADVSYVVRRQLRDYELYNESPVLVQFVNYNPSGSFSFTITPRDNKSVL
VVENVGKDKEKVYIAPLNKAIKTSFGGIRILATPYYTKAAYDQEISVNKLSSIDMANALLGRLSITQTTDDASLLQIAME
DSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILSEELGSVEGDLEKIKVNNNGMDVAEVGGMYIEDSRS
YRLEATKIDTDLKLAEMMSDYLSKSDKQTALIPNNTGLIDGNIEGQIQAYNTLQIRKNKLMEDGNSENPIVKEIDKSLNT
MRSGIERTLGNTISGLQVKKNNAVKEENRASGKSRQMPQKQRLVLSIERQQKVKESLYVFLLNKREENAINQAMTDDNIK
VIDPASGSFAPVYPNKFKKVGLGVAIGLVIPSLLLILMLVVDSGVRNRKDLEEGLSVPFLGEIPLAKKNKHTVGNVSVSQ
TGRDALTEAFRILRTNINFMSRGGVPPKVITFSSARVGAGKTFSVINLATTLSFLNKRVIMVDLDLRKGTLSSRIPVPVR
KGITHYLSDKELNLSEVIYKTEVSDNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYDYIIIDSVPVEIIADAYITDR
VSELTIFVIRSGKMDKRELPDIEKIYQSKKLSNMAILFNGVNSGKRGYGYGYGYGYGYGYRYGDDKKSFWKKVFNK
>gnl|bykdb|A0A348PT57 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=384 residues).
SKEIEYARIERVYNSNEKYYTLLLEKKTEYAISEAGFISENRVLRRASTSRIPISPVKPIIYASFLALGLILSFLLIGIR
YILNNDISGVHDLSRLMNPRISLLGVVPKYSKNIPLSQLIIDKNPKSVMAEAFRTLRTNLDFFQTDNEKKIIAVTSTISG
EGKTFVAINLGGILAFSDKKVIILDLDMRKPRIHKGFNSTNEYGMSTYLSNRDNLKDIIRKSELDGLHFITAGPIPPNPS
ELIISGNLTKGLDELKKIYDIIIIDNPPVGLVTDGIASLKLADYPIYIFRNEYSKKSFIDNINRIFIENKITNLSAVLNS
VDLSRARYGSYGRGYGAKYGYGYGYGYGYGYTSGNGYYSEDNEEEEPKLNFLRNLRSKLKNDDN
>gnl|bykdb|A0A350PNH9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp] (length=833 residues).
MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYHLLSTPCVYQRTASILIKEDGKSQSIN
SDVASMFSDMGISGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHGNLFSIVHVSGTDKAGNQVESDEEVQGKLGQTVRTAMGHVCVDQAPGYSAFINGHESRKLHVTRTNLYAMTNHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDTKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYCISRKNRPTLLQRIQFWKKPKETLQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGN
IAMSLAIKKKKVLVIDGDLRRGATSMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFT
DRLEKMIRQMRGEYDYVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLMQRSMLGDIEQFYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGGAKIGK
>gnl|bykdb|A0A350V3E4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=738 residues).
MPILLSLAVGLVVSYFYAYSQVDIYASASSMRLSKPKENVLENKIFSDIEGELPERYINNEVEILKSFAIREKTAASLLD
SFQVLKGKIPFYLLSATPENQVDPKSKNQIANVLSAVTEISQKRGLDIVSIKTESPSPQEAALISNCYAEAYADYSMKFN
RGHLTLNREFLEKQVQEKYNSLLQTEDKLTNFLRTENVVELNAQANSIISSLSGIEGDYNRSLIDVQSTTRALTDIKGEL
DKYDPKATDYFESKITDPYVAELQGEIARLEIQRDLAKTGNDELVKNSKSLKDINNKVAELKRSLDEKLNILKEGANSNS
PEEMRSLTSKYFETKVLNNQNKIKESLLRGYLNKYQEKFNKLPAQSIEYANLERERLANEKVYLMLLEKYQEALINEESQ
PNNVKIIDYGKVPKAPSKPNRFLIITIGLLIGLGLGYGFALLRNILDVSVKSPEDLENIGISLIGWVPTFMREPKAGRHT
HTEQELVLAYNSDSVPAEAFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISSNLAASFALSSRVLLLDCDFRKPRM
HNIFNMKRYPGLCDYLFGTVTIEEAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMMKPKYDYILIDSPPLATVT
DAELLSSYVDGTVVVSLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYYYYYGSEKGKESAGTNGKS
TNGVNTNGSQKEKIIKPN
>gnl|bykdb|A0A352ME00 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=790 residues).
MLKTIEPDSSIAPLKYFILKVASLKYLYMALIVLCLAIAFFYNHFSKKVYEASASLSPVEDKTSSLLKSNELFSGIQSLE
SLRNIENDIKNLSSFELVYSTVNSMNLEVSYFSESKKLLKQTNELFGTTPFTVSIDKSHIQPIGANIYVSILDESSFRLT
ASQKKVSYYNYVDNQIISEDNFFEIDTICKFNETISNKVVRFSVALNKDFPLKKTEDKSRYYFKFNHLDYLAKGYLKQLE
IEKASPLASIINVRFSENNLDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMADSLVRSESALKNYRSANQV
MDLSFQGQRVYEQMTDIDNERANLKVQERYYNYVINYFKMNADVSGLAPPSAMNVSDPIINQMITNLNDLNAQRSTIIAG
SNPQKNIFIGQIDSKIDFQKQIILENFTNNLNTLTLSLNELDYRQNKLSKEASSLPRTEMNMVSMKRKFDLNDEIYTFLL
QKRSEAQISLASTRPDYEIVEPARTITSRIVAPKSAINYMMALFFGLLLPTLYLMIRDFFDDKIRSINDAEYMLHRSVMS
VIYSNNLKSEAVVAEFPKSAISESFRNLRSSLFLKSDHEKSKVILITSSQPQDGKSFVSLNLSSSIASVGYKTVLIDCDL
RRPTLHIKLKEDNAKGISNFMIKKATADEIIRNTAITNLDFISAGPVIPNPSELMESGILDNLINYLKTKYDYIIIDTTP
VGIVADAILMMKYASKVLMVIRNNYTRKDIFANVINNLKSNKLTNYDIVYNDLNLHKSSYRHYSNYYIKN
>gnl|bykdb|A0A353WYK7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=779 residues).
MEQNQQFDFDKLQMVFKRSLPVLIMLLIFSVATAYLTIRYTKDLYQSESVLQLDIKSEAQVLGFRSFDEDINNLSKEIEL
LKSKLFFTRVAEVINNDVNVFAYGKVLFEERYQNSPFFVEYKIEPQYFDHPFDVDILNSKKFILRLKKGDQVIENTYSFG
EEIVCDGFVFMLALSPHYRKDNDNVHYFFKINSPQSNIRYLMDNTEVKPLDFKAKTISVTFKDFNKYKAQDILMAIDTLY
IYYTQLEKNRVNDQKIKFLNEQLHQTESTLSELENYFENFTIDNRTTDMNVSLSRTITMLEELDSIKMKLNDQLDNFNEI
YDKLLDTADLQLGNSELRMLSSEVAQDINRLEELKKEMNILKGAYKTNTFAYRKKKEEINFLRERIIGYVEESRKGIYDK
LDEINLKKNRLETDFSSLPSKSTEYAKTERYYDLYEEFYLSLMKNKAQFELAQAGTVTDFKILSSASLPSNPIAPNKILI
WAGAIIASVILSFLFIIIRYLLHNSVSSEKDIEHITPTSILGSIPFVEKLKGRDSDRLVIDKVPKSEISEAFRSIRTNLE
FIKRTDKNTVIAITSTVSGEGKTFVTVNLGGVISLLKSKVVLVDLDMRKPRLQKVFYHNIQAKGVSTILIEKHSVEECIL
KTNLENLDYISSGPIPPNPSELIHTGSFDKMIGDLKSKYDVVIIDTPPVGLVTDGILALKKSDIALFVVRSGFSKKSFIQ
NIDRLVKAHHLDQSSIIFNANRSSKNYGYGSYGKSYGYYEEPEYLESNLFATFKSLFSK
>gnl|bykdb|A0A354LNT9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp] (length=833 residues).
MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYNLLSTPCVYQRTASILIKEDGKSQSIN
SDVASMFSDMGISGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHGNLFSIVHVSGTDKAGNQVESDEEVQGKLGQTVRTAMGHVCVDQAPGYSAFINGHESRKLHVTRTNLYAMTDHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDTKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYSISRKNRPTLLQRIQFWKKPKETRQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGN
IAMSLAIKKKKVLVIDGDLRLGSTSMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFT
DRLEKMIRQMRGEYDYVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLMQRSMLGDIEQFYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGDAKIGK
>gnl|bykdb|A0A355BP94 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=773 residues).
MSKQLNSPTTDPIEGFDLDKLWVLLKKNALIIILLFLSTNLIAYLKIRWTKDEFESYSELKLEVKQDATALGIKQFAEDQ
NRNLVAGEIEQMKSKLFFSRVLDSLDLGISYYSLGNVLEHEMYRRSPFKARCIGNVESFQDQPIFVDFVEGNKYQLWVGE
NGTKQTGTLGEPVVVSDANFVIELSPNATPDFKNHFFFVMNSRNRLLDFLSSNLRIEPINFDANTIRVTFRDFNPLKVYT
VVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVENKMEGFENYFEDFTLKNKSSDLTTELRQTIYALNQVDSQRFSLN
KRILELNGYIEELSTGKLVQVAPRNFLPEYLNTRIEEYLKLVRGKERLALSYKDNTFAYQQKDQELNAARTALFTQLAEI
KKQWLGAMLELNQKKESLEKKFASMPDKSTQYSKNQRFYKLYEEFYLSMMQAKAEFEIAQAGSTPDLKILSSAILPGRPV
APNRYLILGIGLVAGLVINFFFISIVYLLSNKITSLQEIERTIHVPVLGVIPEMRRNTTSPFYIVENPRSIVSEAIRTLR
TNLDFFTSSETNKIIVISSTVSGEGKSFLAMNLGGILAMSNKKVILLDLDMRKAKEILHARVTDPSKGISTLLIHKTTLE
ESITKTDMAGFDYIPSGPHPPNPSELLLSKAFEDLLAELRTRYDYIVIDTPPVGLVTDGIMAMKRADLSIYVVRANYSRK
EFLSNLERIVSINKLSHVAVVLNALPTSGKTYGYGYYHEDQKKRSLIRKIFRS
>gnl|bykdb|A0A356Z058 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=787 residues).
MTKETDSGIALIKHYLQDIAYFKYFYIICLVILLTVAFLFNKYSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN
RNLESGISNFISFPTVSSTISSMNLEIGYFREKHHLFRQVSELYLRSPYVVIMDKSHIQPIDVKLRVFILSDTTFRLVID
QNTVSLYNYLDNQIVIENVPLKVDTICRFNETIRGKTFKFSVSFNRDFYTRETNMEDFYYFSFFHLDYLTKDYLKKLEVE
PISPKTSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQVMD
LSFQGKSLYEKLEQIETERANLQIQERYYNYIINNFKSSNDMSGVVPPSAMNVADPIMNQLITQLLLLYSQRSGIASNNA
EKNLFLGQIDNKIKVQKQAIIETVTNNLNTLNLSLNELNYRADKLSREISQLPRTELNMVGLQRKFDLSDVIYTYLLQKR
SEAAITMASNYPDFEVIEPAREFTKKIIVPRPKLSYLLAIFFGLAIPTTFIFIRNFFNNKISSIYDLESLINQSGMGVIF
NNNYKSEAVVLEAPKSAIAESFRNLRSSLFLKLKSEKSKVIVITSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKP
TLHEKFKEDNSSGISNFMVKNATVTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGL
VADATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSYYLKK
>gnl|bykdb|A0A359ATS6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=233 residues).
RDVINEAFRVVRTNLEFMDGSGEPDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKSVLVIDGDLRRGSISDYVDTPKIG
LSDYLGKRIDTPEEIIVVDKKHPTLHILPVGTIPPNPTELLVEERLKELINRMRSRYDYILIDCPPIDVVADTAIIEKLA
DRTIFVVRAGLLERSMLVELEKIYNEQKYKNMCVILNGTTGNGGRYGYGYRYGYKYGYHYGSEKKKTWWGNKG
>gnl|bykdb|A0A365UKN1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=794 residues).
MDTINQKNQVIGNKKEHSVNVLDILKYLLHNWKWFALSILVFGGYYYYQYSKTPFVYNSSEIVIVKTPSNTPTTARITRS
FGANTISVKDELLQLKSKELMRLVVDRINADKSYKVHRGLRDYELYKKSPVQVQVEGKSSEDSYSFTVVPVDANNVIIKN
WNPENKDKEIKVALNRLTLTPVGKVLITPSKYYTKDYYEVEIQVAKLPREAVMGSFVGNLTINQIEEEASLLQLTIKDDS
PERAADILTSLITVYNDVFLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKNQYKT
EGAKIETDIRLAEMMRSYLNNRGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNSSNPVVLDLDDALAAMRT
NISRAVDNALRGLNVKLNNTRQEEGIAQGKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAMGAVLPAVVLLSMLMLNTGVRGRQDLENVLTVPFLGEIPLARGRKQGNGDVLVSQSGR
DPLTEAFRILRTNINFMTKNEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNSSIKISDILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGSYGYGYGEEKKKSIFDWFKRS
>gnl|bykdb|A0A368D1N7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=821 residues).
MSEPSKKKQQSSVLYDKFNVGLLLYVLRKSFKWFFLFMLLSSGIAHIFLHFSTRIYSSKGVLIHIAGEDKQNLLGLDKTL
PSQNFTPTDFQQDVRVITSPIVVNKAFRQKGLNYIFYEVGDFRSLEIYPNPYFTIDSFYQDYKMRRVSIDYSILINQQKD
SVRLDYIYQGKSWGGFLKPGKPYADENIYLAISNLDQKLLEGNAENQKSILFKVYTDEQLSNELMAITSIEPNKETFAIQ
VSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIKPLYDGALIAVRNAEAQKGYRNIEALGGGLYE
DVKELQRKLVRIEYVTSVLEWFAVMVQQEEDLNLASTQLSGEDFDGVTRALSVDEILKLEYEKESALMQVTPEHPTVVLI
ERNLDKARATLIAQVEINIDKNQQERDAVVAEINKLLEELDLLPLFEAEYLRLKRDYEVKSSFYNSLLDRKASFTLSRAG
IVSDYIILEMPKIAEQHVAPDDSFIRFVGLAIGAILSLILVVIRYITHKEIINIEDITSQTETSLLGIIQRYSEKLPVSS
IVVTNRPKSGISESFRGVRSNLEFLEEEKGFRSIAVTSTIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRIHKIFD
LPNSSGMSTLLNKRSIKEDIIFSTPEENLWAIPAGPIPPNPSELIGGDSFVNFLDEVKTLFEVVIFDTPPIGLVTDAIPV
ISRANNPIYVLRADYSHREFVGHIESIKDNLKVPNLSIVLNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYGYGYYS
DPDNTRKKKRSSLISRFRKKS
>gnl|bykdb|A0A372Y7D2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM18-9] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDIMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A376E091 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia meningoseptica] (length=788 residues).
MNQYNKHSVQKENTINVLDIFKYLLFHWKWFALSILIFGGYFYYQYSKSPFIYNRSEVVMIKTPSNTPTTARITRSFGGG
GVSVKDEILQLKSKELMRQVIDKVGADKSYKIHSGLRDYELYKKSPVQVKVEGKTHADSYGFTVTPVDTRYVLLKKWNET
SDEELKIELNRWVVTPVGKVFITPTKFYNKDYYGKDIQVTKLPREAVMGYFIANLKIKQMDEDTSLLQVSMDDVSSDRAD
DMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIEGELGAVESNIENLKIANQGMDVATSGNMYLSESNQYKTEGTKI
ETDIRLAEMMHSYLTNKNKRNALIPNNTGLVDTGVESQIAEYNTALLKRNRLAEGGNSANPVVLDMDESLNAMRNNISRA
VDNALKGLNIKLNNARQEGRTAQAKVLQMPQKERTMLSIERQHKVKEELYLFLLNKREENALNEAITEANLRIVDPPVGD
AYPIYPNRLKKLFTGVAIGTVLPMIVLLSLLLLNTAVRGRQDLENVLSVPFLGEIPLARNRRQGNGDVLVSQSGRDPLTE
AFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGTSHYLS
NPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVADLTLFI
IRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKR
>gnl|bykdb|A0A389LWV6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=795 residues).
MESTNTKSTNFSIDDTNFQHPGNTSSFDLVLWIFRILKYWYLFLVVILLSLSLALLKNKTWTPTYKTSSTILINENKGQQ
VSDLTTGFAVSQGLRNVNNQMIMYGSYDLISKSVDKLDISTDIYHKGLLKSVSYYKASPILIKSNFISEEAASLDFRIRG
IDTTAYEITFDGAKNIAPFSIVGNYGTSLQHNLFFVTVDKTDQFPHTVKYELNFNFLSRGQQIADYNNRLNCSFLLDGAS
VMEISLVGKVTQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILKDSISSAESKLNAYQSQAGIFSSDNSLRS
STELVDLDKKKAEIRLRKEYTKFLQDNLKKEDGNLVPPSSMGIQDVELAVLVSKYNDIFFEIKGLGSENPIYKRYKLQLT
DIKSSINQSIVSMKNSIGIEEADLNQRYSKLSAEVASLPDKERKLLTHERDFKINDSYNTYLLQRRIESQIQLASNMPDN
LVLDNARTTGLVNAGDISNTYVYFVVTGLILTIIFIFLKEVLLKTSIQSRSEVEKISELPILGTIEHTERKEMMVLYKYP
KSSFAENFRHLRSRMIYLTKRDSPIVMLITSTEPRDGKTFVACNLASAYQMTGKKTLMIDFDLRRPALSKALDLDTQKGL
SNFLIGKASLADVVISHPDFGFDILPAGTIPPNPSELINSEMTKKLLSFLSKEYEYIILDCSPVGLVSDAHFLAKLADVV
LYVVRNEKTNRNFFKHTISEFKGDVTSGKMAIIYNDVDLDGNYYASRNYYGKSSYYHKHNSYYNNDEFVDEQNQN
>gnl|bykdb|A0A3A5RIJ2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CF01-10NS] (length=783 residues).
MALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDFMGQINV
ASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFSKGTELR
RVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVRAADILD
MLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIKELDTQL
QLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIFRALDNL
SASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVSGSNIPI
SPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPLSEAFRI
LRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHYLSNPLV
SADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTLFIVRVG
KLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A3A6AD54 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF25-18] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3A6MIU7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF17-1] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3B8TU58 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=779 residues).
MLLSSGVAHIFLHFATRVYDSKGVIIHIGGEQKQNLLGFDRDFQKQFTNTDFQQDIRVLTSPLVINNAYSDKGLNLLFYD
VGNFRSLEIYPNPYFSVDSFYQAPELTKINIDYHMFLSRKKDSIRLEYIYKGSTWGGHLKPGKPFIDENIFISISNFDES
LLTDEFEGEKNIFFNVYDNNRLADEMLSNIKIEPNKETFSVAITGKHPSKAKALVMVDLLIESFLNFHLYQKTESIKQSI
SFLDEQIDSIKPLYDEALVAVRNAEAQKGYRNIEALGGGLYADVKNLQQKLVRLDYLISVLGWFAVMVEQEEDLSLASTQ
LSGADFEGIINGLSVSEILNLEAEKEKALMQVTPEHPAIVLIERNLDKARVTLVAQVRINIERYQQERQLMIDEINKILE
ELDVLPLFEAEYLRLKRDYETKAMFYNNLIERKSSFSLSKAGIVSDYTILENPKIAKNHISPNDSFIRFVGLAIGAILSL
ILVVFRYITHKEIINIEDVTSQTETALLGVIQRYSEKLPMSSIVVTNRPKSGISESFRGVRSNLEFLAAEKNFRSIAVTS
TIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRVHKIFNLPNSAGMSTLLNKRSIKEDVTFSTSEENLWAIPAGPIP
PNPSELIGGDSFVNFIEEIKTSFDVLVFDTPPIGLVTDSIPVISKVNNPIYVMRADYSHRSFVGHIESTKENLQIPNLSI
IVNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYYSDPDETRENERTGFFSRFRKNS
>gnl|bykdb|A0A3C0I8F1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Microscillaceae bacterium] (length=834 residues).
DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRGSIPFIILIVGLSLGGSYLFLRYTKALFQSSS
DLRLSIRDEAQPGGLPIQTAPINNNAHLLGEIEFIKSELLHEEVIKKMNLGLTIYAQGNILDNELYGNVPFEIKWWATAN
NPWFDKRFDVQIVDPKHFVLAFEQGRGVIKQKYQFNDTIHLSGMSLVLIPKPAINISKNYYFIINSRYALLSYLQSKLKV
DIINHNAGIIRISFKDHNAEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVDEELTKYESLLEGSLIENKTT
DLLSKFSTSVKESENFGEKKAEITNLLNLLDQLEVQAQNDSIITTLMPEVNLPGIDFNSLILKINALFSEIASISYYKTD
NNATLKVKRTQLIKYQKELRAQINEAQRMLNKEIGALQSKFSRAQGEFLKIPSKETELKRIKRLHTIYEAFYSQMLNKKA
EIGISRSAIVPEFVILAPASQPTKPIYPVPTNIYSLGLAAGVVLSLLLVAIRYLLNNTVANQKELEKIIIAPVLGVIPFH
NKQKNAKYSKLVILDNPKSTINEALRSVRTNLDFVLNKSGGLNDTSTSKVISITSTISGEGKTFVAANLAGIIAMLNLKV
LIIDFDMRRPKVHIAFDREEEDNLKGTSTILIGRHTPQECIQHTPIENLDFIPSGPIPPNPSELILRPICDEFIKQLTLS
YDVIILDTPPIGLVTDGVLLMQKAEVPIYIFKANYSKKAFSKSINKLILKNNFTNLSVVLNAVNKRFSYGYGYGYGYGAY
YGKRSVAYYNDSESNYKPIRWINRIYKRAMSFRK
>gnl|bykdb|A0A3C0S618 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp] (length=796 residues).
MENRPEVVNNQFFGAKNNSTFNVLDIIKYLLFHWPWFLLSVCIFGGYYYYQYSKTTFTYRQASTVMIKTPANTPSSATLT
RSGMSYNTVNLATEMLQLKSKELMRETVESIKADVSYVVRRQLRDYELYNESPVLVQFVNYNPSGSFSFTITPRDNKSVL
VVENLGKDKEKVYIAPLNKAIKTSFGGIRILATPYYTKAAYDQEISVNKLSSIDMANALLGRLSITQTTDDASLLQIAME
DSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILSEELGSVEGDLEKIKINNNGMDVAEVGGMYIEDSRS
YRLEATKIDTDLKLAEMMSDYLSKSDKQTALIPNNTGLIDGNIEGQIQAYNTLQIRKNKLMEDGNSENPIVKEIDKSLNT
MRSGIERTLGNTISGLQVKKNNAVKEENRASGKSRQMPQKQRLVLSIERQQKVKESLYVFLLNKREENAINQAMTDDNIK
VIDPASGSFAPVYPDKFKKVGLGVAIGLVVPSVILILLLIVDSGVRNRKDLEDGLSVPFLGEIPLAKKNKHTVGNVSVSQ
TGRDALTEAFRILRTNINFMSRGGVPPKVITFSSARVGAGKTFSVINLATTLSFLNKRVIMVDLDLRKGTLSSRIPVPVR
KGITHYLSDKELNPSEVIYKTEISDNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYDYIIIDSVPVEIIADAYITDR
VSELTIFVIRSGKMDKRELPDIEKIYQSKKLSNMAILFNGVNSGKRGYGYGYGYGYGYSYRYGDDKKSFWKKVFNK
>gnl|bykdb|A0A3D0FMX4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=803 residues).
MATDTNVQNQDFTNQDDRIQFDVMEWVFKFLSVWYLYVICLAIAFGISIYSNRKWVPTYRTAGTLIINEYGSQASNALMQ
GFGVDVGYRNVNNQVIMMGSYDLMCRVVDSLPFMRTDYISRGRFKDTYLYRYTPVVFEPSEIRPEGYEHLYKLDIGTNGQ
LTVSIADEDTKNPMTFNTIYGQTFDCGLFSGLFMPTEYMTEKTTIYFRFRSQESLVADFSSRLTLNFVAEGSSVLTIQLV
SETPERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIRKSLASSESAMTDFRKRNEIVDIQSYSSELLGKVNA
YDQERLAMRLKETYFEYLTNYLNTTMEQGTVIAPSTMGLDAQALGTLVTQLNDLQIKRAELSEKNIYYDKYTTDMQNIKV
AILEVLSSMRASMDIEKKDLELRFSEVRAGINALPEKELEMVALERNYRIDDNYYTFFLQKRAESEIQKASNTPDNDRLD
KARILECTNAGAKNANRTKYLLLGLIIPFLFVILRELLNNKVRTTREAEALSHYKLLAQVRHTRGSNPTEVVDHPRSSYA
EQLRALRTRIEFVVRRKTGIMVLTTSAQSGDGKTYLSTNLAALYAMSGKKTLLMDMDIRKPNIHEKLGTSIEKGLTNYLI
GEISKQEMIQHDPSYEFDIIYAGSIPPNPGELIRSDQVVELLEELRSEYDYIVIDSSPIGLVTDAYALIERSDITLFVVR
YNKTQRNFCREVLAQMEEDGKQNIYIVFSDLPHERSGRYNYNSKSYHYGYGYGYGYGGYGYGYGYGYGSRKKGTNHYYTD
EDE
>gnl|bykdb|A0A3D0QPV7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=816 residues).
MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARKSLRWVLLFLITSLLAAWLYLRYTPPVYESLSVIQISEENNMK
QVIPGINSFEDEQSGVDKALELMRSEFLFKKSIEKLDFTVSFFSEGQILTENKYPAKYLRFSDLTIIDSTIFGERIDIFS
NSNQITLNCRNQTFTTESGGLLQSPWFRARITVADPQTIQAIQSENKLYFVFNHPDQLLTQYFPAINVQVLNASAKTLQI
SMRDHNKAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVYTKLKNSELELQAFRQLNKVQNFEGVSKNYLER
LTELEGQLLKVDIDEELIIEVERALKEYHNESDIYNVLSILSGTRFESELSGMVKELHVLILTKEKEKFSSTSKSTYMKS
LDYQIDIQLKMINQAITSLKNQFSKRKGSLKDKIRQYETIYYGLPEKEIEHARMERMFAINEKYHTMLLEKKTEYEISLA
GQTTGNQILEQATIPKLPVSPKKRMIVIAFFFIGILFSSVMIVIRYLMHNEITTLHEITRISNASLGILGIIPKYKEDIP
VSQLIVDKNPKSLISEAFRTIRTNMQFLTADKDAKLVSVTSTISGEGKTFVAINLAGMIAFSGKKVVILDLDMRKPKIHI
GFGTDNEVGMSSLLIGRDQLEQCIRKSEMENLHFITAGPIPPNPAELIINGKLDSILEELKRIYDIVIVDLPPVGLVTDG
IPIVQMADYPIYVFRANYSKKNFVQNADRLVNENNIQRLSVVLNSVDTDRGSSGYNYGYGYGYGYGYGYTYGGNYYTERT
NATEKKIRFFRRKNKK
>gnl|bykdb|A0A3D1AEJ6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=212 residues).
MDFMRVKQDNIKVITTTSTSVGSGKTFVSSNLAASLAMTGKKVLLMDMDIRKGTLGKGVDTHKNIEGYDIGLTSYLSKIV
TKVESLIIQDQDYPNIDIIRSGPEPPNPAELLLSPRLDELIRELREMYDFIVIDNVPAGMVADAMISNRVTDLTLYIIRA
GKMDRRMLPEIEQLYREERLKNMAVILNGTGSGIGYGYGYGYGYGYGNDKDK
>gnl|bykdb|A0A3D1BT36 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=796 residues).
MSKNNETKSESLKIKEFIFKVFSYKYYFISSIILLGLMAFLLNKFTPAVYEVNSIIGPVENKQSSLLESSDIFSGLGSLS
QSRNLENDINSLKSFSLISETIKNLALEIGYFIESDDILGQVRQVYPNSHYTVNIDKSHIQPINARFYINIVSDTTYRLT
VSEDDVSFYNYLDNKVISAGHMLNIDTVYKFNQTIASPYFRFSVSKNQDYLNQRPVDEERSFFMMNHIDIITEQYLNRLT
VESVSLKSTLINVFFQGENLDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEISESLSSSQSELRDYRSTHQV
TDLSYQGQQALNQMEQIDNEKATLQAQQRYYNYIIDYFNNNQDIAGLAPPSAANVSDPIMNTLVLELLDLNSQRSAILSN
NVQKSLFLEQIENKINLQKQTIIENVKNNLNTLSLTLNELDYRAEKLSSQIARLPRTELNMVSMQRQYNITDAIYTFMLQ
KRSEAGIAMASNHPDYEVLESARSITSSIIKPKKMINYIASFFLGLLIPSLIIILKDFFNEKITRAYEIEDVLGKPVLST
IYNNSFKYEDVVHKAVGSPIAESFRNLRSNLFFRSKTNPLKVILVTSCQPQDGKSFVAMNLASSIASVGHKTIILDCDLR
RPTLHDKFKIDNEGGITKYLTDKNVDNDIILKTFVDNLDFIPAGPVLPNSSELIEAGALDKLIQYLEDNYEYIIIDTTPS
GMVADAAQLIKYSSINLLVCRNNHTRKDVFNSVLNFYKTHNIENFDIIYNDVEIKESRYGRYHGYYKKPKAFTARK
>gnl|bykdb|A0A3D1MEL0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=782 residues).
MLLSSGIAHIFLHFSTRIYSSKGVLIHIAGEEKQSLLGLDKTLPSQNFTPTDFQQDVRVITSPIVVNTAFSQKGLNYIFY
EVGDFRSLEIYPNPYFTIDSFYQDPKMRRVSIDYSILINQQKDSVRLDYIYQGKSWGGFLKPGKPYVDENIYLDISNLDQ
KLLDESAENQKSILFKVYTDEQLSNELMAITSIEPNKETFAIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQS
IAFLDQQIDSIKPLYDDALIAVRNAEAQKGYRNIEALGGGLYQDVKELQKKLVRIEYVTSVLEWFAVMVQQEEDLSLVST
QLSGEEFDGVTRALSVDEILNLEYEKESALMQVTPEHPTVVLIERNLDKARATLIAQVEINIDKNQQERDAVVAEINKML
EELDLLPLFEAEYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIVSDYIVLEVPKIAEEHVAPDDSFIRFVGLAIGAILS
LILVVFRYITHKEIINIEDITSQTETSLLGVIQRYSEKLPMSSIVVTNRPKSGISESFRGVRSNLEFLEAEKGFRSIAVT
STIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRIHKIFDLPNSAGMSTLLNKRSTKEDITFSTPEENLWAIPAGPI
PPNPSELIGGDSFVNFLDEVKTSFEVVIFDTPPIGLVTDAIPVISGTNNPIYVLRADYSHRSFVGHIESTKDNLKVTNLS
IVLNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYGYYSDPDNTRKKERSILFSRFRKKT
>gnl|bykdb|A0A3D2HF71 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=816 residues).
MTSPSPLNNPSQPYYIPPEEEGLDFKRYLSLFISNWYWFAGALLIALSIAYSINRWSEDVYSVSSTLLIKDEQLMGGLSS
GTTTLFPGMEAFRSQQNLKNEMGILRSFTLNYRVMQEMPDFHVDYTAVGRRGIVEKRIYNKSPFIVIYDSLNKQTIGEKV
NVKILSAKKYKIEIDGERNFSKEMNFGDRFNEQGFDFIIELRDKNNFVFDPNASNRYYFYFVSPQSLANIYRSKLSVSPV
EEEASLVTLTVTGTNPEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIISDSLHLAENSLESFRLANRLIDLS
REGVAIQNRLEEIDKEKTSLMLQKNYYEYLKDYIDTKKESGEIIAPSVMGVTDQLLIRLVEELSQLQKQKKQLSLNLLES
TGPLRVLEGNIANTRIAISNNIADGLANIEKSISEADKRLNEVEREIMKLPSTERQMINIQRKFDINNTVYTFLLEKRAE
AGIARASTVSDNRIIDYAGVYSSTMIKPKERQNFMLAIILGLFFPGIGILLLDYFNNKIIDKKDIEKRTSAPIIGFIGHN
TFKTDLPAVEHTGSSLAESLRSVRTNLKYFMKDISNPVIAVSSTITGEGKTFVAVNLAAIIALPGKKVLLIDLDLRKPKA
HKILGNNDNTEGISKYLIGESKIEDIIIKTEVENLWYAPAGPIPPNPAELIESESMKEFIDKAKKDFEFIIIDTPPAAVV
TDALLLADLADFYIFVVRQRFSSKNTVELIEELYRNETIGRIGIVMNDISLTGYYGYGLRYGYAGGYGYSYGYNYYGDYV
YSRYGHSGEGKYYIEE
>gnl|bykdb|A0A3D3HL11 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=791 residues).
MQLMTNNNDSQSEAFNIKEFLAEALSYKYFYIASFFICLLIAFLVNRFSPTVYEVNSVIGPVEDRRSSMLGSNDLFSGLG
ALAESRNLENDINSLNSFSLVATTIRSMNLEVGYFAGKNTIFQKPTQVYLGNPFSVIIDKSHIQPINTRFRVDILDDQSY
RLTASEDEASYYNYIDNAVVSTENRVRIDTICRFNETVTSYNYKFSIGFNKEYYNPKLSGETDYYFEFYHLDQLTRTYLR
RLKVEPVSIRSSLINVLFHGENRRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEISDSLTQSESKLRDYRSA
NQVTDLSYQGQQALEQMRQIENERSMLQVQERYYNYILDYFDKNQDMTSLAPPSSSNVVDPILSSMIMELQQSSAERANI
LSNNAEKNLFLGQIENKIRLLKQAIIENVKNNLNTLNLTQNELDYRESKLSGEISRLPRTELNMVSMQRQFNLTDQIYTF
LLEKKAEAAIAMASNYPDYEILEPARDVTASIIAPRTNLNWLIALFMAFMVPTIYIILKNFFNEKISSVRDVEHMIGQPV
MNLIYTNFYKTESVVKDYPGSSIAESFRNLRSSLFLKFRSEPQKVIMITSAQPQDGKSFVSSNLAASIASVGHKTVLLDC
DLRRPTLHEKLKIVNSVGLSNYMVNNASTKEIIKKTDVDNLWFIPAGPILPNSSELIEAGVLDSLIEELKQQFDYVIIDS
TPAGLVADATLMIKYASYILLVCRNDYTRKDVFTDVLNLFRTNNITDYDIVFNDLNLKKSRYGRYDNYYKQ
>gnl|bykdb|A0A3D3LSK1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=370 residues).
NKIGIVNSLSSQYNAQIKTLPSQVIEYAKLERDKLAAEKLYAALESNYQESLINERTQTIKSYVIDPGYDDNSPIGPDRR
NMNIFGIIAGLIIGLAFALMRIYFNKNLSTPEELESKGVSLLSWIPNIEQITDKSDPTNDFIVAKKPSSQISEAFKALRT
RITFSKLEDKPLKTILVTSSLPSDGKTIVSVNLAGSFALDNKKVILIDCDLRKPRVHTVFEFDRFPGLSDFLFHHVNFED
IVRDSGFDNLSVITAGTIPPNPSEMLGSLQMKKFLELVESKYDIVILDSPPLISVTDSEILYNLTDGTVLVAQAEKTDKK
AFFKTYNQLKRINPHNLLGAVLNNFKFNTSYGYYYNYYYYYSGDSKKKNN
>gnl|bykdb|A0A3D4CJE1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=568 residues).
IAFQSANARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYYNKLKVSENKLQKFQKENKISGSSEFSAMYME
KLNRLENQLIDLDLQINVLKEIQNKAKNANDNMQVYDLLSILAGTDYESTINGLITNLQRLLDKKQQLQNEVTPDSEILK
TLNLQIEAQRDLIIESLRSLLDKLLTQRNEVAQKIKEFEQKFYNIPAKELEYARLERMFSIDEKFFTLLLEKRTEYSISE
AGFVPQHTILEQAEIPNVPIKPNKKLIFVVFVFGSLVLGIGFVVIKYLFHNEITSVADITQEGKAKLGVLGVIPKYKKEI
PVSQLIIDKNPKSVISESFRTIRANLQFISNKPGSKVMAITSTVSGEGKTFVAINIAGIIAYSGKKVIILDLDMRKPKIH
LGFNVENDRGMSTLLIGNDSLNNCIKHSALKGLDFITAGPIPPNPSELIINGNLTEIIEELKQTYDLVIIDNPPIGLVTD
ALYTISMADYPIYVLRANYSKKEYLKNAYRIYEENNIHKLSLVLNSVDFEQGQYGYGYGYGYGYGYGYGYYEDVPEKQVW
WKAIFNKK
>gnl|bykdb|A0A3D4RLG4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=444 residues).
MHKYKATSKICRKKNWRWSLSNAITELMTTTXTQKNVYYAKYTKDIENVKTAINEVVGSMRASLEIEKKDLQNRYKEVEK
EIPNLPTKELQMVAIERNYRIDDNYYTFFLQKRAETEIQKASNTPDNAVLDKARTTYITNAKQQRKTMISYLALGFLLPL
VLSVLIELIYNKLRIPKEVERLSSFPLIGSLRHVRSQNPTLVQKNPRSSYTEMLRTIRTKIEFIVGRKQNIVLSITSTQS
GDGKTFLATNLAALYGMTGKKTLLIDLDIRKPNIHEKLGVDAGLGVTNYLIGECEIEDILHKDTSYNFDFLLAGTIPPNP
GELIRTDKLVSLLQELRKQYDFIIIDTSPIGQVPDAFALIEQTDLTLYVIRCMQTNKYFCKNTLQQMEADYKDKVQLVFS
DMPVEKKRKRLGRKSYGYAYNSYGYGYGYGYGGKNDYNYYSDDE
>gnl|bykdb|A0A3D5KRM7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=251 residues).
MVENSESDSLDNIRYSKTRIMPLDAEVLQDNRIIMGLYNDQRADLFRVLRTNILKQLRENNWNSFFITSATPGAGKSWVA
TNLAIAIALEGNQTVLLVDADLRHPSICNHLGLNCKFGLIDYLSGVTSLEQILIHPKIENLVLLPGKESKVNYSELISSP
KMIEFIKETKSRYESRIIIFDVPPLFVADDALLYMSYCDAALFVVEDEKNTVDEIKHSMKILEETNLLGIVLNKSRQPIP
SYKYGYGYGYG
>gnl|bykdb|A0A3E0QD27 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=804 residues).
MGKKKITNLNEEFDFKLFSIIAKKNAYWLFVILTICFTSAFLYLRYTLPIYESRGILKIGTVNTANAVLNIGSNQALEVL
GSNQLAGDVELIRSRVIVSRVVGALPLDVSYYAHGKVIDHEMYLSSPFRIEYEIEDSAIFSIPFYLDFESEKVFHLRYPT
HEGEKVKAFQTNVWNKVPGLKFRMTVQNWAAIQKQEINLQDEAYYFIINNSTTLVERYFKNLTVVLMNQVAQTILIKFND
NNAVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGIDVELRASEGSLEQFKKDNMIIDPRQNASEALTHINKL
IEQRVEMQLQLAVMNRLERDITSDSEVESLLPFLSGSYSDGVILSIVSKIHELEDKRSNLRFIATDKNAAVISLEQDIDF
QKKNLVMSIQNARLSIREKINNIDERIREFEGNFLKLPSQEAELSRLSRLFEINQKFYQLLLEKKVEFSITKAGIISNNI
VLERGKPAVNPLSPNRRLVIAGSLLLGFIISFLIIFVKYLFYNEITTLDEINLYTDAALLGIIPKYKNEIPVSQLLVDKN
PKSAISESFRSVRTNLQFISNEPGPKVVAITSTISGEGKTFVAINLAGVIAFSEKRVVIIDLDMRKPKIHLGFNVENTKG
MSTILIGKDEADNCIRKSNLTNLDFITAGPIPPNPSELILSRKMVELVEYLKSKYDVVIIDTPPVGIVTDGVDVIQNADY
PIYIIRAQYSKRMFINNLNRLIEESKVRNLAVVLNGVETSRFRYGYGYGYGYGYGYGYGYGYYDDEAKKPLTTWQAFKAR
LGKK
>gnl|bykdb|A0A3E4JJC9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNRKQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRGTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3E4WDQ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNRKQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3M1NUH2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=238 residues).
MSPVVESYRHLRTNIQFSRPDTVVETIVVTSPSVEEGKSTTAANLAVVMAEAGRRTVLIDADLRRPRVHQLFGRELGPGL
AHFLVQEPRFDEELVATPIDNLWIIPAGKVVPRSSELFATRVMRDFIESLRARFDVIILDTPPVRVATDAALLATQCDLT
LVVVRAGQTREGELEFAMESLAAVGAPAIGTVFNGFDVSMAYGYKYRYRHYDRYTQYTSEYGTYGYRDVKELLKDKES
>gnl|bykdb|A0A3M1TXY5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=695 residues).
LDFGISYYLKEGLKTRQTYHYAPFEVQLDSSHVQIVGAKFFVRPISDTEYEIEADEKSAEIWNIAEDALVHELEPFVFNK
RLRFGQPYTDQNLSFTLHRNPDFEVKKGQRFYFVIHGLKDLAERYQSALKVEAVSKEARLLNITSEGPVVSMQNQFINTL
LNTYIQNDLEKQREIGRKMLMLIDEQLTGVTDSLRKAEFSLRGFRAGTNIVDIGVTSKDLTDQLTELERQRAALAVAGQY
YEYVLEDIQADNSLAEVVAPASTGIEDPLLTSLLVDLARLKQERAAIRLTAKERSPKVQNIDAKINNVRQAILKNVNTSI
RANNIAISNVNERIEALRTRLRRLPESERILTNIKRNFDHSSEVHKYLLQKRAETAIALATDIANKFVVDEAKQVGSGPV
SPKVGLIYAVAFVLSLGLPLAIMLVYDFFNEKISGDQDIEACTNIPILGYIARYEKSNNYIIEKDSRTSFAESFRSLRVK
MLFVVEGDKKKVIGVTSSSSGEGKTFCATNLAATLAHAGKQTLLIDTDLRRPKVQTYFRTEHHAGLSDFLCGEVDYVNEI
IHSTHIENLHIIPAGNPSNNPTDLISNSRMKELVEACMDEYDHIIFDTPPIGLVSDYLILMHLTDYNIYVVRHNVTEVAD
LKLINELFETGKIQNIGLLLNGVASLSDYGYLDTDYGINGYVKKGKKRKRYEAIN
>gnl|bykdb|A0A3M1Y2F5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=437 residues).
NINDPFLQSLMGKLTELVSERAELDFSVTADNPNIDRINLEISRVKSSLLENINNRVSSTEFELESVEDQIRTANGRLSR
LPRNERMLTQMGRTYESINELYSYLQKKKTEAEIALANLTVDLMIIDPARYTGKESRNSRMLIMALALILAIGLPAGFLV
VLSYFSDKVSTYQELKKATPIPVLGTVIKNDDGLEVIKQSTSYSPLAECFRAVRVHIYNKLTNKREKIDVSERGILLGVC
STWSDEGKSFCAANLAASFGIGGYNTLLVDLDLRNPSQPEYFRYPRQMGISNGLLGPERSHWKKWIIKDVESQIDILPAG
PHLPNSIDLLDTGAFEELIEELPLHYQYVIVDLPPIMQASDYMLVEKWLDFTAFVVRHQQTRLQDLERINELFEQERIGK
IGLLINHVANPAQFRHGDASYYTYGKKYAKVYGAMHT
>gnl|bykdb|A0A3N2LCI3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-077] (length=448 residues).
KMLPMNSGVANVDIQSQITDYNNLVLQRNSLLAKSSDKNPLVVQLNEQMDQMRHAILASVDNSINALNMQISSLQGSQAS
TTSKIASNPSQAKYLLSVERQQKVKESLYLFLLQKREENELSQAFTAYNTRVVNKPASFGPTAPNTRNILMMSFLLGLAI
PFGVVYLMESNNTKVRGRKDVEHLAVPFLGELPQDGHEKKKEAGEANTIVVKGGKLDIINEAFRVLRTNVEFMCNSSEGN
KVIAMTSFNPGSGKSFVSMNLGMAIALKGKKVLIVDGDMRHGSTSAYMGSPAKGLADYLGGAVSEVDTLIVKTPECQNMQ
VLPIGSIPPNPTELLESPRFGELIGELKSRFDYVIIDCPPIEVVADAQIIDKFADRTFFVIRAGLFDRSMLPELDRLYEE
KKYRNMSFILNGSRNDQGRYGYSHTYRYGYGYGYGYGYNYGSGEKKEE
>gnl|bykdb|A0A3N2NDY8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-114] (length=804 residues).
MSDNINVTQESEAAEEFSLKDFLACCLSKWRWFTVSIVLFCCLGVLYVLRQQPVYSRSMELLIKDQDGGGGVADISNAFS
SLGLVSSNTNVNNELISLSSPAVMYEVVKNLGLDVNYSTPGRFHEKTLYGSNLPVNVKFHDLEEQQCAGFRIELGKDGNV
VLSKFHLETPDGDEEIEKEVKAKIGAGPIETPVGKVSIAANGNYTAPKGKKNKPVTEIIVERDGMQSTVETYGGLVKADL
ADKDADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKRDHRVPNL
EEAAKTQMKQSVEMSNKMLEVTNQMSMSIYLRDYLNNPGNAKSVIPVNTGIGSPTLEAQISNYNNLLLTRNTLAASSSDT
NPLVVDYDGQIKGLREAIVNAINGQIVALNKSLRNMEGAKGAAESQLASGSTQAKYLLSVERQQKVKESLYLYLLQKREE
NELTQKFTADNTRIITPPTGSLQPVAPKVKFILAICMFFGLCVPGVAIYIISATDTKVRSRKDLDRMSAPFAGEIPFVGK
KSIKDRMARLLPAKKNSKELERVVVAVKEGSRDAVSESFRIVRGNIDFMIRGKEGGNVIMITSFNPGSGKSFISFNLSAS
FALKGKKVLVVDGDLRHGSASQFVDMPSKGLSNYLTGNTDNWQSLVVPVAGQNGMSVMPIGHRPPNPSELLDNGRIGQFL
DEARKEYDYIFVDCPPTDVVVDTQIVEKYVDRTIFVVRAGLLDRKALEEIDAIYRNKRFKQMSIVLNGTEAASRKSYGAY
GYYG
>gnl|bykdb|A0A3R6HJB3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. AM23-5] (length=816 residues).
MARPNQEEDFIRIQDLLYLCLTQWRWFILSLVVTCGIAIYYNLTTPNVYQRTASLMIKDESKAQGIGSDVASMFSDMGMG
NMKSNVNNELIAIQSPAVLLETGKRLKLDVDYAIDGRFHKEALYGADLPVTVDFVGFTDEQSGSFKLQLKGDGSYVISKL
KGVTRDNLPVDDSDEITGRIGQIIRTPLGKIKVDKAPAFTQFVSGEDEPVLYVSRSNVYAMTDRIKGSLSASLSDVKSTV
IDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIERVLGDVDKNISTFKSSNLLPDVEAAAQQY
MQKSTEVDKQIMDLNSRLAIAQYIRNYLTGKVGKNQLLPSNTGIESPGIEQQITEYNKSQLERNNIVANSSEQNPLVADY
DQSLTSMRKSISASLDNFVVTLKTQLGTLQANEAATTSQIASNPNQAKYLQTVGRQQKVKEALYLFLLQKREENELSKAF
TAYNTRIITPPTGDNTPVEPVRRKILLIALVLGFLIPMVVIYIREKANTTVRGRKDLKKVNVPFLGEIPFSISRKNRPTL
EQRIKFWKKPKEVRMIVVKAGKRDIVNEAFRVLRTNFEFTIGTHPEQNVIVFTSFNPGSGKSHIAANMAMSLAIKKKKVL
LIDGDLRHGSTSMLIHSPGEGLSDYLNGRITDIHDILYKGEENGLVKGFDVIPIGTIPPNPTELLFTPLLEQMIKTMREE
YDYVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLMERSMLPEVNALYKEKKFKNMTLILNGTKAQGGRYGSHYGYGYGY
GYGYNYNKEKNGGAKS
>gnl|bykdb|A0A412GR09 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=784 residues).
MAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFTGLVNVA
SEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSRGMEQRK
VVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRAADILDM
LITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKELDTQLQ
LVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYRALDNLS
ASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSGSNIPIS
PNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALSESFRIL
RTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYLSDSSVE
VTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLFIVRVGK
IDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A413V760 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides nordii] (length=305 residues).
LGIPMGVFWLLNVTDTKVRTRKELDGVLTIPFLGNIPRHGNNKGEDSDGIVVRENSRDSVSEAFRIIRTNMDFMRVKAAN
LQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSGIFSNSSNRMGLTHYLSGSTDKLDDIIGRSEEYD
KLDVIFSGPVPPNPAELLLSERFDRLITELRKRYDYIIVDNVPAGMVADASIVNRVADLTIFVVRSGVMDRRQLPELENM
YRQEQLRNMSVILNGVPSDHKGYGYGYGYGYGYGYGYGYGNESHGHKHGRYESLKNLFSRFFKRS
>gnl|bykdb|A0A414H9P2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNRKQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELISSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A451FS66 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Aequorivita sp. H23M31] (length=822 residues).
MNQEFDIKQADGSFDFKGFFDRLLRSGPLFLISFLITFSIAYYFNIRKLPIYQMENLVAIKDDQNPFFTTTTSLTFNWGG
TTDKVNTSVITLQSRSHNEKIVERLQFYLTYLRDGKFQLIDAYKQTPFLIRVDTTKAQVLNQQFKVVFKDSVNFNLSVSF
EEGKNINLQNYTTKEKSSLFIDTDVFSKDYKLGESISTPFFSGTFIPNEEVISNPGTPYYFIFQDYDTTVKNYLNTKVTP
ESKGSSVLRLTVIGSNKAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKSAELNSVQDELNKFRNKSAVYDL
ATEGSELNSKLNALDLRKEAVNRELNYFITLQEYLTTRTDYRDVPAPSVAGISEGSIIAGVGKIVALAQERNKLQYSFKE
GAPVFNDIDRQINAVKSVLLENIRSSRSLKADEINSINQDIGRYESEIRKLPKEQQDLLNIERRYNLSEGTYNLFLAKRS
EAGLVKAANVSDVVIIDTAKDTGGGKIGPNTQLNYVMAGLLGLFIPLFIIFGMAFFDTKVEYVKDLAKITPIPLFGVIGK
NHSGNILAVLSHPKSAIAEAFRSLRSSLQFLYKQHGVTGAKTVLFTSSVSGEGKTFCSINIASIFALSEKRTVIVDLDLR
KPKVSGAFNMDNSIGVVNYLINEADLDTITQKTEVDYLDVIPSGPTPPNPSELLIGERMDEFMERLKERYDYIILDSPPI
GLVSDAMEIIKYADATLYMVRHNRTRKNMLTFVNEKYKRGEIKHISIVLNEYVEKSGRGFGYGYGYGYGYGDGSYKSYGD
GYHGPLGKKSLADRIKNIFKQT
>gnl|bykdb|B5CTK0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides plebeius] (length=788 residues).
MAEKKQATDLLKGEDSSFNIGEILHMFLSNWYWFLVSVILCLFFGWYTLQKAIPTYKRMATVLIKDNSSGSMSESAVFED
IATVRAERNVSNEMLVFKSNRLMQIVARRLHLDVNYLIEEGLHMKELYTQAPISVRFFDVDEAETLSLTVLPHSEKEVTI
TDIITSSGESVNKSFYIPLNDTVSTPIGRILISPTLYYGKGEFSPLIVRKVNLKSIANSFAARLTIAQALAGSTMLNLSI
IDSSVARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIEKELGNVDSNIETFKRQNRLTDVNSEASMYLASSS
SYQQEGVGIENQLTLAKYIKSYLTDPSKNFNLIPTNTGISGADVNIESSIATYNAMLLKRDKLIDSSSDKNPVVVNLNNS
LSALKQTIIRSIDNTIVALNVKLKNLQAQEARTASRIAAVPTHQKYILSVERQQKIKEELYLYLLNKREENALAQSITES
NVRTIDPASGSNTPIAPDRMRIWMISFLIGIGIPAVFLMLLKMTDTKVRTKKDIENKLSIPFLGEIPKYQGKDDIIIHEN
GRDSISEAFRIIRTNMDFMRMKKDNMKVVTFTSMMPGAGKTFVSMNLALSFALTDKKIILMDLDIRKGTLSAHSKRKELG
VTDYLSGKIADLNQIIVKGKLHANLDMIYAGAVPPNPAELLLSERLDQMIEELRTRYDYIIVDNVPAGMIADAAIVNRIA
DWTLYIVRAGVLDRKQLPDVDALYKSGQFTNMALILNGVDFKHAHKYGYGYGYGYGYGDTKTKHKKKS
>gnl|bykdb|B6W3W8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei DSM 17855] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDA
RVLDPAGGGDTPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|C2FUH6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium spiritivorum ATCC 33300] (length=797 residues).
MVNNQITQNITKADKSVNIIDLFKYLMIHWKWFALSVLLFGGYYYYQYSRSTFMYRSSEMVMIKTPMNTPSTARITRTNS
AFNSVSVAGEILQLNSKELMRRTIDRLNADVSYVIRNGLRDQELYTQSPVKVTWMDKKPDQSFSFTLTPLDGKYVLLKKW
SNGDRAKELKIELNKESNTPVGRIVVTAEKQFTASTVGEDIQVTKYAHEAMVGYIMGNLKIQQMEEDASLLQITLEDQSI
KRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIESELGNVENNIEQLKTANQGVDVNVAGEMYLSESRQHLEE
RNKLETDIRLVDMMRSHLDNKTKRNELIPSNTGLVEANIENQITDYNTTLLRRNRLVEGSSTENPIVQDLDKALGAMRGN
IDRAVENATEGLRVKMQKARSEEQQARGKVIQMPQKQRIMLSVERQQKVKEELYVFLLNKREENALNKAMTDDNIRIIDP
ASGSDAPVYPVRFKKVMTGVGIGIVLPAAVLLCLLIFNTGVRGRQDIESVLDIPFLGEIPQAGKRKTDSNKVLVSKTGRD
VLTEAFRIIRTNIGFMSRNGNSPQVITFTSFSIGAGKTFTALNLAATLSFLDKKILILDLDLRKGTISSRVNVKSALGVS
HYLSNSQVAIDDIICKSGIADNVDIISIGMVAPNPVELLLGKRLDELIADLRNRYDYIIVDGVPVGLVADASIVNRISDL
TIFMVRVGKMDRRQLPEIEKIRQEGKLSNMSVILNGLKQGRRGYGYGYGYGYGYGYGYSNEKRHNLFSSLLEKIKGL
>gnl|bykdb|C3R5A8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei 5_1_36/D4] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNREQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|C9LKL0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alloprevotella tannerae ATCC 51259] (length=815 residues).
MEYSQKNEVQNSEFKIVPFLLLCYHVFLAKWRWFAFSIIVCVACGWYYQQIQPRVYTRQATMLIEGGNGSGRGGFSSSRN
RGSGLNTMMDFNGVTIGDNLSNELFILTTRRLMRKVVDSLGLDVDYTTKNALHRIALYDNRPFDVSFGTKTSVPANFQAE
IMPGGKVRLFDFKLNGEEYSDDIETAPEQAVKTPLGVLKISKNATFEEFSKGKVITVDYIPADLAARRYQGEISATVQDQ
ESSLIVLTCQDINIARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIGSELAGVEGRLASLKESNRIVDFKTA
ADQYSSMSVTARQSSVDLQSQVSVARYLKDFMQNNSNKHQLIPVLNLPDATFAGLVNEYNTMMIERNSTEKNSSPNSPLV
KDLDSKLTTMRNTILSSVRSYVKTLEMRAKSARSNESVINGEVSRAPGLERRALSIGRQQNLKEALYTYLMNKREEVALQ
LAVNDANVRLVEDPLGSNTPISPSRSTIILISLLIGLLIPTLILTIRRLMDITVSGRHDVEEATTIPLVGELPTWEEGGD
DGLITTCSSDAPIVEAFRMLRYGLNFMRHSAKVCVVTSSTPGQGKSFISRNLAAIMGMANKRVLLVDADIRKRTLSSKFG
RSNGLTGWLVDEEEKLSLDEIIIKDGVAKQVDFLPAGMLPPNPSELLMSSRLEALVEEARELYDFIIIDTTPILAVSDAS
IVDRVADVTLFVIRVGVQVRAFLPELEKMNKDKKYRHLCIALNDVDVKAKYGYGYGYGYGYGYGYGNYSYGYGEQYNNRK
SKKKLSGRLLSKLRK
>gnl|bykdb|D1JY72 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 3_1_33FAA] (length=794 residues).
MSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRGLDRFNTYSY
TNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQVRLSDFSTDA
TSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSLRDYSTARAE
DVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKRQYSSTTQEL
ELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLIAMRQNIIRA
IDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDARVLDPAGGG
DAPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAHGIAVRAQGR
DIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSHTRLHTEEKG
MTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVADAAITNRIAD
LTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFKKKS
>gnl|bykdb|D6D2Z5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides xylanisolvens XB1A] (length=781 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINLLPERHISFVVTPKDDATVTLSGFGGL
PAAGESYEVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|D7J4K6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. D22] (length=779 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINVLPERHISFVVTPKDDATVTLSGFGGL
PAAKDSYDVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|D7JEV9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes oral taxon 274 str. F0058] (length=811 residues).
MEQNNNISNNTFNEEETSSFNFMEWAIRFLKYWYLFVLGVFISLAIAYYQNRSFVPIYNSSLRMLLKQEAGSLSYMQGQG
FNSVMNRLDQTNIENQILLLQSQDLIGRTIDSLPKFRVDFYKKLQFKNRPMYATSPIDIDIISISDISYGKYYLYQRKDN
DYFTIKVFDNEDVELETVEGRYNEPVGCKYFLIKVIENKAFRDVDKVHFRFRHRQELIAEFSSKLAIQLIPNTSVLNISV
LSDNPLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIISDSLSRSESNLNSFKVANKMYGQNNTSILTERMES
LENQGKQIRLRDEYFKYLRNYLKNNIDNESLASPTTIGIQEPRLIALVDKYNELQIKLLDLGVKNPQYDVVISQIRQIKT
QLNELINSVSDVYKIEKSSYQSDLSALNKLLVEAPNKELRMLDYERRYKINDSYYTFLLQKRSEAQIRKASNSPDNAVMQ
KARTSQLVNANQKQKKYMIFFFIGLAIPAVLIILKELLNNAIRTEKDIERATRNRFPTIGSVRHTKHKADERVIASKYPN
SYFVEQLRVIRTKIEFILKRKEKITVLISSTESGDGKTYISLNLAGVFALQNKKILLIDFDIRKPNLTKNLGGMVKNKLG
FVNYMIGDCSLNEAIESTPYGFDFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYDYIIIDSSPLGLVADAYALFSVVDIK
LLVVRSFKTNKMEFTDLSKRLYSDNIEDIYIILNDVDKSKIGYVYGYGYGMHKKMGNYYVTEEFEQDDVSILEKLIYKIS
DMTKKIRNIKK
>gnl|bykdb|E4T131 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter propionicigenes] (length=798 residues).
MDKFNLEKPFNSEEESGFDIMEWVSYFLNNWYLFVIGIILSLGLAYIENRSWLPTFQTEGRVLIDENRSSNANSSQALMQ
GFGIQSGYKNAKNQIIMLGSNDLFSKVVDSLPFLKVDYISKGSFKTRNLYKTTPIIIQTDYIAPEAYGVLFKIKLHSNGS
YTISVDDKNLFSKFQINGRYGRPLQHNLFFLTVHNVNKYMGNTEMYFKFRTKESLVNDFISRFSTSYVTEGSSVLRINFV
SDTPDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVSKSLTTSESQMTNFRQSNKIVDVSSHTSDLLGKATK
YDGQQAELKLREDYLTYLTKYLKTNLEDGAIVAPSSLGLSEPMLMKLVEQVNDLYNQRSDLTEANPYYAKFTKQIETSKL
TILEVIKSMRASLEIEKSDFNKRLSVVNKQIEELPEKELEQIAIQRKYKMDDNYYTFFLQKRAESEILKASNTPDNDILD
KARIVGVTNSDKRSKTTMVFLLFGLLIPTFIVILIELLNNTVHSTKDVEKNSVFPLIGAVRHTKSTDPLVVSKNPRSAYT
EMFRIIRTRIEFIVQRKTNIIVMTTSTESGDGKTYFSINLASVYAMASKKTILVDMDIRKPSVNQRFNIVHPLGVTNYLV
GQCALDEIILKLPKVDFDILPAGSIPPNPGELIRSEKLGKMFEELRTRYDFIIVDSSPIGMVTDAYSLAQHSDVNLFVVR
NGKTNKTFFKKLCAQLKLDNIPQLYTVLNDVLDDESKYTKYKLYKYAYLFGFSYGYTSKKKKGDAEKYFHYYQDDTEI
>gnl|bykdb|F0R0C9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salanitronis] (length=802 residues).
MAIPNNPTRPKQGDDFIRIQDLFYLCLAKWRWFVVSLVLTLGIAVYYLLTTPPVYTRAASLLIKEDSKGQSLSGDVGSTF
ADMGLFQANTNVNNELLSLQSPAVMLDVVKRLHLHTDYLTDGTFYKQVLYGQTLPFSISFFGLQDNETASLTLRQGASGK
LELSDFTRNGEKVEGISEGKLNDTIASPVGKLLVEPTPYYNIGFHEPVYVSRSSLHGATGAYSSRLSVVLSDEKSTVINL
SFQDVCIQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDENISSYKSEHLLPDVQAASNLYMAQ
SSETNAQILALNTQLSMARYIRNYLTAASSRNQLLPANSGIESANIEQQIGEYNTMQLQRNNLVANSSEQNPLVKDLDQS
LASMRRAIITSVDNLMVTLDTRIRSLQRSEQQTTERLAANPSQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRVITPPTGSMLPTAPVRRNILLVAFALGLLIPVVIVFVRENMNTKVRGKKDLECLSMPFAGEIPLAGESRRKHLFASK
TYDAPRGIVVKQGKRNIINEAFRVLRTNLEFMTSENEKANVILLTSFNPGSGKTFLSLNIAGSLALKGKKVLIIDGDLRK
ASVSAFIDSPKTGLSDYLGRKTDAIDTAVVEAPQCPGLYILPVGTLPPNPTELLAEDRFGKLVAGLRDRYDYIFIDCPPI
EIVADTQIIEKVADRTLFIVRAGLLERSMLAELETIYQEKRFKNMAVILNGTLDGNNRYGYKYGYKYGYHYGYGSKDYYN
NE
>gnl|bykdb|F4KR18 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Haliscomenobacter hydrossis] (length=776 residues).
MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILSKWYLYLAFSIICIGLAYVYYKNQQPVYAITSKLLIRERERDYGP
GADFVKQNINFAAAAEDASNEIEMLTSFALMKAVVEDLGLETRYYWKHKFSEYDAYGNFPIVVDTFKLNPSAESTFKITP
LNNYSFRFSQGSKTETQRFGTLFSNQFGVFRINRIGALPISSDSSMYVSFQDTKGLARNYQHNLSVELSDEKNHSSVLIL
GLRDVVPQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANISAELASAESTVESYKLNNDIIAETTTDLSITLE
DVNNLVKEQRKVELQQKMLQAMKSDLQDTSSKFKLIPINPALYDGKIRDLIQPYNDLVMERERFLTKGQTSNPVVQSNNQ
KLKSLQSSINLAIDHMQDDLNMQQNKLKYHYDQSSNHLRSVPSKERGLSDRVRIQSIKENLYVYLLQKREETALALVSNY
ANALLFDPPYSSIGPVGPNKIKIFAAAGMGGLAIPFFLILVLELLKNSVQTEEDLKSMLPEKTIMGVINHQKGKKQHSLL
SKSQNTLTERFRTLRTNLQFHQREKTKSILVTSSTSDEGKTFVATNLAMSFALAKKKTIVVDFDLRKPSISKYFEGNAEI
GLSSFLINQLEVEEVIQTSGDLPNLDYISGGPFIPNVSEQLTEQQLSVLFAYLKSKYDVIIIDSSPIGVVSDGMLLNNYV
DNTLFVVRSNFTKKATIAKAREIFEQNKLVNPAIIFNGVKKQNDAYGYSYKDYGYA
>gnl|bykdb|F5IV23 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas gadei ATCC BAA-286] (length=801 residues).
MDNNNKKVIESDPYFEEVKTKTNISFDFVLWFYRILKYWYLFIISVALFLGYAYIKNKSWVPVFYVQALMILEDRNTASV
VAGSVPTGTLLRNTENQQIVLKSYGLTERTVKSLPAKMRIEYYIQTRFKYISLYTDTPIEIEMIDIKPEAYNYSYEIAYI
DQEKCEISYKENPESETKISLIAPFEQEIDYKLFKIKLHKTPNFRNDVKGAFKPDISTFNFRFLSEGQLIGMYSGRIGSD
LQNNSSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLINDSLDISRFKLEKFQKETGVYDV
SSQSLRIALDSADREKDALALREKSVLLLTEKMKEKILGTDDLMDPASMNIRNPKLSEFVVKYNELLQKARNLGAKNPLY
NKTIDELNDLRVKILQEIQVSQINLQNQKDALVRKYEVLQLKIDNLPPQERDLIKFQREFRVNEMYHQYLTQRQYEAKIQ
KASNTPDNFIWEAPRQMGGAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEECEKISGFPVIGTIENVSKK
LNNGVVLVKNYPKSSFAESFRNMRVRIEYMAQRENKITVLVTSTEPADGKTFIATNIASVYQLMGKKVIIVDLDLRRPSV
AKTLQIDSQKGISNYLIGQVTLDEITYSHPDYGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYDYVIIDCSPVGLVS
DAYILSEIADTTLFVVRRAKTNKSFFKSVITQLRYDGVEDIALVFNDVKGREGYYGTSRYYGDRTYYLKKNSYYHDDYFE
N
>gnl|bykdb|F8X2T0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas mossii DSM 22836] (length=798 residues).
MDINNKPGADTDPYFEEIKSKTTLSFDFVLWFYRILKYWYLFVISVVLFMAYAFIKNKSWVPLYGIQAMIILEDRGSSMI
SGAVPLGSILRNTENQQIVLESYGLTERTVKNLPKKMHIDYFIQTRFKYISLYTDSPIEIAIDSLETDITPEAYSKVFDV
SYVSDSQIRVSYKDGLDGEPEEAFNVVFDSPVENKFFKGTIRKTKNFKRDFLPFSFRFFTNSQLTGMFSGRVSTALKTEN
STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLEQFQKETGVYEVSSAT
VRRELDVADVDRDQVAMREKTVLFTTQKIKEGIMGSSELIDPVSIGLTDEIKLSRYVEEYNQELRKSKNLGPKSPIYMTA
INKLNESRVQILRELQLIQVKLQDQKDLLVKKYQNLDLKLDNLPPQERDLIKYQREYNVNEMYHQFLTQRQYEAKIQRAS
NTPDNFIWEYPRMVGGAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECEKISGLPVIGTIENISKKLAG
GVVLVKNFPKSSFAESFRNMRVRIEYMAQRENKITILVTSTEPADGKTFIATNVASVYQLMGKKVIIVDLDLRRPSVGKT
LQVDAQKGISNYLIGQVTLEEIIISHPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYDYVIVDCSPVGLVSDAY
ILSSMADTTLFVVRRAKTNKAFFKSVITQLGFDGVENIALVFNDVKGREGYYGTSRYYGDKTYYLKKNSYYHDDYFES
>gnl|bykdb|I8WPP8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei CL03T12C01] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|I8WPR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei CL02T12C06] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRIQNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|J6GV98 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. oral taxon 279 str. F0450] (length=796 residues).
MSTQTNRSNQAGEKAAEVNLLDIFFYLLRFWWLYLLSVGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDTEMLRY
ARAARLNMDNEHVQLVSRRVLERTVKMANANVFYNVKSGLRTLELYSDAPFSMKFLDTTERKSVYEVAFQDAGHVRVTPV
HTGKSQVVPLNVPVQLGDERFIIEPHQNFNTPWEYKHIEVNRMPFTQMVRYYQHAILVAEPENRASTLTLRLQDRTKKRA
LDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDTQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPVSPNALRVALIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPKEEKRGGKKAQPRGVREQGSD
ETSEAFRVLRENMRFMIGTGGKKAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|L1M9T3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. oral taxon 473 str. F0040] (length=780 residues).
MVRDGFYLCLAHWKWFVLSLLVCLSSATYYLLRTPKTYVASASILIKPDSNKGNTPDELLARRMNVESGLDAQMTNEMLS
LKSVTITRAVAERLNLDVEYTHKGMFHPKVIYGSELPVKTEFLNISEEQTASLSLTLMADGRVLLENFVRDGQNLGGSVL
SQVGKRCATPIGLLKLTPTNAYRKGMTDEYDIKRSSISTTAAIVRSRFDVQLSDKASTIIDIRYSDVNTARAKDAIDMLI
SVYNENWVKDRNQISVSTNEFIKERLSVIQRELGNVDQNIAGYKSANLLPDVEQSGSMAMAQANDAEIKARELSTQTYMT
RHVREYLTDGRHENQVLPSNSGINNPSIQAQINDYNSKLLERNRLLATSSAQNPAVMDLETQLGSIRRGIIQSLDNELDM
LKTQQRATEASHSEATSRISANPRQASYLLSVERQQKVKESLYIFLLQKREENELSQAFTAYNTQIIETPHVTGTPATPV
SKKILGIALLLGLGIPAALIFAREGFNTTVRGRKDLEDMSVPLVGELPFKGKKRPVWQRWRKQTIVAQPNMVVADQQRDI
INEAFRTVRTKLEFSMGFDNGCKVIMVTSMNPGSGKTFITANLSTAYALKGKRVLVMDLDLRKASLSQYVGNPQIGLSNY
LSGQINDWHKIIIPLGQVDCLPSGVIPPNPAELLSTSRFRDLIETVRQEYDLIFIDCPPVEIVADAEIINPVADLTLFVV
RAGLMERSFLNDIERWYLDKKFHNLTLLLNGTTDALGRYGYHKYGYGYGGYGYGGYGYGK
>gnl|bykdb|L1NGW4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas catoniae F0037] (length=797 residues).
MANTQETTSTQPAEKGLEVNLVDIFFYLLRFWYLYVICVGIVVAFALYRTAKQPYIYEASVKVFIKDASQRSMMDADVLR
YMRSFRLNMDNEKMQMSSRRVLERAVKTVNANVYYQVQSGLRTLELYTAAPFSMRFLDSLEKVATYEVRFKDAGHVSIQP
QGSSKAQDVPLNVPVQLGPDRFIIEPRSNFNSPWEHKTINVIRHPLVGTARYYQNAVAISQPQEKSSTLMLSLQDRTKQR
ALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLSKELGIVENEMESFLVTNRTLDFDAKMGRYNTRSVDYEVQAM
EIETQLKLVSFMLSNLSSPQKQTEYMPLNIGVSDPNLDGYIAKYNQLKGDRDRLVKASEGSTENPVIAEYDRGLAQIRQN
AISSLNQYANVLRVRLKDAQGTQSSLLSQLPDVSNKGREKAEIDRKIAIRERLYTELLNKREEYALMQAMTQDSAYILDM
NDAPAPPVSPNKTRTVLLAILIGLALPTIGLIIRLLADNKVRTRKDILDRLTIPFLGDIPKEDAPGRKQPRGAREQGSDE
TSESFRVLRENLRFMIGSGDTPSKKIIFTSFGESAGKSYVSYNLAKTLTFSGSTVVIVDLDLRKGTLSRRAHVAGQGVTE
YLVDKAMPVEKIIHKDPNFSKLAIIPAGAIPPNPAELLLGHRLDDLAQELSDRFDFVIFDNVPFGSVADAAIANRIADLT
IFVLRAARLDKRALPELQRLYDNEILRNMSIVLNGASDGGHGYGYGYGYGYGYGYGYGYGYGNKKKKGILYRLGLKK
>gnl|bykdb|Q8ABP9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=779 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINVLPERHISFVVTPKDDATVTLSGFGGL
PAAKDSYDVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|R5DEG6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii CAG:246] (length=600 residues).
MVVVPSLYYGDKYFNTTVQVTKSPLQNVALRFQSGLQATLASKTATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKN
QIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTSSQYRQEGLSLENQLSLAKYIKNYLTDPGK
NSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSLIAMKQTIIRSVDNLIVGLNIKIKNIRAQE
EQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESNARIIDPAAGSNAPVAPKAMMILLASVVLG
CAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKNEVVVHENGRDSVSEAFRIVRTNMDFMRVKEKNMQV
VMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLDIRKGTLSSHVQVSDMGVTNYLSGRIDNVDEIIQKGELYDKLDII
HAGPVPPNPAELLLSDRLEALIAELRERYDYIILDNVPAGVVADAVIVNRVADLTIYVVRAGRMDRRALPEVEKLYREGK
LRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGQRKKK
>gnl|bykdb|R5JJI4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:189] (length=755 residues).
MIRDDSKGGSISESTAFADISFLGGKRNVDNEVLVFQSRHLMEKVARRLHLDMSYKVKNGLREDELYTHSPITVLFPESE
ERQVIEMTVTPVDSATVRLSDFSLSIAGEEIRSAEVVDARLNDTISTPVGTMVVTPTLYYTDTYYGKPVYITKSNMEKVV
EGYLRRINISLASKTATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIE
SFKRENQLTDITSETGMYLQNTSRYKQEGLSLENQLSIVKYIKEYLVDPQKGSDLIPANTGISDNSVESQIKEYNDMLLK
RDKLVAGSSNKNPIVIDLNNSLGAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPTQQKYVLTVERQQKIKEE
LYLYLLNKREENALTQAITESNARIIDPASGSSVPVAPKSMMILLAAIVLGGTIPMIVLWLLNVTDTKVRTRKELDNILT
IPFLGDIPRHGTRKGEDTDAIVVHESGRDSVSEAFRIIRTNMEFMRVKSDNLQVVMFTSANPGAGKTFVSSNLAMSIAQT
NKKVVLVDVDIRKGTLSGIFSNPSGRMGLTHYLSGRTDGLDDIIGASEEYGKLDIIFSGPVPPNPAELLLSERFDRLITE
LRKRYDYIIVDNVPAGMVADASIVNRVADLTIFVVRSGVMDRRQLPELEKMYREEQLCNMCVVLNGVSYERRSYGYGYGY
GYGYGYGYGYGNEHHGNNKQGVAKRIINKLIAFFK
>gnl|bykdb|R6D982 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:754] (length=797 residues).
MEKQVKKILAEEDKSINLVDILMYLLSYWKWYVLSILICGGYFWYDYSRTPFVYSRSATVMIKTPANTPSAIRLIRSGDY
MGQVNMATERLQFQSKALMRKVISRLNADVSYAVRDGLRQKELYMAAPVRVHFLVSEPEAELSLLVTPKNERQVELSDFS
RGAESRKTVNINDTVETALGRLVVSATENYDSSCWGKPVKVSKQAREKMVYFFLSNLSIKQVNGDVALLNIMMDDFSPLR
AGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIEDELGSVETDIEVMRKESDWGDINTAASMYVSDGRKYESSLK
ELDTQLQLVSFIKQYLQDAAKEDELIPGDIGLTDAVIEGQIARYNEALLRRNRLRSGSGGNHPVVQELTRSVETMRQNIN
RSINNQVTSLKLKRTEISGQERLARRKVRDVPGKQREMLSVERQQKVKESLYLFLLNKREENALNQSMVDNNARIIDSAS
GSNAPFYPNKYKKLLLGGGMGILIPTVILLLILIVDTRVRNRKDMEAVVSAPFLAEIPKSAEKVTEINDIMVRARGQDAL
SESFRILRTNLGFVASQSPGQKVVTLTSFNVSAGKTFVSVNLSASLVQADKKVILIDLDLRKATLSLIAKARGNGIKGMA
HYLSNKSISMDDIIMKDGFGERIDLIPVGVIAPNPAELLLSGRLDELIGHLRERYDYIIVDGVPVGMVADVSISNRISDV
TLFIVRAGKLDKRQLPELERLYQEHKLNNMAVVLNGTKQGRRGYGYGYGYGYGYGYSYGNDEKKKNWFFGKRKKESV
>gnl|bykdb|R6U429 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:770] (length=732 residues).
MRDLASFTGGLSRMRSSGSNVYNEMEAFSSPDLMCSVVKRLGLETSYVEKQFLRTRDLFTNSPLALVRAGDNNASSFSFE
IMKEGEDAFVIKDWHVAGEEMEYAKIKGRLNDTLDTPVGKLVIAPTMLYDQWKKPIVISWVNAKKLAKAYNKSLSVSLSG
KESTVLVLTLTDRFPSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIEKELGGVEEHLKDYKAEHNITDIQS
LSAAYLGESTEYKSMSFEVNNQLAIAKFIKEYLENPAHDGALIPANSGLTNSTVESQIGEYNQLVLSRDRLVSGSSSENP
LVLDYNNSIAALKIAINRSIENLISTLKLQADKVAAEETNIMNKISNTSGQELQLLSIERQQKIKEELYIYLLQKREENE
IASLVNVGNTRLVMEPAGEDMPQSPNKKMIMLIALILGAGIPFGIFFMINQLDTRVKTRNDLTNMQVPFLAEIPQLGQGA
GILNKMRKKMCDDANTKIVVAPSNRNSINEAFRVLRTNLDFMTGGQEGCHKVMITSFNPTAGKTFVLMNMAATMALKGAK
VLLLDLDLRKGTLGKALEHNKSGISAFLNGKLESIVPEIQNIKENLDLISVGSLPPNPAELLVSEKFDKMMDELSARYDY
IFMDCPPVDIVADTSIIAKHADYTVFVIRAGLFDKRALPAVEDAYERGVYNHMAVILNGVDTTSKSYGYGHYGYGYGYGY
GYGYGYGNNVQD
>gnl|bykdb|R7CUW4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:462] (length=782 residues).
MQTTSNNNRNEQGINVVDLLVYFASKWKWFLISVLVCGGLAWLSYARSPLVYFRSATVIIKDPSNKTSTAGLDRYDNFIN
KVNVANEILQFRSKKLMREVVQRVHADVDYLIQDGLRYNELYTQSPVRLSFPDAMPEQGLALTVQPKSERSVTLSRFSWM
EADSTCTVAMGDTVRVHGQRLVVTPTNYYAASWTDVPIRVQKRPLESVVNRYKGALGIQQEEEESSILTLALKDSSPVRA
EDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIERELGGVESDLESFKRSNQIVDISSAAGMYMTESQKYNADALE
LETQLRLANFIKDYLTDPSKETDLIPSNTGLSDMNIESQINLYNTAKLKRDRLISDSSEKNPVVEELNNSLRAMKQTIIR
AVDNMIVSLNVKRNDAQNREMRAQSRVTSIPTKERQMLSIERQQKIKESLYLFLLNRREENALSQAMADNNARIIDSAEG
GDSPISPRRNRILLLGLLVGIALPGVGCLLVLFLDTRVHGRKDIEKAVSVPFLGEIPLDKEAARQHGRTAKASVGQDDSI
VSEAFRILRTNMAFMSRKDRPTQVITFTSFNEGAGKTFISCNLAMSFVYARKRVVVIDLDIRKGTLSRHLGEHRTGVTNY
LADTTVTVDDIIRKGEHFDIIASGPVAPNPAELLLDSRLDTLIAELRTRYDYIIVDNVPVGIVADATIANRIADLTVFVV
RSGRLDRRQLPDIESLYEDKKLHNMALVLNGVDPHRHGYGYGYGYGYGYGRYGYGNKKHGRN
>gnl|bykdb|R7F6L5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:485] (length=814 residues).
MANQIKENEAANISPYYEQAAPASLVSVQGFLSFVRHRWYWYVISVAVCVGIAWLMLARSPRLYTKSETILIKDPTFGNS
ASSVDLSEVGVMPKYANLENEIAIFTSPDLMENVVKAYNLNNFYSYNDGFKDVDIYHQEPGIISSPDAANADASYSFKYI
VKPDGTVILKDFNKGGTELPDKPLSCKLGATVKTPVGAIAIDRPEWVSDYVDKTIHYSHVPVRPVAESIVGGLKATYEAK
EGTLIALSYTSTSPYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIEQELGNVDSDISSYKARTMSPDLEAQ
AQINMARSSELQNQQYDLSNQIQILNYVRGELSREGIDETLPSNMGIANTGLESQIQVYNQQVIERNRLLKTTGANNPQV
VEKDEALRTMKRNIQHTAATYATSLNTRLSGVRSQESVTNSRLATAPRQANYLLSVERQQKVKESLYLFLLQKREENELA
QAFKSYNTQVVRQPAGPGAPISPVSTNTYLIAVLIGLIIPSGVYVVKANLDNKVRSREDVENIGIPFIGEIPQKGRKKLG
KDSSSERQVVVRADSTNVINEAFRVVRTNLDFFLTSDKKGAQVIMVTSANPGSGKTFITMNLAVALALKHKRVLMIDFDL
RRAALSNAFGSPREGIANYLCGADQMSDIVQHNVNDVEGLDLIGVGNLPPNPSELLYSERLKTLLSTMEQEYDFIFFDCP
PIEVVADSRILNEYVDTTIFVIRAGLFDRRMLKSIRNLYAERRYNNMCLLLNGTSVGHNYGYGYGYGYGYGYGYGYGYAY
GDDNDKKKKKRKKS
>gnl|bykdb|R7JFY1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. CAG:409] (length=276 residues).
MAIPAGILWLRWANDTRIRSMKDVQDRTALPLLGEIPALEKNQEKLVVKEGSRDAVSEAFRILRANMDFMRGGDEHMQVL
LFTSMNAGAGKTFISSNLAASLVLTHQKVVLLDLDIRKGTLGKQAGYRGEGITNYLSGKVTDVTSLICQDELVPGLDVIH
AGPVPPNPAELLQNKRLDAMIAELRTRYDYILLDNVPAGLVADAQIVARLADLTICVIRAGVLDRRQIPALEMLSRRFPK
FSLVLNYVKGHHGGYGYGYGYGYGYGYGYGNEKKRK
>gnl|bykdb|R9H6G0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron dnLKV9] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|U2K8K9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. oral taxon 278 str. W7784] (length=795 residues).
MPEQQITNRPSDKGADLNLVDIFMYLYRYKFLYILCVGIVVALALYRNARQPFTYEGVVKIFIRDASQRTMVDDNMLRYM
RNTRLNVSNERIQLSSRRVMQRTVRLSGANVFYNVKSGLRTLELYDEAPFKVTFLDTLDVANTFRVSYQDASHVSIKLGK
DGRTQVIPVGEPIRIGETRFIVEARKTFNAPWAYSEIQVSRIPFVDAVRFYQHSVAITQPEAQTSTLTLTLRDKTLKRAL
DILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALSRELGVVEQDMTRFSARNKTIDFTSKVESYNARSLEEEDASIKI
EKQLKLVSYMLSQLNSPSKRNELMPLNIAMPDPELDGYITQYNQLKFQRDKLVESSGGSTQNPVIAEYDATLDQLRKSAT
EILNQQASALRARLKSVERDQSALFSKLPGVTEEGRTKADIDRRLAIQEGLYTELLSKREEYALRQSMTQDSAYILDMND
APNTPPVSPNTLRTIVLAFLLGLALPTIFLIVRLLTDNKVRTRKDILDRLTIPFLGDIPKEERAKSGHTRGVREQGGDET
SEAFRVLRENMRFMIGSAAGKTKKIIFTSFGESAGKSYVSYNLAKTLTFSGHRVVLVDLDLRKGTLSHRAGIIGKGVTEY
LSDPTVQVDQIIRKDPNAPKLSVIASGAVPPNPAELLLGERLDELADKLSEQFDFVVFDNVPFGSVADAAIANRVADLTI
FILRAAKLDRRALPELQRLYDDHILTNMAIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKTLLQRLGIRR
>gnl|bykdb|Z4WRA0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas catoniae ATCC 51270] (length=795 residues).
MANTQETTSTQPAEKGLEVNLVDIFFYLLRFWYLYVICVGIVVAFALYRTAKQPYIYEASVKVFIKDASQRSMMDADVLR
YMRSFRLNMDNEKMQMSSRRVLERAVKTVNANVYYQVQSGLRTLELYTAAPFSMRFLDSLEKVASYEVRFKDAGHVSVLP
QGSSKAQDVPLNVPVQFGPDRFIIEPRSNFNSPWEHKTINVIRHPLVGTARYYQNAVAISQPQEKSSTLMLSLQDRTKQR
ALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLSKELGIVENEMESFLVTNRTLDFDAKMGRYNTRSVDYEVQAM
EIETQLKLVSFMLSNLSSPQKQTEYMPLNIGVSDPNLDGYIAKYNQLKGDRDRLVKASEGSTENPVIAEYDRGLAQIRQN
AISSLNQYANVLRVRLKDAQGTQSSLLSQLPDVSNKGREKAEIDRKIAIRERLYTELLNKREEYALMQAMTQDSAYILDM
NDAPAPPVSPNKTRTVLLAILIGLALPTIGLIIRLLADNKVRTRKDILDRLTIPFLGDIPKEDAPGRKQPRGAREQGSDE
TSESFRVLRENLRFMIGSGDTPSKKIIFTSFGESAGKSYVSYNLAKTLTFSGSTVVVVDLDLRKGTLSRRAHVAGQGVTE
YLIDKAMPVEKIIHKDPNFSKLAIVPAGAIPPNPAELLLGHRLDDLAQELSDRFDFVIFDNVPFGSVADAAIANRIADLT
IFVLRAARLDKRALPELQRLYDNEILRNMSIVLNGASDGGHGYGYGYGYGYGYGYGYGYGNKKKKGILYRLGLKK
>gnl|bykdb|A0A345UMN6 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Candidatus Cyclonatronum proteinivorum] (length=798 residues).
MELENNERRKSMRSNGASEDPFNPGAIPGEEDDQNDPFDPQLILYSLWDGKWIILACVVILGALGYYYTQTLPNQYRTTG
LFLIENQRADRGLNLFEFTRARNLTWDEVGTEMQFIVNSHELAENVGRRLIQELVNPVTGDTLPMLRQNGLGFMPEEQVL
QRLARRLPNRISLHQIDQMNLVEIRTTSFDPQEAAFIANFYIEEYRILDETITRSNLTSAASYLEQLEERNTMTLGEQDE
QIRMFLDSDWTLITDEQGTAAAQELRGLFREAEELRFRKVAVSDFLDRLREEKDMVLNMLYDGATDNDMELVNAFEQAIL
DLRLQAESFYIEQPQLRTNPEGNSVLSQILRRIDYLEGLRDERLESQRDRVRDRQGLDQASLASYLTDIRSEIRSNEARL
VDMQLREDFIAERVDDIQSDMSSIMERSAELQRLRRNQVISEELYLNLLKRLQETQIAIQSEVSRVREIRAASVPSSPFS
PNRLRNYILSLILGFGLGAGIVLLRNLLDDLIHDPGQLRNAGFNVIGVIPDFTDYINTHFKNTERLPIRGRSVDVNLISL
IDPISAGAEAYRRLRTSIEFSNADREYQTLVVTSSKPGEGKSLTSINLALTYAQFGKRTLVIDCDLRKPTIHKKLGLDKS
PGLTDILFDKDTLENCLIDASTDNFFVITAGNSIPNPAETMGSKRMQELLSSLKKEFDIIILDTPPLLVVSDAMPLAVAT
DATVLVSKMDETELSILKETRQDLRNLGVNIAGSVLNAYDTNSVKSYYKYNYKYNYKYKYDYAYKDYKLDYTDQPDQK
>gnl|bykdb|A0A356WWN1 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneolaceae bacterium] (length=331 residues).
MNLWERTQFGMGRPLDYAVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALRSYKVPFLGNIPDYNI
IDSFDPGQKQYVQGKPVSNQLLTFLDHISPISEAYRRLRINTIYANPDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAE
KSVLIIDLDLRRPTMHKIFGENKEPGIVEMLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDK
YDHIILDTAPYGIISDSASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLNAFDPKKSSDYYTNYYYYKR
AYSDYYEEDKA
>gnl|bykdb|A0A3D2IJ12 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp] (length=435 residues).
NEILKVKRQIKDRTNNLLSSGSDLYLSFIGSGDGTLTQRIAEISQKLIELKVEQAQLKTQENIISKRYAEVNNRLEDLPD
EIIQLARLKRNVRVNEEMYLQVSSQFAEMSLWEKTQFGLGRPLDYAVPAKEPVKPKKKIIVVVGFFMGCVLAVGFVLVRE
MLNDTITSTDALKEFQKPVLGAIPDFSVIGELDPNERQYIGKKSVSNQLITLFDHISPISEAYRRLRINVVYANPDKDYK
ILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDALFDSTIDARLSTVAPNVDLITV
GHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNAD
VLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR
>gnl|bykdb|A0A3D4V2H8 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp] (length=301 residues).
PKKKIIVVVGFFMGCVLAVGFVLVREMLNDTITSTDALKEFQKPVLGAIPDFSVIGELDPNERQYIGKKSVSNQLITLFD
HISPISEAYRRLRINVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPG
LSDALFDSTIDARLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLI
VVSRFNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR
>gnl|bykdb|A0A3M1A6F3 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=256 residues).
MKLSKLQKLPSLDKIIKNNNHEKIYRGYYKDSAFNAESERVLSKIDTFRRGRTKQSVMVTSAILGEGKSTISSHIALASA
RNRKSPTLLIDLDLRRPRIHEIFGQNKTPGLAEILSRKLTLHSCIRDSEIENLKIITSGSLQGNPLNIINAETIHAFFNE
IYKYFDFIVVDAPPVIPVSDPLILGKVVDHVVMVVRVGKTPKPIAKRAIEMLQSVEVNILGIVLNDVDSLLPAYYNNRYY
KYPYYSEVEESNNNLE
>gnl|bykdb|A0A3M1AUM6 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=235 residues).
MQSFVGNIVDYFEEESPEATEFRRLYSKLQNLYSGQNIKNLLITSATMNEGKSTTAALLACTIARYRETKTILVDCDLRR
PRVHQLFNLAKEDGVADVLMSKRRLDACFKQSPLENLKILTSGGIVDNPTELFNSSKMKDLFSEIKFYFDAVIVDSPPIN
PVTDALILSSEMDGALMVVKAGKTPKDVVRRAVDLMRNTGLNILGVIVNNMKGVLPYYYDYKYYGYKYYTKDLKA
>gnl|bykdb|A0A3M1NH38 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=599 residues).
MVQKVIENLKNIISYKLDQTSRTVMTVLVKHRSPEMAALIANTLAKRFVELNREVARYKSDKIMEILENQLKIAKQELDE
ATQKLRAFQERYPWVRLSADAQMQIATITELEETEQKLQNKIRDVQGLLQKLEMSGNTLDLEEMLSLCNEMITLLSSSGE
LAREQFEYPLASVFSAEYEKLTAERRDLLASYAPTHPVVKENEQKIWALLEKVKKGARDYVNKLEQELVGLSQNLQVERK
KLRRLPATSLQYAELQREHDLKERVYSTVLVRYNQNKLESEVDISDVFIIDPAIPPPEQDVLFALIMKSLMGLLISVGIG
FIVAVIVEVFNKTAENVEELQEMLDIPVVGEIPMIKVEQGDGEGIQELRGKRDPKLITLDYSPTLASESYRDLRTKVLFM
NQNEDLSSLMVTSLRPNEGKSLTTANLAITVAQQKISTLLIDGDLRRGVLHNTFGNKKTPGLSDFLISSATVDFDNLSKL
IQPTFIPNLFLITCGSPIPNPTEMLGGDRFVAFLKLLRSRFGMVIMDTPPIQASSDAAILARYFDGVLTVIKAGSTDIGQ
LRQKLNEYPNLRKKVIGAVLNMVQMNIKKNQYQYSYYNY
>gnl|bykdb|A0A3M2FHF6 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=777 residues).
MNNNVPAASGDLAFKLKKIIRLLKRKKITLLSVFSVTFVVVFLAALKFGPQQQYKASALLQIDDKRALTSVGGARGRQQN
DSKLGLIMSRSFLKRVVDKTNFQFQVSGQPRYNVIDSVVLDDQLKYGKYLIKKDENNLKVFYTDPTKTIDEELVLETSVP
TDHKLSYGGFTVYFKKNFWENNKKIVFHLLKSSKAVEALRASIKPMFKNRARTMMEVGISGVDRFYITEVLNVLVDEFVQ
QNIDVKKYHTREVLTVLTTQLEQAKKDLDAASEELKRFRERNPYVGLAGEATAAVTRISSSENQKNEVLRKKKELSELIT
RLNTAAGDERYSILNELLAWLAANGSPTVPALASEYTTLNEERIRLANNYAPEHPTVLENKKKIRDLEKKVLYTANNFLA
QYDESLANIESMMRQEQGKIRSLPAKELQYAELQRKKNVADGVYSDLLIRHNKAKVADAVEVGDIIIIDHAVPPPRVSAL
GVFLKYGFVALALGLIISIGFVLVADFFDKTVRTADELEKAVPIRVVAKIPVVGTTKEITMEDFAKNKRIDPKLVTADYS
PTPMGEAYRSLRTQLLFNNEDKRNRSLFVTSLNPNEGKSLNASNLAITFAQQKIPTLLVDADLRRGVLHSSFACNKKPGL
ADFLYSSADINDENINKVIQQTHIPNLYLMSSGMAVPNPSEILGTQRAADLFKFLAERFGFLIVDTPPIMVTSDSVVLSR
YVEQGLFVIRAGQTNVESVKEKLAEYKNFEKRLFGIILNCAELDMKSDHYKYSYYNY
>gnl|bykdb|A0A3N5KHL3 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=772 residues).
MALEEFEILDQPQQSSIPIDFGKFIAGIWRRKWLILFLSVGMTIPFYFHAKNQVPQYKSKVVIQSKQYGSEEKSFFDAET
QAEITSQSFTERMARVLGLAILSSDTLYRNVSDVFAEYHTTSEPVVSRYKIEVDDLGVYYLYQKNETSRVLVDSANVWDA
VDALRNANGLSFRLQPTFVHQAGEFHFRVQPFSKGVKVIQLGIKMDFSRSGKFMIMEMKGENPNYITSELNRIADAYLIE
VQKLKSVDSDTYREALRRRLAAAETNMKVSEENLRNFYSQYPLSLDAEKTELMGQLKLNEQALRDLPLQRKQLTSLLARL
QAENNADYSAQYRRVVVNQIANYAAMSNEPEMTIYRQNLEQLEARYRELSGLYSSDNEEVKGLEEKIGETQAHIIQFASN
YRNVLAERESTLRREKLELESKLKSLPNDEYRLMELERNKKIDEDLFKFLYTEVQKLQVSEASQDRGVRILDYAVPPTKP
INPSKKSQIMLGGGLGLLLGLLLSIVIDLADRSLQSVKDVERHLKLPVLGTIPEVLFKDIPEYRDDQKAEQIDKQLVTHD
YSPTPIGEAYRALRTHLLFSKDTEQLRSLLITSICPEEGKSFTAANLAIIMAQQRTNTLLVDADLRRGVQHNTFNVPREP
GLTNYLSNKGTLNTLIHSTHIPNLSVMSCGSLVPNPSELLGSIQMKRLLSDVKRKFDFIIFDAPPLDAATDSVVIGTVVD
AVTIVLRAGKTNRKIAKERLEIFQNVPAKIIGTIINGTDEAILKSTYSYYHY
>gnl|bykdb|H1XXC2 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix abyssi DSM 13497] (length=778 residues).
MNNQKKSTDLNLTDSKMDWQHYIKLFKRKKWLMLLLFIFGFLFSAAFLYKISPRPVYQTQALLQFQDTRSLNELDSRRRP
DFESKLGILMSRKFLGKIVDDLSLVVRFSGVDRYEAVDSVFLHPNYLKGRFVLKKQGNKLLLFYTSQDHSIEDKKVLEVD
YPEDRLIVYGGVGLKLKDRYWQQHDKLIYTVNSRPRAIESLLSSLGYQFKNRARTLLVLTLKGEDRYLITATLNKIVDYF
VQENLNLKKYQTREVLSVLEEQLQTAKVELDRAAQELKQFREKNPWVGLTPDATGAISSVSALESQKSQLVNLKNELQSL
INRLQAKSGEERYSILNEIISFLGAQDAPTAPALASEFTTLTTDRSRLLASYAPSHPYVKENTKKLNELEKKVLLTAQNM
INAWNKQINDLEQKIVENTNKIKRLPAKELKLAELERQRAVTDEIYSSLLVRYNQAKIADAVEVGDVVVLDRAVVPLRIS
QFKTYFKIMLIGLVVGLGLSVVVVIVIDFFDKTVRSAEELEKAIPIKVIGKIPVIKTEKEIVDVKFDDAVRIDPKLVTAD
YSPTPVGEAYRSLRTQLLFNSDKKLRSVFITSLNPDEGKSLNAGNLAITFAQQKLPTILLDADLRRGVLHNSFACKKKPG
FSDFLYSNADITDENVRKIIQTTHIPNLYLISSGVPIPNPSELLGSTRAQELIRFLSHRFGFVIIDTPPLAVASDAVIVS
RYVDGGLLVVRAGKSNIVQLKSKIEEYQDLRKNLVGIVLNFAKEDMDHKKYRYTYYNY
>gnl|bykdb|A0A1F4QQE0 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium RBG_16_48_16] (length=772 residues).
MPYQDQSYFDSDQQDVPQIDFKKYLRGIWKRKWLPLILILVFAFPFYRSTQNQIPIYSAAVLIKTNAFAATEDKILSVER
QLELLSRTFLERVAARMGLAIEVESSSATMYRESIFSEVYTTEEPTAGDYEIEINEFGQYFLSMIKSGKKVGLDSANVWD
AVEKPRSVNGVTFRLNSEFVQNASRVKFKILPFGYAVSYLKSKVNLEISRSGATMKLSMTGTNPDVLPAELNRIAETYVE
ETKKLKRRDLDNQKKLLMQRMAAAEEQVKKAEEDLKDFNTRYPLSLNAEKQAILGKLHSTQTYLRDLPLQRQKLTDLLDE
VDKEKEGVDTDKYRRLIIRTIANFAVFNDEPQMAILRQTLEEQETRYNDLVKNFSENWEPVIDLKRQIKDTEEKIIKFAS
KYRNTLAQQETDYRKMYADIQAQLKNLPRDEYQLMELQRNKDVADGFYNSLYSQLTKTNISEIAETDEIAILDRAVRPGK
PINPSTKRSVLLGSSLGFLLGIILSVIWELTDKTMRTVEDVERSLRLPVIGAIPVMDFKDVPEFHDFEKVRQIDKQLVTD
DYSATPVGEAYRALRTHLMFSKNTGKFQSLLITSISPEDGKSFTSSNLAIIVAQQKTNTLLVDADLRRGVLHNTFGLPKD
PGFTNYLTNKITLLEAIQPTHIPNLSLISCGSMIPNPSELLGSLQLRRFLEDARRKFDVIIFDTPPLDAATDAVVLGTQV
DAMAVVVRSGKTSRTLAKEKLEIFETVPVKLIGIILNGSETALVHNYSYYHY
>gnl|bykdb|A0A1W9SG21 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium 4572_119] (length=726 residues).
WAYYLKKQPPVYESSCRIRFRNLASGAEYIIDDSRIIELTSRSFAERVVAQLGLTLQIEEDEYVTRQRFFEEFTTTITPV
KGDYVFKWDRDGTYKIYRIIESERELVDEGQLIDAISSLHETANGFSFKLSSEITSMPKEIFFRINKLRNTVKSFQSNIN
VRRTGGGGILLLSMTDANPVLVAQKINRLAEIFVNESKLLKRNSIENYKRTVKEQLQFSEKELEITDQRLKDFKSRHKVS
LGAETQEVVSDLDQVEEGLERYIKDKSDLAELLKQVSGQTAEESGELKYVYQQITELQTFQFNPKMGILQKQLKDLESNY
NSVVSNFSETHADATQLEEQIKNVQNSIRIEARNHLDDLTAKIAEMKTEKSTLEYKLGRLPEEQYQLTELERELDAKEKI
HRELLAKSQLAQLTEAVETEYVDILDPAIVPDEPMSRDKKKKALMGVFFAFFLGVGLAFTLEFLDKAIKSVEDIKRYLKL
QVLGTIPNIDFNEVSDYQDSEKIKQIDQQLVTYDYSPTPIGEAYRSLRTNLVYSKTTGRMQSFVVTSAAPGDGKSFTSAN
IAISMAQHKSNTLIIDADLRRGVLHNTFGVPKEPGLTNYLTGMVSFQHLVNDTLIPNLSMVSCGSLLPNPSELLGSHQMQ
RFLDEAKRKFDIIIFDSPPLNAATDAVVIGTQVDALVLVVRSGVTDRDVAKHKLELFKNVPVRILGAVLNGTNSEFGHDG
YSYYHY
>gnl|bykdb|A0A3A0BWH6 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=381 residues).
LPEKSLRLARLERAATVDEKIYLMMQEKYEETRITEVGQLGQVRIIDTAQAPKEPVKPRKKLYLVLGALIGFGLGLGLTF
LFEYIDNSVRSIEDVEHIGLTVLGSIPVIKEDEALKRLKVLPGMNGNLDTLESKKMAARLITHFAPKSPISEAYRTFRTN
LQYTKLDRELKAILVTSPGPGEGKSTSVSNLAITMAQMGSKVLLIDSDLRRPVLHTIFKVDRRIGLSNILVGKVSVSEAV
QKTEIDNLYVLPCGTLPPNPSELLASSAMTRALEEMKDLFDIILFDSPPIIAVTDAAVLCPRLDGVILVLKSGQTDRDAA
FRAYTLLKNVNARLLGSLLNGVQIESMYGSYYYYYHYYYYGKGDGKKSKTRRSRHSSTNAA
>gnl|bykdb|A0A3A0DU25 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=237 residues).
MQKSLTNSIVSVFSDETPEANEFRRLYSKLKNLYAADEMKNFLVTSAKMNEGKSTIAALLACTIARYRNTKTILVDCDLR
RPRVHQLFGMPKEEGVADVLMGTRKLDTCFKQTPIENLRLLTSGGVVTSPTELINSARMRDLFSEIKFYFDTIIVDSPPV
IPVTDALILSPEMDGALLVLKAGETHKAVVQRAVDLIRNAGLNILGVIINNQKAVLPYYYDHKYYGYSYYNTEEKVK
>gnl|bykdb|A0A3A0DZV2 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=247 residues).
MKTSVAKFKKSAKPLGYYLETPELNEFKRLFNRLHTEKQKHGTKIFMITSAMMSEGKSTVAAYLAVTSALYQSTETVLVD
CDLRRPVIHRHYELPLQQGIAEVLSRELDLSAAIKPSALPHLKIITAGKPNQTPAELFSLTHLQSVVDEMREKFSIIIFD
APPIIPVSDTLLLSNFVDGILIVVKAGKSQKRVTQRALDMLQTNSDKILGVVVNNLRSALPYYYDHRYYGYKYYRQIENA
NAKRSDH
>gnl|bykdb|A0A3N9N7Z2 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=773 residues).
MGMEEIESFDQPFEKEPANQLDISKFLKGIWKRKWIILFLCGISAVPFYFIAKNQIPIYKCKVVIQSKKLGENENPIFDG
ETQAEIRSQSFTERVASVLGLAFANSDSVYTNFEDVFLEYQTTTNPVESRYKIVIDNLGNYYLYQKYGTQKTMVDSANVW
DAVDTPRNVNGISFRLNPGFCATAGEFHFRIRPFIKGFKFLEYDIQKKFSNSGKFMVLELRGEDPDLIPKQLNRVAEVYL
QEIKKLKNIDSEDYRTMLQRTLSAAEENMKNSEEALRRFYTQYPLSLETEKNTMTSRLSANEQILRDLPYQRRQLSELLM
KVDNPEDGYEMDYRRVVVHKIADFEVMADEPELTIYKQNLENLERRYDELYSKYSAEHEDVLECANRIKETQDKIIEFAS
NYRNILAAKETKHEKIKTELEAQLRALPDEEGRLLELERNKRFDEELFNSLYVEMKKLQVSDASLDPGIRILDHASRPTK
PINPSRKSQVMMGSAFGLMLGLLLSIGIDIADRSLHTLKDVERHLNVPVLGTIPTVRFKDIPDFRDDQKALQIDRQLVTH
DYSPTPVGEAYRALRTQLLFARGAEQIRTLLITSISPEEGKSFTASNLAIIMAQQRTNTLLVDADLRRGVLHNTFSTTKE
PGLTNYLSNNATLASLIQPTHVPNLSVLSCGSLIPNPSELLGSMQMRRFIAEVKRKYDFIIFDAPPLDAATDSVVISTLV
DAVVVVVRSGKTNRNNAKERMDIFSTVPARLAGVVINGTEEANMKNSYSYYHY
>gnl|bykdb|A0A3N9NJI9 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=763 residues).
MPPNTNAQHGKEWNLEDYLDLVLRRKVIILVVFIVVFVIVLAYALTRPDIYSSRVTFSTEQTQDGGLGSGMPYYYYYQMQ
KPIEYYQAVMNSGLFRDKVTKAALHDSILLANGGLSTEEIYGLLGRIGLSKEEYSDLMYMSITAFDPIVAYRIVDIASIA
YKDRSREIQEEQARATVEYVNRQVALAEENLENAERKLEEFKSKTKFTAVNVNDGIIQRLNEIENKITELSTQRELAQAN
LDVYNERLSQFKDQNAASLWDNESEEIVWMRQEIEQLQNQKNALEENNASSRQIQQLANEIDERKQQLRNAVLKRSAENP
SAQGAIGDEQELAVYQERKIEEELNLFTLKNQERYYTSLRDTYRKQHPNMLEHSIELAKLQRAKTVNATLYNFLIQKGEE
AKIKAATGTGGVKVISPPAIPERPIPKNTMRDIFVGVILGLGLGVGLAFGLDLMDQSIHTPEDVEKHLALSTIGTIPHID
YVTKKADRDKRIPVLQDRRNGKPAKDGVNERIFQLLPMLGSKNPLVESYRNLRTDLQFVNVDEPIKSIMFTSATPGEGKS
LNTANLAISFAELGKKVLIVDCDMRKPVQSKIFQVEKSPGVSDYLARELTVDEIIQKTAITNLSLVTAGTSPPNPAEMLD
SHKMTELISKLTDRFDLLIFDSPPLIAVSDPKILAPKVQNVLLVVRVGKVNYRLVKDAYSRLDKVDAKVIGAVLNGVGTK
RGYGYYSRYNYYHHAEYYTSIEKKSADKRRKKPYIKPQFFKSS
>gnl|bykdb|A0A3N9NL50 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=220 residues).
MIEAYRSLQLNLSFLNPDNKLKTILITSAAPGEGKTLTTLNIAQIYARSGIKTLVIDCDLRRPMVHKALKIRQEPGLTNL
LVDKTATLDSCVQLLDDEQLNGHLAVLTCGAIPPNPVELLSSKSMQDLLTKAQAIYELIFIDAPPVISVSDSVILGQKVD
GVLLVLRSGKINREAAQKAKKILENGKINIAGTLLNDVDYKNVYGYYKDYYYYSDKDKIK
>gnl|bykdb|A0A3N9P469 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=773 residues).
MAMEDFETFEEPIDKELSSQIDFAKFFRGIWRRKWLIISLSLVFAIPFYFIAKNQVPRYRCRVVIQSKKVGTDEYNIFDG
DTQAEIRSQSFTERMAAVLGLAFVNLDSVYKDFDEVFLEYHTTTNPVEAQYKIVIDKLGTYYLYRKDSDMATPVDSADVW
EAVDTPRSINGISYRLNPNFSYKPGEFHFRIRPFIKGFKFLYYSVEKTFNRAGNFLVIELEDENPDLIPKLLNRIAEAYL
LEIKRLKLMDSDTYRDMLSRNLSAAEENMKNSEEGLHRFYSQYPLSLDAEKKSLMNRLAANESALRDLPHQRRMLSNLLM
KLENPEDGYEREYRRVVVHQLASFGAMTQEPELIIYRQNLENLEKEYDRLYSEFSAEHKDVINYAKRIQETQDKIIEFAS
NYRNILAEQESAQRKEKVELEAKLHTLPSDERRLMELERKKQVDEELFTTFYVEMKRLQVSGTGSDAGIRILDRAARPTT
PVNPSKKRQVMLGSGLGLLFGLFLSIGLDIADRSLYTLRDVERYLNLPVLGTIPVVSFKDIPDFRDDQKALQIDRQLVTH
DYSPTPVGEAYRALRTQLLFARGSERIRTLLITSISPEEGKSFTASNLAIIMAQQRTNTLLVDADLRRGVQHNTFSTSKD
PGLTNYLSNKATLVGLVQPTHVPNLSVLSCGSLIPNPSELLGSMQMRRFVAEVKRKYDFIIFDAPPLDAATDSVVISTLV
DAVVIVVKAGKTNRNNAKERLDIFNTVPANLVGVVMNGTEEANMKSSYSYYHY
>gnl|bykdb|A0A2G6E825 [Bacteria] Bacterial tyrosine kinase [candidate division KSB3][candidate division KSB3 bacterium] (length=239 residues).
MAKRRSRRKHQNLDLIWEEGVHSMAAESYRTLRTNIALSQVDKPLRTLLVTSCIPREGKSTTAANLGVTFALAQQKVLII
DADLRRPILHRLFGVPNSQGLTHALSDAVEFGQVYTPTRIANLWVVTCGIIPPNPSELLGSQKMRLFLERAQKQFDLVLL
DSPPISSLADASVLGSLVDGVLFVIKANMASRDIIGRAKEQLETVGANIIGVVLNDVDIKRDGYYKYYYYYNYEYYGGQ
>gnl|bykdb|A0A2G6KDG7 [Bacteria] Bacterial tyrosine kinase [candidate division KSB3][candidate division KSB3 bacterium] (length=239 residues).
MAKHRSRRKNQDIQLIWEEGAHSIAAEAYRTLRTNIALSQVDNPLRTLLVTSCIPREGKSTTVANLGVTFALAQQKVLII
DADLRRPILHRLFGIPNSQGLTHMLSDAVKYDQIFTPTKIANLWLVTCGIIPPNPSELLGSQKMRTFLERVQEQFDLVLL
DSPPISSLADASVLGSIVDGVLFIVKANMASRDIIEKAKDQLETVGANIIGVVLNDVDIKRDGYYRYYYYYNYEYYGSK
>gnl|bykdb|A0A1F4PXF3 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][candidate division NC10 bacterium RIFCSPLOWO2_02_FULL_66_22] (length=248 residues).
MASPAEKKKSPTPGFPSILSDAGSALTEAFRGLRTNLLFSGVDEPHRRILVTSAIPREGKTTTVANLGITMALAGSKTLL
IDADLRRPGLHRYFQLSGKVGLTSVLGDQAELREAIQRTKLAELSLLPCGPAVANPAELLGSRRMAELVNHLAAQYDLLV
FDSSPVITVADALVLAGVSDGVILVVRSGGAPHEVVSRAKKQLESVKANIVGAVLNAFDAKGEGYYSPYYYRYGYGYGDS
NSDGQKAK
>gnl|bykdb|A0A1F4QJ00 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][candidate division NC10 bacterium RIFCSPLOWO2_12_FULL_66_18] (length=317 residues).
MDPDVPENNSSALPAFLFDRILRARLPGEMSGNFQEQGPTDGSRRLAPPSVPGQAVEGPDALDDHLVSLLAPASFEAEQY
RTLRYGLEQMAKAGQFTPIVGITSPTVGDGKTTTAINLAGALGQAPEARVLLVDADLRRPCVGGQLGFGDSPAPGLADAI
LDPGVSLDDVVRGCPPFNLSILPAGRPPAAPYEVLKSPRLGELLEAARQRYDYILVDTPPVVPVPDCRLLAKWVDGFLVV
VAAHKTPRPLVAEALTVLDPAKALGLVFNGDDRPFAGYYHAYGYAPDATRGGGRARAVRAVAAFLGRRRSTWQRGAP
>gnl|bykdb|A0A0S7WF31 [Bacteria] Bacterial tyrosine kinase [candidate division TA06][candidate division TA06 bacterium DG_26] (length=228 residues).
MKSVLQRYEVESPEATEFRRLFSRLRRTGEPEPVKSILITSAVRGEGKSTTAAYLAITAARYRKTKTLLVDGDLRKPKVH
TLFQLRNQPGLSDVLSGASSLKACFKSTSLEELKILTAGKARLSPSESFDSDRMKDVFEEMRFYFDVIIVDAAPVIAVSD
PIILGSEVGGVLLVVMAGKTPREVVKRAKNILADSSVNILGVVLNNADEVLPYYYDYRYYGYPGTDEK
>gnl|bykdb|A0A0S7WGH6 [Bacteria] Bacterial tyrosine kinase [candidate division TA06][candidate division TA06 bacterium DG_26] (length=229 residues).
MGLSVLKQYEIESPVATEFRRLYSRLRRAGEGSSLKSVLVTSSVRGEGKSTTAAYLAITVARYRNTRTLLVDGDLRKPKL
HELFQLRIRPGLSEVLAGVASLKSCFQSTSLESLKILAAGSASLFPSESFDSDRMKGVFEEVKFYFDVIIVDGAPVIAVS
DPIILGSEVDGVLFVIMAGKTPREVVKRAKDLLSDSNVNVVGAVLNNVDEVLPYYYDYRYYGYAYRGTG
>gnl|bykdb|A0A3D4NYA6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=240 residues).
MVEPKVKSIELIAHLSPKSNLAESYRTIRTSLLLSSADKKPKSIVVTSALPEEGKSATLCNLAVTLAQAGKTVLIVDSDF
RRPTQHKIFKIRNINGLTNYLTSEMELKALVKETGIPKLYLINVGPVPPNPAELLGSEKMGNLIESLKQWFDFILFDSPP
VLTVSDAMVLGPKIDGIILVVWGGKTAKDALKQAKERLDMLKVKCLGVVINNLNIQEHDYYHMHHHYHYYGEGKGGEKTT
>gnl|bykdb|A0A3D4P3H6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=307 residues).
DNTVKTSEDVEKYAHLPALGIVPTFTVDGYRKGYGYGYGQRGHAKGIILKTTDGIHQTEDKGGAGAEARESGAKNQGTQV
KSIELISHRWPKSDYAESYRSIRTSLLLSTADPNLKVIVVTSALASEGKTATVSNLAVVLAQAGKHVLILDADLRKPRQH
RIFGIRNLNGLTNYLTANLELKALFKQTEIPLLYLINAGPVPPNPAELLGSDKMAGLIEYLKPHFHYILIDTPPMLAVSD
ALVLGPKLDGVVLIVQGEKTSREAMKRAKEKLDLLKIKSLGVVINNLNLQRHDYYYKRYYYHYYGEE
>gnl|bykdb|A0A3D3DCV6 [Bacteria] Bacterial tyrosine kinase [Candidatus Atribacteria][Candidatus Atribacteria bacterium] (length=248 residues).
MEVKKLSPKLKKLDKEFENIFIVQNDLKSPISEAFRTLRTNIRFSSLDKPLKTLLITSPIPEAGKSFVSVNLALTIAQNE
NKVILVDADLRRPVIHKIFEGNNKPGLTNILVEDKKIEEVIRRVSGIDPNLYYIPSGPIPPNPSELLGSNKMQEVIEELQ
KQADLILFDSPPVIAVTDTLVLANQVNGVVLVLDVGEVSRDVAKQAKILLEKVKAKILGVILNKVDMGSEGYYYYYYYDD
ERKKRRSQ
>gnl|bykdb|A0A2A5AMW6 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium] (length=704 residues).
MAMKNSELEMYQLKQFFIDVFYKEFFLIILLFFASISAGSYIIYVKTSINYKSSTILNLKSSFVGEKALFPWIKESSGFK
PNYIKKKLRDSDILKDVMLETKTKISVGMILKKLKIKNYSDDSNERQRVLGTVDIGKSSSSNIFTLEFSLGGTLKNDLPL
ILKLLISKFVKNENDEIHLSLEKKLSIFAFQREEIRKKLSELILKKSSYQEKNNSLDIQAEMDSIILFINKNMGVLDRLD
GETLVLSQRKIEVSKELKNRLKESIDLSLFDKSYGELRNQLLELEADKSVLEETYIKGHPKLRSIGSKIKVLRTRANELN
DRFNNGSGRMSLDPVARSLNQEIRGLGFKVAALIQQRKSISEITKKEKKNYKSLNEAQSQILSLVNLEKDLRNEESDLTK
LIEIGGLNSKTIFLDFEYVKEVSDAVKFNNQFRNFGPILVFILALISVALVLYTKYFFSGKFMRSSDVSRVLPQPVYGMI
TNSKILNGDEIVCIENKTPAAESFRKLRANLSFHFDDLKTITISSAERGDGKSFVAVNLAASMAMMGKKVLLIDGDVRLP
RDHLMLGLENLLGFVDLMDDCSLDDVIQETKVNNLDFMSSGITSQNSADFLHSSRFGTIFTMLEERYDFILFDTPPVAYA
TDAFIYAKRTSVTLFVLSIDKTKVVNVEKYLSELENLGIDTMGLVINRVSEAELFGARSYKYYY
>gnl|bykdb|A0A3M0ZE95 [Bacteria] Bacterial tyrosine kinase [Candidatus Dadabacteria][Candidatus Dadabacteria bacterium] (length=246 residues).
MEVIARPTSSGAEAVRTLRASLFLAAPGGAPGRLLISSAKPGEGKTCIAINLAAALAQMGRRVVVVDCDLRRPRVHKALG
LSQSPGVTNFLTGNVTIREVIRDSGQVGLDVVTAGPIPPNPVDLLDSVRMGELIRELEERYDHIVVDTPPALGFADVPVL
SNRLGGACLLVTQAGDTSRRVARQACEYLIRMQSKLLGVVLNRVASRSSGYSYYGYYGYYGYYSHYGEYYKRRPEDETQP
ALENTA
>gnl|bykdb|A0A1J5E0N0 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG2_30_40_21] (length=238 residues).
MDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNV
HNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAIT
DTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANIIGYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A2H0A8Q4 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_40_23] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A2M7JEF9 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG_4_8_14_3_um_filter_40_12] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRTRSFLSNAHANII
GYILTGVEHFVPGYLANYGYHYGYGQYNGYYAHSEEV
>gnl|bykdb|A0A2M7P361 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG_4_10_14_3_um_filter_40_18] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A2M8AWJ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG_4_9_14_3_um_filter_40_11] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A163UNQ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Fermentibacteria][Candidatus Fermentibacter daniensis] (length=476 residues).
MAGEIASINDSYIDTLQEELALLEASRATLLARGAQPDDPALTELEEEISIRTEALSSSLEGLVRARYPENPSAAVQSLV
GEIIRVEADLRAETTRESVLRAQASSLESDLSRLPAAEMNLARLQRNRLVSENVYLLLRNKYEEIRIAEAGQIGNVTIID
TALPGNMIRPSRRKNLMMGLLVGLALGLGTVFLKQQLDTSISSPEQVEALGVSILGVIPHLPKSALASRASRTVPSSTLV
THFAPRDPISEAYRDLRTSLKFARADQPLESILITSAGPREGKSTTSANLAVAFAQSGRRCILVDADLRRPVIHNIFGLD
REPGLSEAAAGVTPLAECVRKTSIDNLSILPSGFIPHNPSELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTDALLLSP
EVDGTLLVVGAKLGNRRVLQTSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYTYRYYYPYYNPEGQGRGKGRRTR
>gnl|bykdb|A0A1W9RIK7 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium 4484_7] (length=235 residues).
MVKKDAKTIFEMFDQESPMATEMRRLYTNIRHIHGKKDMRSFLITSSNRGEGKSTIASHLALTVARFRGKKSLIVDADLR
RPRLHRIFDVPKEPGLLECLEGKIDPMDAIQDTKVENLKVIPSGGKISSPAHLFEGDTLSEIIEKIRFYYDIVIIDSAPV
IPVSDPMLIANEVDGVILVLLAGKTPRNVAIRAKNILIDGNATILGVVVNNLSEVLPYYYDYKYYGYKESEDSNG
>gnl|bykdb|A0A3A4ZF06 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium] (length=253 residues).
MTDSERKNIYDVFDQESPMATEMRRLYSNIRHHHGRPDMRSFLVTSADRGEGKSTIASHLALTVARFKGKKSLIVDADLR
RPRLHDVFAVPREPGLLECLEGKIDPLAAVKDTPVENLKVIPAGARIKSPAHLFEGDVLSEIFKKIRFYYDIVIVDCAPV
IPVSDPMLISSEVDGVILVLLAGKTPRHVAQRACDILRDANANVIGVVVNNLSEVLPYYYDYKYYGYREHEGEKGGASGA
GNAPAGSGAGGPR
>gnl|bykdb|A0A359IET8 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=547 residues).
EQLKQVEERLRVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKEKELLNNFI
QTANPLILELQTKIAKLEASVVEAIAKGIDENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDPLSINQSMLEDV
IKLRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSV
PPKYPVSPKKKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQ
SRLITHFDPKSPVSEAYRSMRTNIELSGVDKSIKSVVITSAGPGEGKSTTIANLAIAFAQMDQKTLLVDTDMRRPVLQKV
FKVPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDAS
LLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGGSYYYYYRYMNYQYK
>gnl|bykdb|A0A3B9KQY2 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=578 residues).
ALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYS
AMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILELQTKIAKLEASVVEAIAKGIDENAPQIQTIKVQMDKMKER
LNQETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNE
NIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKG
ITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDPKSPVSEAYRSMRTNIELSGVDKSIKSVVITSAGPGEGKST
TISNLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGS
KKMREIYQTLTEQYDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKH
MKGGSYYYYYRYMNYQYK
>gnl|bykdb|A0A1G1J391 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RBG_13_46_9] (length=271 residues).
MKKILDILKKILAYYTPPMYVIKKMKTPDGVDGHLVSYTDKHSFVAEQYKVLRTNLYSLSPRETLKTIVITSSQSQEGKS
VTSCNLSYTLSLDTEKKILLLDADFRRPSIHRLFGIPRKPGFTDVLSGLVELEHFTKKPTFGNLHVIPSGTLITNPSEFL
SSIKMRNLIKELKTSFDYVIFDSPPVINVTDSCILGSICDGVILVVKAGITPKNMIEEAFTMLTHAQAKPKACVLTNTSI
PVYYYYVSRYKYYYKYRYGYRSDTPIDTSVK
>gnl|bykdb|A0A1G1JRT8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium GWA2_52_8] (length=230 residues).
MLFDTAHPSPVSESFRALRTAILFRFRRVSGCRVLLTTSPNPEEGKTTVSLNLAAAFHQNHLKVLLIDADLRKPKIHKIF
DVEDARGLSDVLEGTARPRDVIAENVDGLGFDVLFSGPHSDHPTEILGSKQMSDMLTELKSHYDIIIIDSPPYLAVADVA
VLNEYVDGITVVTRYHKTDKRHLKDMKKRLSREAEKILGIVINQVSVKEKDYYYQQYYYYGYGDAKPRKR
>gnl|bykdb|A0A1G1JUC3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium GWA2_52_8] (length=729 residues).
MNTANLPPYGAKPAVESHSEDHLEANLFAYWHILVKRRLVLLMALLVCLGLALIINSMQTPIYRTGAELVVEPKSSNESN
TDLQLNNLMRDPTYLMTQSRLVSSKKFAKRVLETAVDTGIQIQMLEQAGRSISHERKKNFKLEDREQELLMRIFAGSITL
RPVAAGARIFSLEVKGTQADLCAELANIAAEVYVEMNHAANIDAFKSRFSMTSKSLNEIREKVKASEMALEKVAAEADLL
KALKVFGEKYPDVIKLQGMIRALSGKLEESQNSLQLSQIAQRQRMFSIILKPHLTAEELIPVESDLTNLKNLLEQEIETN
REIYNSIYKRLQEMELAGGASLWVDIKVIEPAAIPGRPIQPNKKMNVLLSLVIGAFIGLALAFFLEYLDSSLRSLEDVRA
HLRVNALGIIPEVEFETADLRELQDKFHAEGSSRVMWSTSDLKIPLYVAEAYRIIRTNFVFGAVDKSLRIFQVTSAVKGE
GKTTTTVNLGISLAQVGLKVLLIDADMRRPSLHHALRLPKEGLGLQHVLKEGLPLEAVVQKTKTENLQVITSGGIPEHPA
ELLSAPVLTAFLNTLREVFDVVLIDSPPVISVADAPIIASRVDGTILVARSGYIPRRLSIQAKKAIEAVNGKIIGCVLNS
VAASHHPYYYYRYYSDHSYGYYGSEANGAGGKKRRSPIQGERVSSLEKLKLVFQSLLPKGNARFENLPPQPRHSGSRTET
ETSTPTMTV
>gnl|bykdb|A0A1G1MCV8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RBG_13_41_10] (length=231 residues).
MAKKKVESKIDPRIVAFHDPKSSVSEQYRILRTNFQGISSPKHPIKAITITSSVHSEGKTITAINLAVSMAHDLNKKSIL
LVDADLRRAKISKYLGVNAEVGLADLIANGTNIDDTLLNIGIDNLTVMPAGKIPHNPAELLGSAKLKNIITALKSKYDYI
IIDTPPIIHVTDAGLVGAQTDGTIMVIQANRTQKGVVEHAEMLLKQAQAKVLGYILTNIQYHIPAYLYRYL
>gnl|bykdb|A0A1G1N811 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_48_11] (length=231 residues).
MVIKKIGNSNVDPRIVTYFDPKAVITEQYKILRTNLLSMNKGKSPRIIVVTSSVHSEGKTVTTLNLAMAIAQSAQKLKVL
LIDADLRRGRMAKYLGVNQKIGLTEVLKGEADVADVMFNIDVENLTFIASGTVPENPAELLDSEIMKNLLTTMRTKFDYV
LIDTPPIVSVTDSGIVGSQVDGVLLVIQAGRTQRGIVKRATELLNQAHSKLLGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A1G1NXZ1 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_52_10] (length=226 residues).
MSDSKVDQRVITYFDPKAVITEQYKILRTNVLSFSKTKPLKVMAVSSSIHSEGKTLTALNLAVAIAQSTSKPRVLLIDAD
LRRGRVAKYLGVKQPVGLANILKDEVKPSDALFNIDVENLTFIAAGPIPTNPVELLSSDRMNRFLILMRSKFDYIIVDTP
PVISVTDAGIVGAQTDGVLMVIQAGRTQRGIVKRATELLNQAHSKVLGHILTNIEYHLPEYIYRYL
>gnl|bykdb|A0A1G1P565 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_50_17] (length=231 residues).
MVIQKIGDSKVDPRIVTYFDPKALISEQYKILRTNVLSANAKRPLKTLVITSSLHSEGKTITALNLAMAIAQSTQKPKVL
LIDADMRRGRVARYLGVEQKTGLTEILTEKADPSQTLFHIDIENLTFLSSGAVAENPAELLASDGMQRLLADMKTQFDHV
IIDTPPIISVTDSGIIGALADGVLLVIQAGRTQRGIVQRATELLEQAHCKTIGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A1G1PTZ0 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPLOWO2_02_FULL_63_16] (length=308 residues).
KITQALEKAARERLQHTQAHATTTAQAVSIHIEPASGPGDVGDIAVADRIEVDPHIVAATDAQSPISEQYRILRTNLQSM
RMSSGSPVIVVTSAVHAEGKSVTAINLALTLARQEKLRVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSLVR
LQHPPLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQFDLIVIDAPPTMLVTDPAILASQADGTLLVVRAGKTQRKTVAR
AHALLTQMHAKVVGCVLTHVEYYLPGYYQHYYAYRYGEKKEATSDKGQATSSKQQGTSDKKQVSGLGG
>gnl|bykdb|A0A1G1PUA7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFOXYA2_FULL_45_12] (length=250 residues).
MAKATDDSGIDPGVVTYFDPSSSIAEQYRSLRTNILLNNLSRPLKTLAICSSLEGEGKTTTAVNLAITMAGDLERSILLV
DCDLRAGTVHQLLAIKSAAGLSDILASGAELESTLGQTRIRNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSKFDYIIL
DSPPIMPLTDACVISSQVDGVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTETKEHADRYGYYGYGEVQKSDSD
SLEQTEKAIK
>gnl|bykdb|A0A1G1PYB2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPLOWO2_12_FULL_63_16] (length=310 residues).
MSKITQALEKAARERLQHTQAHATTTAQAVSIHIEPASGPGDVGDIAVADRIEVDPHIVAATDAQSPISEQYRILRTNLQ
SMRMSSGSPVIVVTSAVHAEGKSVTAINLALTLARQEKLRVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSL
VRLQHPPLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQFDLIVIDAPPTMLVTDPAILASQADGTLLVVRAGKTQRKTV
ARAHALLTQMHAKVVGCVLTHVEYYLPGYYQHYYAYRYGEKKEATSDKGQATSSKQQGTSDKKQVSGLGG
>gnl|bykdb|A0A1G1QJ19 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFOXYB2_FULL_45_11] (length=250 residues).
MAKATDDSGIDPGVVTYFDPSSSIAEQYRSLRTNILLNNLSRPLKTLAICSSLEGEGKTTTAVNLAITMAGDLERSILLV
DCDLRAGTVHQLLAIKSAAGLSDILASGAELESTLGQTRIRNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSKFDYIIL
DSPPIMPLTDACVISSQVDGVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTETKEHADRYGYYGYGEVQKSDSD
SLEQTEKAIK
>gnl|bykdb|A0A1W9R9H3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.1] (length=315 residues).
MGKISEALKKLNEEKERQKKEIMEKEKVLKKKEEAREEIKEDKSGAVRALLSSWGERLHFKENFFLFSSQSPSGIDPRIV
TYYDDYSPLSEQYRLLRTNVKSLVKRIKGNHKSIKGVNSPAIITFSSSLRNEGKTVTAVNLAMSLASEEGTKVLLIDADL
RNGTIHKLLNVEEEPGLSTVLVGEYDWSVGLHPTLNKNLFVIPRGKISAHPCEFLGSRKMRMILERLRGEKFNYILIDTP
PLLSFADAYLIAQLTDGLIIIVEAHRTKAEIVRKAKEVCEEAHTKILGFILTKVDYYTPDSYYYYYNYRKYGRKI
>gnl|bykdb|A0A1W9RBB3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.1] (length=322 residues).
MGKISDALRKVMEEREKQNREAKTLITSTINKEDSGFSSDDISPISLKSSRRSTQKFLPVKDKAYIAKTRDDSGMDSKVV
VYYDYPPPISEQYKILRTNIKSYLNKTVNIDKINMNKTVTPPRMITITSSLRGEGKTVTCANLAVALARDCENKILIVDC
DLRGGTLHKLFNLDCRPGLSDILTTDFDWSVALHTTKLENLFVLPRGETIPNSSDLFSSKRMKLIIEKLKSEQFSYIILD
TPPLLFFTDASVLGVQTQGIILVVQARRTPLQVVKKAEEFIKQSSNRLIGFIFTQVDYYASNYYYNYYYYRDRGSNYQKG
KY
>gnl|bykdb|A0A1W9RLY2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.2] (length=310 residues).
MGKITQALRKIQEEKEKKSKIQKTIEDSNVVKDNFVKKEKEEEDFPFSRGKEYSLKNKAFLVSKKDISGIDSRIITYYDP
SSPLSEQYRILRTNLKSILRKIKATRRNIKSSNFASVFTISSSLHNEGKTITAVNLAMSLASETETRVLLIDGDLRNGLI
HKLLNIEAEPGLSTILINDYEWTVGLHPTRKENLFVIPRGKISPISSELLSSRKMHIILEKLREENFNYIIIDTPPLLSF
ADAQLVTQFTDGIIIVVEANHTKAEVVKKAKELCEQANNKILGFILTKVDYYAPDFYYYYYNYKNYKKDV
>gnl|bykdb|A0A2H0LKN2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_9] (length=304 residues).
MSKITKALEKAARERLHKLQEHANVRSEAVEIPIETPSRISEAMAAGRVHIDPHIVAATDSSSPIAEQYRILRTNLQSLR
LRPGPKTIVVTSSVHSEGKSVTSINLALTLARQENLRVVLVDADLRKGSINKWMGLGERAEGLSTALLRGGELNGSLLKL
KDPALAVLPCGDYPEHPAELLESSSMKKVLAGLREQFDVIVIDAPPVLPVADPGILAAQADGVLLVVRAGKTQRKTVLQA
QSLLRQMKANVLGCVLTHVEYYLPGYYRYYHQYRYGVVKDKDGNGKAAAGSPAQPEAQSSTPQT
>gnl|bykdb|A0A2J0KUN7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15] (length=708 residues).
MEENSNLEATLRDYLEIVAKRKTVFVVGFIIALIGSIAVIFLFVPLKYRATTEIMIGSPVTEVVDQQGTVYIRGKYDVAV
AFELMRSDIIPEKISKTIEIEEKVLISPGEVKGMIAFIAASAQRTKNPYAHNLILISAIHTDTRKAYLVAKAAIKILFEE
TRKYRKRVIKEMYDALSSQLLEKHRQLEESERELTRYIIDNDIIAKGIEVGSDLKGGKPGVEVWRGPQINEKYLALKSQR
LNEEQFLEEVKKNRQQDEVVTLSIISKKYGGLVDEKLRDELYEKERVLSKLLLTQSEMHPDAVEAKGEVDEAKKKISMEL
DRALQSLDRSSATLKREEEKLRTLIKEGLSDKMVEYSSLHRDVEVKQEIYNSVVKQVEELDTYEKLLSTGFLKVVRSPIM
PRNPENPRSGSCTMAFFFSILCGIACVFLFEVLDISIRNVEDVEDIIGITMLAAIPSWEPKTENKDAKVKSAKRQDAGLV
VARNPKSIMGEAFRTLRTNIKFVCVDKNIKSIVITSVGPKEGKSFISSNLALSIANSGEKVILIDADLRRPTIHKYFGIE
NQKGLSNLLIGDGSLDEFEAADSAFENLKIIPAGPIPPNPNEILGTRRMEEILEHLKGTCNIIIIDSPPLLTVSDALILA
KKTDGVIFTFFTNKTAKKAGKRAVFLLKNAGINMLGGVLNYVKTSKGGYYYYYYSYEYYADKNDKKKS
>gnl|bykdb|A0A2J0L3X7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15] (length=200 residues).
MITSALAGEGKTITAINLAISMAHDLDNKSILLIDADMRKGKIAKYFGLGSHPGLSELLKGNADQEGVLINPGIPNLTVV
LAGKTPKNASELLNSKKMEQILSYFKTRFDYILIDTPPVMPLTDACILGPVVDGIIMVIQAGKTQRDIIAHAEQRLYQAR
AKTIGYVLTNIEYHLPQYLYRYVHQYDGNYSYEEKAAAKT
>gnl|bykdb|A0A2J0M9Y8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG_4_10_14_0_2_um_filter_44_9] (length=258 residues).
MGKFTEAIRKAAEKRIERVEKKEEFKPYVIRTVSDSKIDPHVVTYFDPTSPISEQYRTLRTNLQALDKANPPKVLAITSA
IHGEGKTITSINMAITFAHDLNNKSILLVDADLRKGNLTKALGLKADKGFADILTDGTTVEDSLLSIDIKNLHILPVGNK
PNNPAELMGSAKMRQFISEVRKQYDYVFFDCPPVIPVTDASVLAHQCDGALMILQAGRTQKGIISHAQDRMSQAKVKVLG
YVMTNIEYHIPEYIYRYL
>gnl|bykdb|A0A357BIJ1 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=261 residues).
MGKITNALKKAAEERLERIEKISRLKEREDLIVKKIGESNVDPSIVTYFDPKALISEQYKILRTNILSMNKGKPPQTIVI
TSSIHSEGKTVTVINLAVALAQSVQKPKVLLVDADMRRGRMVKYLGVDHKVGLMEILTGAAKAEDVLFHLEYDNLAFVGS
GGIPENPAELLASDKMKQFLAEMKSDFDYILIDTPPIIPVTDAGIVGPIADGVLMVVQAGRTQRGIIRRAEDLLFQTHSK
ILGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A358AEN7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=296 residues).
MSRIGEALNKATQEKIARNQEAAFPVQSPLEAQKPPAQERSRNSGYIAKATDDSGIDPGVVTYFDPSSSIAEQYRSLRTN
ILLNNLSRPLKTLAICSSLEGEGKTTTAVNLAITMAGDLERSILLVDCDLRAGTVHQLLAIKSAAGLSDILASGAELEST
LGQTRIRNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSKFDYIILDSPPIMPLTDACVISSQVDGVIFVVQAHRTPRRV
VKQAQNMLEHVHAKILGFILTQTETKEHADRYGYYGYGEVQKSDSDSLEQTEKAIK
>gnl|bykdb|A0A3B9ZHK0 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=262 residues).
MGKLTDALKKAAEERISRIEKLDSQDEVKYQFIAKKTVESKIDPRIVSFYDSHAPVSEQYRSLRTNLQALNTSKPAKVIA
ITSSINGEGKTISAINLAITMAKDLNQKSILLIDADLRRSRITKYLGITPELGLSDIITNGSNIDDALLNIGIENLTVLS
AGKHPTNPAELLGSQKFKNLMNQVKAKYDYIILDTPPIIPVTDAGLIGAQADGVIMVVQASRTQRGVVKHSEGLLKQAQA
KILGYILTNVQYHIPGYIYRYL
>gnl|bykdb|A0A3D2GIE7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=261 residues).
MGKITEALRKAAEDRLERIDKIARIREEKALVIKKIGDSKVDPRLVTYFDPKALITEQYKILRTNILSANARRPLKTLVV
TSSLHSEGKTVTALNLAMVIAQSTQKPKVLVVDADMRRGRVTKYLGVDHPMGLTEILTDKIDPSEALFHTDMENLAFIAS
GSVAENPAELLGSDRMRQFLADMKTQFDFILIDTPPIIAVTDPGIVGALVDGILLTIQAGRTQRGIVRRATELLDQSQSK
IIGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A419DVK8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=262 residues).
MGKITEALKKAAQERLARIEKLDNREEVKFEFIAKKQVDSKIDPRIVTFHDPKSSVSEQYKMLRTNLAALGTKKPVKVMT
ITSSTHSEGKTITAINLAISMAHDLNNKNILLVDADMRRARITRYLGVASESGLSDILNDGANIDQALLNIGINNLTILP
SGKIPHNPAELLGSGKFKNLVAALKNKYDYVIFDTPPIISVTDAGILGAQTDGVIMVIQANRTQKGVVKHAETLLRQAEA
KLLGYILTNIQYHIPAYIYRYL
>gnl|bykdb|A0A1F7F7S3 [Bacteria] Bacterial tyrosine kinase [Candidatus Raymondbacteria][Candidatus Raymondbacteria bacterium RIFOXYD12_FULL_49_13] (length=784 residues).
MQTPSVDPSRSAGLPEIVRHYAELFRRKKWLLLIMCLIATGLAGYCIIAFDLLKHAQPATVLIGIDRPLVGNGTIGQESM
GPKKIELIRSRALLQRVVADLSLCLRLEKGMREEFFDSIALGPTAVYGTYRVRWDPASKQALTVYLSKAPPVYRGEAVFR
SDLSKSAILEIPGTFLRLNERFIRNPGTFTFSIVSTRRATDNILDNMTIEGPTSRKENYFTITLSGRDYALTTKIVNAIA
DLFVLQNLSFEKRRVHERIETLGKQLELARKQLATSDYALRDFLTANPASALDKQAERTLGSLVQQESRGLELESFLNDA
ATLQKEFALAPGEGRIDIVREILILLSSKNVIRASVLQSELSRLLLEKDALERTYSKGHPLVQANQQKIDGLALQASQAL
NDFYQDISRKVSEKKDNISQLSTRLRSLPQKGMQLAELQRVQQINSESYSMLMSRFNEAKVEDAVEVSDAFVMDYAVEPL
PMPPMQKLLITLVLSLLAGLITSIAPIVFFDQYRRTAFSEIDLFKLIDIPILESIPVLRPAPQAQRTARERREAAGKPKP
SPLLITEGVLPVYAKEVFRSLRTKILLSFLGINQRSILITSLDSGAGKTIVAANHGITLAQHGLKTLIVDSDLRRGTLHS
VFGLKQSPGLSEYLGDNSEGPLPESIQHTAISGLDVMASGQLVSDVSELITPFRMGQFLTTAFLLYDAVVIDTPPLGVVA
DAAVIHEKFSKCMIVVKAGVTDINDLNEKLKEYPPIRNKIVGIVLNQARRDQRFKYYRSSPYIS
>gnl|bykdb|A0A1F7F7U0 [Bacteria] Bacterial tyrosine kinase [Candidatus Raymondbacteria][Candidatus Raymondbacteria bacterium RIFOXYD12_FULL_49_13] (length=716 residues).
MEHAGKTFNLKDYVTIVLRRKWSLLVIVLAVVAPLIFYVRTMPDTYFAQSQLVIEDLRNTNPMTPQMLRPSRSFDFYQGI
FNSRSFIQAVLQKVGRDTLAKAAGDTVEDKLAAYIASSISLSRGGFESFIVLSARASHAGMAFNLAQSATEIFKLKCREV
VAEEAENTVKETEKQLAIIRDKLEEAEHAYRQYLDKTGNSFDGATTELKLLQDKYYEIRSEWASKEAIYEANRQSLAMLE
RKVAPANTDPKNAEQYNKAKEELRKKEKEKKRLESLGLVLGPSSPINQDIDQLEKEVMRYGAKEERLDAKVVGQWQKMRT
VVAENEMELDLVNNKMKVYQRKIEQYKKSHPDELDQSLEVSRLERSRKVYEDTYNILLEQVEVAKIKKASETGGVTVVDA
VYYPTSAVPRKEAIYYVVGIMVALMLGFGYIFLREFLDTTVKSNDDLEAYNIPIIGTIPHIDIAKSEEIEIRRRSSSSSS
KEAVTTYPKELINFYKDESIVAESYRSLRTNLFFTSPDNPLHTLIVTSSGPHEGKSLTASNLCLACAQMGKRTLLIDSDL
RRPVVHHLFQQPRENGFTDLFIGNSLKSVVRETGLDNLHVITAGRFTPNPSELLASKKIEKLIGELKLEYDLIVFDTPPV
MAVTDAPLLSTKVDGTLLVVKSYSTDRVILERAINTIQNVNANILGFVLNDIDLSHRYASYGYYKYYYHYYRSKKD
>gnl|bykdb|A0A1F7NCG6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPHIGHO2_02_FULL_73_26] (length=246 residues).
MARRAKPAGTVTAVSALVAHADPKSPAAEAYRTLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVL
VVDSDLRRPTLHRIFGLGNARGLSTALLEGLPFADVAQATAIPNLFVLTSGPLPPNPAELVGAMRMRECLEAATTDFDLV
LLDSPPIVSVSDALALSAITDGVVLVIRVGKIPHDVVRRAVVQIESVKGRILGVLMNSVNMKREGYYYDYYRYYHAYYSP
ADGRRR
>gnl|bykdb|A0A1F7NSZ2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_72_37] (length=245 residues).
MAKRGKAAAPSTAAPLVAHADPKSPAAEAYRSLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVLV
VDSDLRRPTLHRIFGLGNARGLSTALLEEQPFADVAQATAIPNLSVLTSGPLPPNPAELVGSLRMRECLEAAAGDFALVL
LDSPPIVSVADALALSAVADGVVLVVRAGKIPHEVVRRAVVQIESVKGRILGVLMNSVNLKRDGYYYDYYRYYHSYYSPT
ESRRR
>gnl|bykdb|A0A1F7PJN6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_71_22] (length=245 residues).
MAKRGKAAAPSTAAPLVAHADPKSPAAEAYRSLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVLV
VDSDLRRPTLHRIFGLGNARGLSTALLEEQPFADVAQATAIPNLSVLTSGPLPPNPAELVGSLRMRECLEAAAGDFALVL
LDSPPIVSVADALALSAVADGVVLVVRAGKIPHEVVRRAVVQIESVKGRILGVLMNSVNLKRDGYYYDYYRYYHSYYSPT
ESRRR
>gnl|bykdb|A0A1F7Q5I6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_73_47] (length=246 residues).
MARRAKPAGTVTAVSALVAHADPKSPAAEAYRTLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVL
VVDSDLRRPTLHRIFGLGNARGLSTALLEGLPFADVAQATAIPNLFVLTSGPLPPNPAELVGAMRMRECLEAATTDFDLV
LLDSPPIVSVSDALALSAITDGVVLVIRVGKIPHDVVRRAVVQIESVKGRILGVLMNSVNMKREGYYYDYYRYYHAYYSP
ADGRRR
>gnl|bykdb|A0A1Q6YM61 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_2_20CM_2_64_8] (length=570 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPEVEVEIDAEVEPEMPVDVESEIHDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEP
EIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTP
NSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNP
KGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGV
DGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNASGNGT
GYLSGNGITH
>gnl|bykdb|A0A1Q7G9Y1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5] (length=820 residues).
MVRGRTRGGGTSLGYRLPPGGETPPGEEWRGYFGSIKRRKRLVILVTLAGTALGVVATKLVAPYLPFYSATANIWIDGSG
HRPDRDQATAGPIHSGQLLGASGWVNLARSYVVLDSVARGLRLYVGWEAEQDSAALWSLGLKTQFRSGEYRLEVDSSGRR
FRLLTAKGAELQRGMVGDSIGGAVGFVWVPPASALTPRRTIRFTVSSPYDAATNLAQRLQVELDPDGNFMQVSLRGSDPA
YIAATVNAVATRFVDVATDLKRKRLGELTKILAAQLEHAQANLRSAETALRSFQVRTATVLPGSAIIPPEALAPGANAPP
PRRPPVSDLVGQSRDPVFANFLDIRVALDQLKHDRAAIERVLAQSADSGLAVDALELVGSVERSSELTDALKELVGKRAD
LRALRYRYTETNPEVRRVAGTIGTLERQTIPALSRQLVEELRTREAELARQVESASADLRHLPSLAIDELRLQRDVVDAE
QLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDAAPFLFLLSVVGSLGAGVLAAVLRDRVDPKLRYPAHVTQEM
GLPILGAVPHLPAANGKGGRKLSGNGVGTAAPVIEALRGIRLSLVHAHGTAGPLLVTITSPGSGEGKSFVAANMALAFAD
AGHSTLLIDGDIRRGQLHRVLNAARTPGLTNWLTAGPAPEAIVQATPYPRLSFIGCGARTPFGPELLGSAEMARLFAALR
PRYEVILVDSPPLSVGVDPYILGTLTGNLVLVLRSGVTNRELAGAKLDAVDRLPIRLLGAVLNDIRPDGAYRHYSYFPEG
YELREEEPAGQRKRILMAAG
>gnl|bykdb|A0A1Q7IM35 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_4_67_11] (length=570 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPEVEVEIDAEVEPEMPVDVESEIHDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEP
EIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTP
NSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNP
KGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGV
DGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNASGNGT
GYLSGNGITH
>gnl|bykdb|A0A1Q7NS62 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_2_68_13] (length=305 residues).
MSLIEPASFEAEQYRALRQLVERLHKSTALSIVAVSSPTVADGKTTTSINLAGALAQAPDARVLLVDADLRGAALAPRLG
FDEYVGPGLVDAIVDVNLTLPAVVHALPSLNLSVVPAGRFPSAPYEVLKSPRFGELLAEARKRYDYIILDTPPLVSVPDC
RVIEKWVDGFLIVVTAHRTARKLLEEALNVTERARIVGLVFNGDDRHLSRDSYGAYDSRQSARRNGGGWRRRVFGNRDRI
RRSVTAGRRRAPGFIGRAAEKIHWSRTRERDGDQRGRSLARDRHGVGDAALARPLDPQQLRAARL
>gnl|bykdb|A0A1Q7TX95 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9] (length=751 residues).
MVEELSGPHVGYLGLLRRIASHWRLSLIVCVGVAAPVAVWALLFLPKSYEAVAAIFIEDPRRGSVSTLRDWMPAGDASYQ
QAVLRSRSLAAAVVDNLPQDSMNELIRHAMHRDYVLAGQNLIRRLLGHEPVVFSPQQRAVRELLTARVRFESLPSGEVEI
RAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATRQFIENLLAQTKANLQEAEESLAKHQRGGTLKLPERSSVEMAQL
AQLESNLADIQASEEIAKRRLAGLKGGKDSAGMPGRAARQALSERLAALEAKLATLEEKYASEHPLVKSTQAEINELKTA
LAAPPSISPGGRSAIRLTLGPADQAAVAKQVADAEVELASLQNREDVLKQSIARLSSRLSALGAEEWETSKVLRRVETHR
SLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFGLGVGVAGVIEYFNQPIETEDDVFDAT
GLPVLGWLPTIAGHQPTTGVEREPLNLVNGSIPDTLPVEGCRSIRTSLESLNGSRKLQSIMLASAGPKEGKSTIVLNLAW
VFWELGRRLILIDADLRRPSLHRGLRCPPQPGLADMLTGNVPWPRAGQGIREGFVFLPAGSTGTAKPGVLLTVAKLRGAL
ELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVSPRETRRYYGR
YGDYYGSRDGNIEPWWQRCRFWANKRTGVLR
>gnl|bykdb|A0A1Q7UA97 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9] (length=570 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPEVEVEIDAEVEPEMPVDVESEIHDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEP
EIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTP
NSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNP
KGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGV
DGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNASGNGT
GYLSGNGITH
>gnl|bykdb|A0A2V6PDA4 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=245 residues).
MSLLDPISFAAEQYRTLRHIVEQPHRAEPLSVLAVSAPTIGDGKTTTAINLAGAFAQAADVRVLLVDADLRRPTVSSRLA
LDDSGPGLVDAILDPALGLGDVVRPRPPFNLWVLPAGPRTDSPYELLKSPRLAALLHEARQQYDYVILDTPPLVPVPDCR
IIGKYVDGFLLVVAAHKTRAKLLDEALGVLGSSKILGLVFNGGDVTDSGYYYAGRYGARRGGDDPEDAFRPWYRGGQPLD
RLLRR
>gnl|bykdb|A0A2V6Q732 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=268 residues).
MSRHRVATLDECLVSLVAPHSYEAEQYRGLRHLVEQAHRTSALSVLAVSSASVGDGKTTTAINLAGALAQASDARVLLMD
VDLRRPAIAERLGVEEGRHGLVDAILSHDLKLADVARPCGPLNLAVVTAGVFSDIPYELLRSPRLGDLLEQARRDYDYVV
LDTPPLVPIPDARVISKWVDSFLLVVRANTTPRSLLEESLNLMDPPKVLGLVFNNDERPRTTYHDYYAGSGRHNKGGAPW
WRPFAKIRSVFDPDAAGRRRAERRREIR
>gnl|bykdb|A0A2V6RAF2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=613 residues).
MTELQSARVTFTPLPSGEVEIRAVAYAPRVAMDLANTYVEVLQTRSRSNIRDEARTSREFIETLLNQTKTSLQQSEEQLA
KVARGRSLRMPERNAIEAAQLSQLENSLAEIQGSKEIAKVRLAQLKGKDASGRPVPQAAQQQVTRRLLQLQEKLAGLRER
YTDGHPLVKATQAEIKDAQDMLTAGPQGLPERVAAPQFGAAERAASAKQIADLEQEVSALETREEVLKQRLARTSQGLSN
LGAEELEVAKLRQSVESQRNLVTTLSEKLGTVRIQEQGEDRGLRLIDLAALPQRPSSVPAMRVILLGMVGGLGLGIGLAG
LLEYFKQPMETEEDITAATGLPVLGWLPTIQGSGRPDKGPEREPMSFIDVFAPNTLPIEACRSIRVSLLSMYRAEDVRTI
MLASAGPGEGKSTVALNLSYVFSQAGRRLLMVDGDLRRPSLNRPLRLPVKPGLVDVLASHLPLAAALQPIKDGLQLLAAG
TTDGADPGVLLSADNISRLFDLAKGHADLVVFDSAPVLAVADNLALASMVDAVILVVRAGVTQRRDLVRAKAMLDKVRAP
VVGAVLNRVSSRETRRYYRSYSGYYGVGEGTSVRRRFRSAQSWWPIRRSEKVG
>gnl|bykdb|A0A2V6RB03 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=393 residues).
MGTTVKPDVVETTVLAAAPQDATSRAGQDAARRGGIVLPRAPGSVDPQVERSRGRRPRTTIAHRLQDERPSNEVFCHLSR
EGSPVSKFLKALERAEQQRALGRHPAPSEAASERGLAVPETAPPRPPRASHELAREVPNGLEEHLVSLLAPRSFEAEQYR
TLRHLIEQLHKSTGLSVVAISSPGVADGKTTTAINLAGALAQASDARVLLVDVDLRGGALAARLGIDERAGRGLVDAILN
AELTLEAVVEVRPDLNLTILPAGRLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLVSFPDCRVIEKCVDGFLIAVA
AHKTSRKLLEEALNVTERAKIVGFVFNGDDRHLSRDSYGTYASTRSVDLGGGGWRRLVSSSSRTHRRQTASDH
>gnl|bykdb|A0A2V6SBN9 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=264 residues).
MEPAAPRHLGRPVIEPPAPVTKPRVDRPNRAEDHLVSLFDSESWEAEQYRVLRHAVETLRKGVNLQIVAVTSAAVGDGKT
TTAINLAGALAQSADARVLLVDVDLRRPAVARHLGLGGSKGSLVGALLDSGLTLEAAVERLANSNLSVLPAGRATVAPYE
LLKSPRLEALFEEMRQHYDYVVLDTPPFLPVPDCRLIEKCIDGFLLVVAAHRTPRGAVAETLNLMDPAKVVGAVFNGDDA
RRSNYYDVYARPSAARWRRAWSKP
>gnl|bykdb|A0A2V6SIE8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=615 residues).
AYYGTQFELLSSRPVLGRVEAALGLPKHPAFAAGGWFGRAGQSSSFEGLDRYIEVTPVKRSRLVRITARVPDADLAAAIP
NRVATEYIGMLSQERREASDAAAKWLESQLGGLRSGSEATGGAVQRFVEQNDMVPSQDGKEFALTQLEDLNRAYTEAEND
RLQKEARARMLTSADPATAGAALGSDLVRGLQAEEARLEREVARAGTTYGPQHPKMVELQADLANAKKRVETEIGKGRSA
VQEEARAAARRAEEVGRRLDAQRQRAITQHVRQMQLTLLKKEADVGATVYADLMKRLKEVQLAAQMRMANVKVVDPAEKP
RGRSSPNHPRDLLMGLVGGLLGGVALAFVREVADKTLRTPRDVDLLVRLPSIGAVPTIPGYRRRTLPPVAELPGVSLPGE
APAWPEQMAEEAFRSIRTLVFHRQAPGTPRTMLVTSAEPGEGKSFVAVNLAVALAGTGEPVLLIDADFRRPSCHQVFDLN
LPKVGLSSILYRDQPWDGSIVATSVPNLAFLPAGPMPPDPAALLSSERARELLAALRERYAWIIVDSPPVLAASDACALA
RQVEGVLLVVRANATPIEAAQLVRDRLERLGANVVGVVLNDVRPTRDRYFYANYG
>gnl|bykdb|A0A2V6SIM1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=300 residues).
MSQFWEALEQAKRDRALQAPQSLPVPAPPEPKGDSALRLVAEAPVEPLHRVDDHLVSLLAPASFAAEQYRALRFVIEQTH
RESAVSVVGVSSPSVGDGKTTTAINLAGALSQASDARVLLLDLDVRRPQIGRRLGLDPNQPGLVDAIVDPRLDLADIARA
VRPFNFAVVLGGQSAKATYELFKAARLRTLLEEARESYDYVVIDAPPLLPMPDCQLIGGFVDKFIVVLACDKTPRRALAE
ALNVLAADKVLGLVFNRSDQLLSDYRREDYGEKVRGARWRWAAKRIQPFNGAKTRSSDIR
>gnl|bykdb|A0A2V6SK79 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=244 residues).
MRRPRQPQAGSGTPTALVTETAPKSAAAEAYRTLRTNIQFAGLDRPCKTIVITSATPGEGKTTTAANFAAVCAQSGSRVL
LVDGDLRKPTLHRIFGLDNQRGLTTTMIEGKSLADVAIPTRVPNLSVVVSGPLPPNHAELAASRRMHDLMEAATRVFDLI
VIDTPPVLSVSDAVALAAQMDGVILVVRGGKTSAEAARRAAEQIDAVKGRILGVLLNRVDARNSGYYADHGRYYDAYYGS
DHKG
>gnl|bykdb|A0A2V6T785 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=381 residues).
MVSKFFKALEQAERDRVEREGQGTKSPLAEPPAAPDASSARPSDTPHPVVAPETAASVAIPGPPVDVGDIGRSPTVEHAR
VPAPRAADAPAARPSVRASRVGREAGAPTAAAPNIVDAAARAHASVDEHLVSLLLPATFEAEQYRALRHVIEHQRAATGL
TVVAVTSPAVGDGKTTTAINLAGALAQAQGGRVLLVDADLRRPSIAEHLGLAGPHRPDLPGLVDALVGGPVRFEEIGQTY
EEFNLTVVTAGGVPHAPYEVLQSPRFAAILEDARQRYDYVILDTPPLVAVPDSRVIMKVVDGVLLVVSAHQTPRRLLEEA
LGLVDPAKLLGLVFNQDDRPLSGYYRGYRGYRTYGAAPTNGHEASRWNRLVRRGRRIENGG
>gnl|bykdb|A0A2V6TVU3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=305 residues).
MSKFFEALERSETEVALRTRASSPRSTEDLAASPAPEAPSVEVLPAAPRGFPRPVFEAPSTAINRVVGRSNRVETHLVSL
LDPRSYEAEQYRVLRYVVETLRKGNNLQVVAVTSPGVGDGKTTTAINLAGALAQSVDARVLLVDIDIRRPAVARQLGLAT
KRSLVATLLDARLTLKDTVEHVAHFNLWVAPAGGPAGAPYEVLKSPRLEALLGEARECYDYIVLDTPPCVPVPDCRVIAK
YVDGFFLVVKAHQTPRGELARALDLMDPQKVAGLVFNDDRVRRSSYYDVYAGPPRSPRRRLWRRP
>gnl|bykdb|A0A2V6U1W4 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=602 residues).
MPPPPAPEETEDLALASPLTSAVLSRLSIEPVRSSRLVRISFESHFPDLAARVPNALADAFIAQQLDQKVEATRYATQFL
ATQLDETRDRLGEAEGKLNRFLKANNILFIAGGDKTSQAQDLITQQLTLLSDGWLKARSERIAKESLLAQGNTQDVGTLP
AVLQNSLVSKLREDLAALESEYEKLSQVFKPGYPHMRQLAEKIAESRRQLRTEIDRAAQALQADYQAALRNEQELEGALA
QQRLQAGGLADNMAKYNLLRREVDTSRDLYSSLLGRLRETQISAALFTSNISIVDRAEISGIPSRPKRTTNLLVGCIAGL
LGGVVLALVFEYLDTNINIKDAKDVESVLRVPILGMVPSWALRRRREPADGLPFALAAQSETASDFAEAFRNLRTSLLYS
SPDHPPKTILVTSLQPEDGKTSLATNLAISLVQVGAVEVLMIDADMRRPNLHNVLSVPQAPGLSTFLTGQAELADVIVPT
SVRNLSIIPSGRIPLNPAELLTSTRLPQALEGLGGRFAHIVVDTGPIFGVSDAMIVAAQVEGVVLVLRHGRASRDAAQRA
IRNLMSVGAKLLGVILNDVDVRAEGYYGYYSNYGYEAEKETA
>gnl|bykdb|A0A2V6U3P1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=207 residues).
MQFAGLDRPCKTIVITSATPGEGKTTTAANFAAVCAQSGSRVLLVDGDLRKPTLHRIFGLDNQRGLTTTMIEGKSLADVA
IPTRVPNLSVVVSGPLPPNHAELAASRRMHDLMEAATRVFDLIVIDTPPVLSVSDAVALAAQMDGVILVVRGGKTSAEAA
RRAAEQIDAVKGRILGGLLNRVDARNSGYYADHGRYYDAYYGSDHKG
>gnl|bykdb|A0A2V6V7G3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=286 residues).
MRAADAPAFTESVPTVKDDDAESVDDRLVTLLTPNSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLA
GALAQARETKVLLIDMDLRRPAVNGQLGLRGFNPKGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRL
HQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLIIVNAHKTPTRLLSETVNVLGQSKVLGLIFNRDDQPIAEHLY
NSYGPDPSGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLSGNGITH
>gnl|bykdb|A0A2V6VAA8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=746 residues).
MDAKTTGSIDYLRLVRRVVVHRWRIIVAGFLAVVVPTVAVVSLSTENLYEASATLFLLPEKSDPPFLREFTSPEATAVYV
VLLRSRSLAQAIIEALPKESREELTKRVLFRDYLLTATNSLRRLTGGEVVVYSPTELALRELQEARMNFTIARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLESLMTQAKMSQGEAEDAMRRFQAKTGGRIKLPEESKSDLTA
LAQLESQLGDLQVTREVAENKLTYLKGEKSRPGSPTASADSSTQGLQERLTQLEAKLAALAEKYTDQHPSVQTARAEIQE
TQERLASALRPRQAPKPGGASASLKPIEAAQLSKQMAALQVEIVSLQAREEVLQQRAARLRRSLSAMGAREQEYSGFMRT
VLTQAKLTDMISDKLTAARISEQSQIRSIHVIDLASLPRQPSPKQPLTLLFMGVLGGLALGVGAATAREWVLQVVETERE
VTRATGLPVLGSIPVADRPGSSEKGAAPADDLPVLFVAGNDLHSLPADACRAIRTALDCQGLDRPLKTLLVTSPGAHEGK
STVLLNLGRAFLETDRRLLLIDADLRRPSLHRALRTPNEIGLADVLRAGTVWPEAFRPLAPGMDFMPSGIKPANPSSLIA
SKHMLRVLELARERADVVLIDAPPVLAVADCLPLCRYVDGVILVARFGATRRRSLIRAKEQLERVGAHVVGVVINGLSRH
ETRHYYSEYTHYVGIQKRKRKGKRRK
>gnl|bykdb|A0A2V6VPM0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=370 residues).
MGAEEWETSKVLRRVETHRSLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGLGLGVGVAG
VIEYFNQPIETEDDVFDATGLPVLGWLPTIAGHQPTTGVEREPLNFVNGSIPDTLPVEGCRSIRTSLESLNGSRKLQSIM
LASAGPKEGKSTIALNLAWVFWELGRRLILIDADLRRPSLHRGLRCPPQPGLADMLTGNVPWPRAGQGIREGFVFLPAGS
TGTAKPGVLLTVAKLRGVLELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASL
LGVVLNQVSPRQTRRYYGRYGDYYGSRDGTIEPWWQRCRFWANKRTGVLR
>gnl|bykdb|A0A2V6W355 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=288 residues).
MSKFFEALQRAERSATPSVPAPASAEPPPMMEPRLPPPALAPRPAVAASLRSASVELHLVSLLEPASFEAEEYRVLRHAV
ETLHKDAHLQIVSVTSPGMGDGKTTTAINLAGALAQSTDARVLLVDIDLRRPAVARHLGLAHSKRCLLDALLDPGVKLED
TVEHIARFNLSVLPAGGPEAVPYEILTSPRLEELLNEARRRYDFVVLDAPPFVPVPDCRLLTKCVDGFVVVVATHRTPRG
MLAETLNLIDPAKLAGLVFNGDVAPRSSYYRVAEPTPVARWRRPWRSP
>gnl|bykdb|A0A2V6X2Y0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=304 residues).
MSRFFKALEQAEHEQALRRQTAPVEPAPAPRVERAPVPSSAGTWPPPQRPVSAARASAPAFSSELDEHLVSVLAPTSFEA
EQYRALRHRIEQLHKTTDLAIVAVSSPSVADGKTTTAINLAGALAQAPDARVLLIDADLREGSLARRLGLDVNMRPGLVE
AILDPNLTLDAVAHADHNLNLSVLTGGRLPSAPYEVLKAPRVGELLGEARRRYDYIVLDTPPLVSVPDCRVIGRWVDGFL
IVVTAHKTSRKLLEEALHVTEPAKILGLVFNGDDRHVSRGYSYGGGRRSQTYGRARRRQTASDD
>gnl|bykdb|A0A2V6XML6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=307 residues).
MSKFFEALERAETEQVLETPAPSPPPTVDPSASAAPAAPSAEVPPTPSVRFPPPVREARAPTTERAVDRSHRVGAHLVSL
LDPRSFEAEQYRMLRHVVETLRKGAILHVVAVTSPGAGDGKTTTAINLAGALAQSADARVLLVDLDIRRPAVARQLRLSG
ARRSLVDALRDPGLTLEDTVEHLAHFNLSVLPASRPAVEPYELLKSPRLEALLDEARRRYEYVVLDTPPFVPVPDGRIIA
KYVDGFLIVVKAHRTPRGALAQTLDLVDPAKVTGLVFNGDNTRRSGYYDGYVASPRGARWRLPWSKP
>gnl|bykdb|A0A2V6YDI1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=291 residues).
MSKFFKALEQAERERAVRRQTATSEPANGQGPAVAEPIAYQAPRVSRGLAKGVSNGFEEPLVSLLAPTSFEAEQYRVLRH
VVETLRKDANLQVVAVSSPGVGDGKTTTSINLAGSLAQAADARVLLVDLDIRRPAVARQLGLAGSKRSLVDALLDSSLTL
EDVVEHLAQVNLSVVPAGGPARAPYELLQSPRLDALVDEARQRYDYVVLDTPPITPVPDCRLIAKCVDGFLVVVAAHRTP
RGGLAESLAMMDPAKVVGLVFNGDTRRRRGYYDVYAGAPERAGWRRAWRRP
>gnl|bykdb|A0A2V6YDI2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=309 residues).
MSKFFEALERAEREADRPTPASSPRPEAGPSGSPPPAAPPAASPPPAAPEPVAPSVFKAPATATRPPVDRASRIGEHLVS
LLNPASFEAEQYRVLRHLVETLRKGANLQVVAVTSPGVGDGKTTTAINLAGSLAQAADARVLLVDMDLRRPAVAGQLGLS
GGKRGLAEALLADSGLSLEDTVETLAHFNLSVLPAGRATVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRV
ITKSVDGFLVVVTVHRTPWGVLTEALDLIDPAKVVGLVVNGDDTRRSSYYDVYAGSSRGARGRGAWSRA
>gnl|bykdb|A0A2V6YHI8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=1105 residues).
MDQPKSSEYVRLLRRVATNRWRLVLAGFLAVALPTIVWAVFLTPDTYEATATLFLLPEKSDPGFLREFATLEVNTLYQVI
LRSRSLAQGVVETLPKESRDELSRRIGFQDHALIVMNQIRRWQGQEVVVYSPTELATRELRESRMNFNIAKDGTVTLTAT
AFSPRVAADLANTYVEVLLSRSSSFARQQARGTRELLESLFTQARTGQVDAQDALRKFQSQTGAAVKLPDEARVDLQRLT
QLETSLSDVQVSREIAENRLNYLKGDRKSGPPTGDASVQPVRERVAQLEARLDGLKEKYTEQHPLVQVARADLQEAQERL
KSTVQGQQTPRPGGVVALKPLEAAQLSKQMADLEVEIISLQSRENGLQARIARLKKSMATMGAREQEYAGLARMAETQAK
LTGLLADKVTAARISEQAQVRGIHVIDLAEQPRQPSSKRPLKFLLFGLLGGLGLGVATAVLREYASRVIETEQEVVAASG
LPVLGSIPIARPLTGAPAGTKTTPMIFVSTHDPHSLQADSCRAIRTAIDCHSLGLEHPIKTLLVTSPTAHDGKSTVLLNL
ALAFVESGRRVLVIDADLRRSSLHRAVGVPNERGLVDMLQKGVAWPEGFRGVATGFDFLPSGIKAANPGALLSSRHMAEL
LDQARERADLVLIDSPPVLAVSDCLPLCTKVDGVLLVTRFGTTQRRSLIRAKAMLEKVGAHIVGVVVNGLSPRETRRYYA
EYNHYVGSGKSRRTRRRKSMKSFFSGLLIVLSVLGSGITARAAEDEYRIGADDVLHIIVWDNKELEQTVVVRPDGKISYP
LAGEIQAQDLTVPQLTEELTKRLSTAVKNPNVSVMVQEIKSYRVHFVGKVVKPGVYPIKAGTPLLQALTLAGGTSENADL
TAAYIIRGNKTLPVDLRKLVQQADLSKNVRLERDDTIVVPEIALGSSLQEMQDRRIYVLGKVTKPGVYNLKEDVPILHAL
FLAGGVVEGGDLASAFIIRGKEKIPVDLWKLIQKGDVSQNVMVKHEDTIVIPAGGELQNAVYIMGEVLKPGVYSQPEALS
LLKLVSLAGGFTKYAAPGRATLVRRDGDKKVLLKVDLKDIMNDPKKYEDLALRPGDVLIVPERLF
>gnl|bykdb|A0A2V6YK84 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=310 residues).
MSKFFKALEQAERDHAQREPVIPAEASSERASVVPHWPEPAAEQPPVFTPPPPRAPRAVIESRVPVDSPRIAPALLDEHL
VSLQAPATPAAEQYRVLRHLVETLRKRANLQVIAVTSGGVGDGKTVTSINLAGALAQSEDARVLLIDMDLRRPSIARYLA
LGATRPTLADALEASGPELKDAVVRIPRFNLSVLRAPVSTAAPYEVLRSPKLEALLAEARRQYDYVVIDTPPFVPFPDCR
LIAKSVDGFVLVVASNRTPRGVLAEALKAMDSEKAVGYVFNAHPWTPTSYYEDGNGHGRTRSWHRKGENS
>gnl|bykdb|A0A2V6ZH60 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=326 residues).
MSRFFKALERAEQERALRVVASPPPAPPSETSPTVPETVPPRPSPAAPKTTPPRAQETFFRPPRAAATAGRAERIIGVEE
HLVSLLAPTSFEAEQYRALRHKIEQLHRSTDLTTIAVSSPDAGDGKTTTTLNLAGALAQAPDARILLIDADLRGANVAMY
LGLDEHTAPGLVDAILNPSLTLGSVVQTHPYLNLTVITAGRQPTSPYEVLKSPRLGELLAEAREKYDYVIVDTPPLVSVP
DSQVLARLVDGFVLVVGAHRTPRRLLLEALNLLEPTRVVGLVFNGDDRHLSRDSYASKRVYEMTVDGTRRHRFSSRSRGR
QTSSDE
>gnl|bykdb|A0A2V6ZW34 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=325 residues).
MSKFFKALEQAERDNVEQVSQAPVEVVSHRPSVMTPPVVTPPPPRAPSPVDEPPAPPAESPRPVFEAPRPVFKAPRPVVR
SPRVASALLDEHLVSLQAPSTAAAEQYRVLRHLVETLRKRTNLQVLAVTSPGVGDGKSVTAINLAGALAQSEEARVLLVD
MDLRRPAIARYLALGESRPTLADALGTPGLALKDAVVQVPSFNLSVLRAPVSAAAPYELLRSPKLEALLAEARQEYDYVV
IDTPPFVPVPDCRVIAKSVDGFVVVVASNRTQRGLLAETLKAMDPDKAVGFVFNAHPTLPTSYYDYGNGHSHGKTRSGRR
KGERS
>gnl|bykdb|A0A2V7A3P7 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=1145 residues).
MPRVFGHYVPARLLTLAAGEAAIVFGSVFLGLALPLVGFHVIRPAWGDGFAPSMVLTTLVLSMAHIAALYDTRQDYGRAE
LLLRLTIAFVAAYLVIAMLGYFILHLTLARKAFLLSFVTAFPASFLLRLVHGRLTAQSRARRKVLLLGSGEVSQMIAATV
RASRHTYEVVGRLDANGRGGDGSDGVWSLGTLEDLDWVSKVTRPDVIVVALEERRGTLPVSEIVESKLQGTEIEDWPNFY
EKLTGKIPVGNLRPSWLVFADGFKPARITVLTKRTIDLLGSLCVVMLSLPVMLLIAVAIRLDSPGPVFFRQERLGRFGRV
FLMFKFRSMLQGEGAALPSPTGGQAGHHGLGPGQEPVRCDRREHLGQIGIRPLLHQEHVDLSRHADPAPHRPDRAFHEGI
RRMEAKTSSVDYVRLLRRVAIQRWRLILAGFLAVVLPTMVIVILSTENLYEASATLFILPETSDAGFLRDFTSSEASSLY
LVLLRSRSLAQAIMEALPNESRDELSRRVIFRDYLLTVMNSIRRYTGGAVVVYSPSEVAIRELQEARMSFVLGKDGTVTI
TAVAFSPRVAMDLANTYVEVLLSKSSSFARQQARGTRDLLENLWSQAKANQTEAEDALRKYQAKNGGTLKLPEEAKVELT
SLANLESQLNDLQINREIAENKLAYLKGDKKKPGGMTLAADPSVQALRDRLAQLETKLAALTEKYTDQHPSVQNAQADIQ
ETQQRLAAALQPQQSPRPGGAQVPLRPVENAQLSKQMAALDVEIVSLQAKEDTLQQRANRLRRSLSAMSGREQEYSGLLR
AVMTQTKLTDMLSDKLTAARITERSQIRSIHVIDLANLPRQPSPRQPLKLILFGLVGGLGFGIGAATLREYMTQIVETEQ
EVIHATGLPVLGSIPIAEHIEPLVKGPREQQPVLFGSGDVFYSLPADACRAIRTGLDCQSLNRPLKTLLITSPGAHEGKS
TVLLNLGRAFLEADRQLLIMDADLRRPALHKALEVPNEVGLADVLREGTVWPEAFRSLGPGLYFMPAGTRRPNPSSLLSS
RHMGTVLQEARDRADIVLIDAPPVLAVADCLPLCRQVDGVILVIRFGSTRRRSLQRAKDQLQKVGANVVGVVINGLSRRE
TRHYYAEYTHYVGIQKHRRRGHKPK
>gnl|bykdb|A0A2V7A9S9 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=668 residues).
MAPEDADMYLNFYALTEKPFNPTPDPKFLYMSPAHREALAQLSYGVQERRGFMLLTGKVGTGKTTLLHALRKRLTSQTAI
SFVFNTTLPFDGILEYILEDLGIAKGLESRAQRLIALQHFLVDRERAGENTVLIFDEAQNLDAATLEQIRLLSNFETPTD
KLLQILLVGQPELRAKLSLPELQQLKQRIGLRCQIPPLAPEEVRQYIRRRLRIAGSHDLGLFSDAAVDRLTEYSGGIPRV
INMVCDHSLVFGYADQKRRIDRPIVNQAIEYLEEGASPSSQPKAVKLNGSRVRLLSRWSFGTLAVALADERAGPCPVSAP
PPAPMSKFFEALEQAQQEKAARRRTVPAAPAEPVAERAPVVTKPPAPAEPVAERAPVFSKPDAPTFPQPVPRRVRRSSLE
PSRGGSNETEEHLQMEEHLVSLLAPTSFEAEQYRTLRHLIEQLHKAAELQVFAVSSPTASDGKTTTAINLAGALAQSHDA
RVLLIDADLRVPTVGTNLGLDERPGPGLADTILNSSLTLDAVVQVRPQLNLSILPAGRLPSAPYEVLKSPRVGELLAEAR
KRYDYIVLDTPPLVSVPDCRVIGRWVDGFLIVVAAHKTPRKLLEEAIRVAEPAKVVGLVFNGDDRHLSRDSYASYAARQF
SDGHGGGWWRGPFGTRDRRHRKHTASDD
>gnl|bykdb|A0A2V7AFT7 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=304 residues).
MSRFFKALEQAEHEQALRRQTAPVEPALAAPVLPARTPFPAGTWPAPRGPVSAARKSAPAFSSDLDEHLVSMLAPNSFEA
EQYRALRHQIEQLHKTTNLAIVAVSSPSVADGKTTTAINLAGALAQAPDARVLLIDADLREGSLARRLGFDVDRGPGLVE
AILDAHLTLDAVAHADRSLNLSVLTGGRLPSAPYEVLKSPRVGELLGEARRRYDYIVLDTPPLVLVPDCRVIGRWVDGFL
IVVTAHQTPRKLLEEALNVTEPAKILGLVFNGDDRHVSRGYSYGGGRGSHTYGRARRRQTAPDD
>gnl|bykdb|A0A2V7AVY2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=745 residues).
MDAKTTGSIDYLRLVRRVVVHRWRIIVAGFLVVVVPTVALVTLSTENLYEASVTLFLLPEKNDPPFLREFTSPEATAVYI
VLLKSRSLAQAIIEALPKESREELTKRVLFRDYLLTATNSLRRLTGGEVVVYSPSELAIRELQEARMNFNIARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLMAQARSSQGEAEDAMRRFQAKAGGRFTLPDESKGELTA
LAQIESQIGDLQVTREIAENKLGYLKGEKVRPISAPASSDPSTQSLQERLTQLEAKLAALSEKYTDQHPSVQTTRAEIQE
TQERLASTLQPRQTPRPGGTATQLKPIEAAQLSKQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMRT
VLTQAKLTDLISDKLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLALGVSAATVREYAVQVVETEQD
VAHATGLPVLGSIPVAERSESASGREVAPVDDLPMLFVAGNDLHSLPADACRAIRTVLDGPSLDKPLKTLLVTSPGAHEG
KSTVLLNLGRAFLETDRHLLMIDADLRRPSLHRALRTPNEVGLADVLRDGTVWPEAFRALAPGMDFMPSGIRPANPSSLI
ASKHMVRVLELARERADVVLIDAPPVLAVADCLPLCRYVDGVILVARFGITRRRSLIRAKAQLGRVGARVVGVVINGLSR
HETRHYYAEYTHYVGIQKRKGKRRQ
>gnl|bykdb|A0A2V7B9E3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=751 residues).
MVEELSGPHVGYLGLLRRIASHWRLSLIVCVGVAAPVAVWALLFLPKSYEAVAAIFIEDPRRGSVSTLRDWMPAGDASYQ
QAVLRSRSLAAAVVDNLPQDSMNELIRHAMHRDYVLAGQNLIRRLLGHEPVVFSPQQRAVRELLTARVRFESLPSGEVEI
RAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATRQFIENLLAQTKANLQEAEESLAKHQRGGTLKLPERSSVEMAQL
AQLESNLADIQASEEIAKRRLAGLKGGKDSAGMPGRAARQALSERLAALEAKLATLEEKYASEHPLVKSTQAEINELKTA
LAAPPSISPGGRSAIRLTLGPADQAAVAKQVADAEVELASLQNREDVLKQRIARLSSRLSALGAEEWETSKVLRRVETHR
SLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFGLGVGVAGVIEYFNQPIETEDDVFDAT
GLPVLGWLPTIAGHQPTTGVEREPLNLVNGSIPDTLPVEGCRSIRTSLESLNGSRKLQSIMLASAGPKEGKSTIVLNLAW
VFWELGRRLILIDADLRRPSLHRGLRCPPQPGLADMLTGNVPWPRAGQGIREGFVFLPAGSTGTAKPGVLLTVAKLRGAL
ELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVSPRETRRYYGR
YGDYYGSRDGNIEPWWQRCRFWANKRTGVLR
>gnl|bykdb|A0A2V7BA71 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=287 residues).
MSKFFEALERAEQERAVRFQAAPSEPTNARGPAVPETALDPALRSAPELPRGVANGLDEHLVSLLAPTSFEAEQYRALRH
LIEQRGKSTALSVVAVSSPGVADGKTTTAINLAGALAQAPDARVLLIDADLRGAAVAARLGWDARVGPGLADAILDASLT
LETAAHACPHLNLSVLPAGRRPSATYEVLKSPRVGELLAEARKRYDYVILDTPPLVLVPDCRVIEKWVDGFLIVVTAHRT
GRKFLGEALNLAERTKVVGLVFNGDDRHLSRNSYGSYATRLSKRNRK
>gnl|bykdb|A0A2V7BAF4 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=579 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIE
PEIHADVEPEIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVD
DRLVTLLTPNSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNG
QLGLRGFNPKGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVP
DCRVISSGVDGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHG
NGNASGNGTGYLSGNGITH
>gnl|bykdb|A0A2V7BRT3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=310 residues).
MSTFFEALERAEQERAVRFQAAPGASTSAPDPPVPESAPDPGLRSLPELPRGAANGLEEHLVSLLAPTSFEAEQYRALRH
LIEQLHKSTGLVVVAVSSPTVADGKTTTSINLAGALAQAPDARVLLIDADLRGAALGPRLGLEEGGGPGFVEAILDANLP
LAAVVQARPQLNLSVLPAGRFPSAPYEVLMSPRVGELLAEARRQYDYVILDTPPLVSVPDCRVIEKWVDGLLIVVTAHRT
ARKLVEEALNVTDRAKVVGLVFNGDDRHLSRDSYGSYGSRRSSSRNGGGRRRRVFWSLDRIRRRRTASDD
>gnl|bykdb|A0A2V7C3J3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=745 residues).
MDAKTTGSIDYLRLVRRVVVHRWRIIVAGFLVVVVPTVALVTLSTENLYEASVTLFLLPEKNDPPFLREFTSPEATAVYI
VLLKSRSLAQAIIEALPKESREELTKRVLFRDYLLTATNSLRRLTGGEVVVYSPSELAIRELQEARMNFNIARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLMTQARSSQGEAEEAMRRFQAKAGGRFKLPDESKGELTA
LAQIESQIGDLQVTREIAENKLGYLKGEKVRPISAPASSDPSTQSLQERLTQLETKLAALSEKYTDQHPSVQTTRAEIQE
TQERLASTLQPRQTPRPGGTATQLKPIEAAQLSKQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMRT
VLTQAKLTDLISDKLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLALGVSAATVREYVVQVVETEQD
VAHATGLPVLGSIPVAERSESASGREVAPGDDLPMLFVAGNDLHSLPADACRAIRTALDCQSLDKPLKTLLVTSPGAHEG
KSTVLLNLGRAFLETDRHLLMIDADLRRPSLHRALRTPNEVGLADVLRDGTVWPEAFRALAPGMDFMPSGIRPANPSSLI
ASKHMVRVLELARERANVVLIDAPPVLAVADCLPLCRYVDGVILVARFGITRRRSLIRAKEQLGRVGARVVGVVINGLSR
HETRHYYAEYTHYVGIQKRKGKRRQ
>gnl|bykdb|A0A2V7CEX0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=304 residues).
MSKFHEALERADTEEALGTTASAPRRTVDVSASPAPEAPSVEVPPAAPPHFPRPVFEAPPRATKREVDRADRIEACLVSL
LDPRSFEAEQYRVLRHVVETLRKGANLQVLAVTSPGVGDGKTTIAINLAGALAQAVDARVLLVDIDIRRPAVARQLGLAG
SKRSLVTTLLDASFTLENSVERLAHFNLSVLPAGEPAVAPYEVLKSPRLEALLDEARQCYDYIVLDTPPFLPVPDCRVIA
KCVDGFLTVVKAHRTLRGELAQTLDLMDPAKVVGLVFNGDHARRSSYYDVYTAPPRRRRLWRSP
>gnl|bykdb|A0A2V7CME2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=553 residues).
DAFIAQQMDRMVEATRYATQFLAKQLEEARGKLGESETQLSNFLNANGIIFVTADRNGNPQDIITQQLSIMSEAFLRARS
DRMAKESLLTQASVQDAFTLPAVLQSPLIAQLKTDGAAQEGEYRRLSQTFKPDYPKMLALKEKIEENRRQLRTETDRTLA
SLKVDFEASVRAEKSLEASLTRQSTLARGLAENMAQYNLLRREVDTSRDLYSSLLGRLRETQVSAALLTSNISVVDPAEI
PAGPSRPRKGLNLLIACVAGLAGGIGLAFLFEYLDTNIKDTKEVESVLRVPALGVVPSRAAFERMLARRKALEAGPGAST
PFALVSHSELPSVFAEAFRNLRTSILYSTPERPPKTLMMTSLQPEDGKTSLVTNLAITLSQLGGSPVLLVDADMRRPMVH
RVLSVEQTPGLSTYLTGQADLDQVIVPSGIPNLFVIPAGRIPVNPAELLASARLREAIETLGQRFAYIVFDTGPMFGVSD
AMILAGQLEGTVLVLRHGRASRDAAQRAIRSLIAVRARLLGVILNDVDLQANSYGYYDSYYLRPDDSRLAERV
>gnl|bykdb|A0A2V7CNK3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=746 residues).
METQKQGSVDYLRLLRRVALQRWRVIVVGFLAVVVPVAILVSFSTENLYEASATLFLMPEKNDPPFLREFTTPEATAIYI
VLLRSRSLAQAITEALPKESRDELTKRVLFRDYLLTFMNSIRRFTGGEVVVYSPSEIAIRELQEARMSFNVARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLLAQAKSHQGDAEEAMRRYQQRTSGSLKLPDESRGTVTA
LAQLEGQIADLQVSREIAENKLAYLKGDKPRAGGAFPGSDPATQSLQDRLTQLEAKLSALNEKYTDEHPSVQTTRAEIQE
AQERLASALRPRQAPKPGGAPAPLKPLEAANLVKQMAALQVEGVSLQAREEILEQRANRLRRSLSAMSAREQEYSGFLRP
VLTQTKLADMISDKLTAARISEQSQIRSIHVIDLANLPRQPSPRQPVKLLVFGLLGGLGLGIGAAMLREHMTQVIETEND
VIRATGLPVLGSIPVAEAAESSGKDGAQSELMPVLFVAGNDLHSLPADACRAIRTALDCQSLERPLKTLLVTSPGAHEGK
STVLLNLSRAYLETDRQLLVIDADLRRPSLHRTLRIPNEVGLADMLRAGTVWPEAFRSLAPGMSFVPSGIRPTNPSSLIS
SKHMTHVLELARERADVVLIDAPPVLAVADCLPLCRRVDGVILVVRFGVTRRRSLQRAKDQLERVGARIVGVVINGLSRH
ETRLRYAEYTHYVGLQKRRKKGKRRK
>gnl|bykdb|A0A2V7D2F0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=314 residues).
MGLSLRSRARGARSAGPMSKFVEALEHAERERVLGQRLDGSSLTAPAAAPVAEVSAALEPVRDAELPVGSPLDEHLVSLL
KPTSFEAEQYRALRHLIEHLHRTAELSVVAVSSPVADDGKTTTAINLAGALAQDPQARVLLLDADLRRGALAHRLGLREP
SPRGFVDVILDGKLTLEAVVKRCPPFNLSIVPAGLLPSAPYEVLKASRVGELLAAARHEYDFIVLDTSPLVSVPDCRVLE
KWVDGFLVVVAAHKTPRKLLEEALNVTDPAKIVGLVFNGDERPLAGYSHGYGHSTNGSTAGWKFFGRGRSAARA
>gnl|bykdb|A0A2V7DAK1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=566 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKPPVAAEPPAQPEPEVPVVAKASTPRKESQPAAAPKATPTPAPEVVATAPVSTP
RKESRPAAAPTPTPTPEPEVVAVAPTITPRHETRAPVAVEIRAPEPEMVATIEAAVATEVEPEPEPEPEIATDIQRAIYT
ELHPIFHPEVEAEIDAEVESEMPVDVESEIHADVEIHAAIAPELHEDIETEIHEEVEPEVYAVIEPEIHADVEPEIYADV
EPEIRMHEEPEIQAEVEDETEAEAACATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTPNSFAGE
QYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNPKGVVAV
LGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLII
VNAHRTPTRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLS
GNGITH
>gnl|bykdb|A0A2V7E6Z5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=506 residues).
MSEFFRALEQAGRDRQEQLAKQRNERKPAAEPPAQPEPEVPVVAKASKPRKESRPVVAAKPSPRPEPEAAAVVPTSTPRN
EPGPSAAVEPPVPPHVEPAIYVEPEVLVATAVATELEPGIDTEVVPEHHAEVEPEIYTELVPEHHAEVEPEIYTELVPEH
HAEVEPEIYAELVPEHHAEVEPEIYTELEPGIDTEVVPELHAEVEAEEETELETEVATENAVAPTPMPFSMRSSDAPAFT
ESVPTVKDDDAESVNDRLVTLLTPNSFAGEQYRTLRHLVEKMHTDTGVSVVGVSSPSIGDGKTTTAINLAGALAQARDTK
VLLIDMDLRRPALNGQLGLRGFNPKGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMIDEARRR
FDYVIIDTPPVIAVPDCRVISSGVDGFLIIVNAHKTPTRMLGETVSVLGQSKVLGLVFNRDDQPMAEHLYNSYGPDPNAG
WTATMRRRWRRSGHRYGNGHSHENSH
>gnl|bykdb|A0A2V7F4L5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=576 residues).
MYLTFYGLKEKPFNATPDPRFLYLTPGHREALAQLLYSVQESRGFLVLTGEVGTGKTTLLQAFLQRLNGRAAVAYVFDST
LPFDGLLEYVLEELGVPTPERSPAQRLLALQRFMLDRRRAGQNTVLVLDEAQNLDAPTLERIRMLSNYETPTVKLLQILL
VGQPELGCGRTRPRALQSPGSDPDCRLLGRDPAPREHSVRPLPRRRLRRPAATDRRRYCRPGHRGARGCGAASGALARFA
GPGSVGTLALGRGRRRGARRARPGPAMSKFFEALERAEREQALRTPASSPSTTADLSGAQAPPAPSGAVEPAGPPLFERP
VFESPATATELAVDRSDRAEAHLVTLLNPASFEAEQYGVLRHVMETLRKSANLKVVAITSAGVGDGKTTTAINLAGALAQ
SVDARVLLVDIDVRRPAVARQLKLAGSKRSLVDALMDSSLKVEDTVEHLAHFNLSVLRAGGPTLAPYELLKSSRLEALLD
QARQRYDYIVLDTPPFVPVPDCRLIAKCVDGFLIVVAAHRTPRSALAETLDLLEPAKVVGLVFNGDSVRRSSYSGYYHAH
VGSSRGARWRRAWRKP
>gnl|bykdb|A0A2V7FF08 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=290 residues).
MSKFFEALERAEREQATQASSPGTTDGPSASPRIEPPVVQATAPANELAVDGSHRVEALLVSLLDPASFEAEQYRVLRHV
VETLRKGANLQVVAVTSPGIGDGKTTTAINLAGALAQSASARVLLVDMDLRRPAVARRLGLAGSKRALVDALLDSGLTLG
DTVEPLAYFNLSVLPAGKPAVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRVIAKYVDGFLTVVAAHRTPR
SALAQALDLMDPGKVAGLVFNGDDARRSSYYSAYVGSPRGARWRRPWRKP
>gnl|bykdb|A0A2V7GJE5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=342 residues).
MSKFFKALEQAEHDRAVREQARRPEGKPAAAPPPTPGASREVSSATVAAPAAPPAARPAEPARDPADRRSVGRVWTAEAP
RPKDRAEGPWGEIDEHLVSLLNPTSPDAEQYRALRHAVEQLHRSAGLTALAVSSPTVGDGKTTTAINLAGALAQDPEARI
LLVDADLRRPSVGNRLGLRNSRDRGLVDLVLAPDLTLDDVVRRRPSYNLSVLAAGRAAAAPYEVLKSPRLGNLLDQARQQ
YDFIVLDTPPIVLTQDCRVISKWVDGFLLVVGADRTPAKLVEEALNRMEADKIVGFVFNDDARSLSRYYSYGYTAKRHEE
EGAGWRRAMTRIAGSFRQRHSF
>gnl|bykdb|A0A2V7I866 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=235 residues).
MLDGLIQRLTSKPELLHEYAALRSGLNLGSSSGGCKSVLVTSAQPLDGKTTIVLDLGLTAMLSGRKVIIVDADLRKPRIH
EALELPNTLGLSDILGARTHAREVIQTVKAMGGNPLDDRSVSVITAGLGGAPLTETLGGPTLKDAIGELTRAYDVVLVDS
PPVLAADDALLLAPLVDGVIVVVHTGIVTERDLKLTKARLEGVGGRVLGVVMNRFDPRVHGPGAHPYAARYYERG
>gnl|bykdb|A0A1F7RIE5 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RBG_13_48_7] (length=248 residues).
MNQLVVKPGGRSLISEAYRSLRTNIQFANPIYFSKEILFTSVGPNEGKSTTVANLSATLALMGNQVVMVDCDLRKPVLHK
IFGCSQSSGITNILADSHSIDENFLKTCIQETRIPNLHLLASGSIPPNPSELLGIKRFDQIMEILRNLYDYVIVDTTPVI
GITDSCVLASRIHRVMLIIDLKSTSKDMVLRSKKLLENVGAKINGVVVTKLKRNNFNSGYYNYYKYYYHEKGNGKPKTPN
RLENKHAM
>gnl|bykdb|A0A1F7RIF5 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium GWA2_38_11] (length=234 residues).
MSEECNECLVTLLDPRSPVAEQYRSLKTHLMGEAETRLISTFLVTSTIRGEGKTTTACNLGVTLANNPQHSVLIIDGDMR
IPSVHKMFGIKYEKGLIEYLRGEADLDSLLVPTHLDNLFVLPAGEPCSNPSELLASPRMRDLIKNEEAKGKGHYLIIDSP
PIISTTDSRILSGYVGGVILVVQSRKTPIDIINHGLSLLKNAQILGVVLNNISGISPYYSYIYSYAYGYAEYSK
>gnl|bykdb|A0A1F7S3V5 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RBG_16_38_10] (length=234 residues).
MSEECNECLVTLLDPRSPAAEQYRSLKAHLMGEAETRLINTFLVTSTIRGEGKTTTACNIGVTLANNPQHSVLIIDGDMR
IPSVHKMFGIKYEKGLIEYLRGEADLDSLLVPTHLDNLFILPAGEPCSNPSELLASPRMRDLIKNEEAKGKGHYLIIDSP
PIISTTDSRILSGYAGGVILVVQSGKTPIDIINHGLSLLKNAQILGVVLNNISGISPYYPYNYSYAYGYAEYSK
>gnl|bykdb|A0A1F7SPN8 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RIFCSPLOWO2_12_FULL_38_15] (length=224 residues).
MFLDPRSPVIEQYRSLRTHLLAESGNKSINTFLVTSSIRGEGKSITSCNLGIILAHNRQNSVLLVDGDMRIPSIHKIFGI
RGNRGLVDYLKGESELDSLIVPTKIDNLFILPAGEPQTSPSELLATSKMTDFLRMEESKGKNHYVIIDSPPIISTTDPRI
IATYVGGVLLVVQAGRTPRDVISHGLSLLKNVNILGIILNNISGISPYYPYRYSYAYGYVEYSK
>gnl|bykdb|A0A1V5FRG6 [Bacteria] Bacterial tyrosine kinase [Candidatus Sumerlaeota][candidate division BRC1 bacterium ADurb.BinA292] (length=302 residues).
MAKVLDALEQARRERLRKLRAAGARVEAPLNPTEPGDDLELELVEAPQRESALRPGQRPVVAPAAHPHIAPEIVALHASD
SPVAEQVRQIRTNLETVLAKLTARTIVITSPVSGDGKTLVAANLATILADDPRTRVMLVDADLRKPDQHRLFGVKGSPGL
AEYLRGRHELADVAVGTSIPNLDFIPAGFPPDKPTVLLSGERMGELLKTLEETYQWVLFDTPPMLPVTDASLLARHVTGL
ILVVRVGSTTRGAIERTQEMLAETHLPILGCILNDFNDHAAPGGYYHKAYGRAEAVAADEQG
>gnl|bykdb|A0A353GLB1 [Bacteria] Bacterial tyrosine kinase [Candidatus Sumerlaeota][Candidatus Sumerlaeota bacterium] (length=560 residues).
SKSERPLNAAPVAPVQPIAALIPEITSARKKTPPDEGPQQPDNLNVEIKDLMAEIFAQPTIDIAPTAVREKPEENSQVPD
LQAEIEVNIQSVVQDETSFFSQVKEEIETFVPDDPEPTVSLPNVKQNASDVSARFQADDTLPPFDVTPPIVQAQEEVSSA
ADLYPTLDFEVPKVTATVNSAPIPSGTVSEAPDPPSESEKVVAAAPMTIPEASVPKVPTPVTPPVTAARQAEPVFVLDPE
PVIPPAKPEPLPTQPLFPNQLETNASVPVAPTIPPPESPLFPNSEKRDALSGGRERHRLTPKRTKGEIPVPGPDPDPLSI
QRITVVHPRPDKRVLSFYEPKHHICEEYRLLGKNLLHTFANTGEITRRGKVVTLTSSIRGEGKTLTSINLSLNMADDLKN
RILLIDGDLRHPKVHKYLGLPGQTGLNDLINSADPKSILEDCIVRTESGLHCLFSQATRENPAPMLDTPRMSEILELLRD
RYSVIIIDTPPVLLATDSLVLGSRSDGVLFILRARKTKREQIQEARQRIARLEIRMLGYVINNVKTFLPKIWSRYYYGNY
>gnl|bykdb|A0A081C5E2 [Bacteria] Bacterial tyrosine kinase [Candidatus Vecturithrix][Candidatus Vecturithrix granuli] (length=237 residues).
MARHRSSRKHRDLNIIWEEGKHSMAAESYRTLRTNISLSQVDNPIRTLLVTSCIPREGKSTTVANLGVTFALAQQKVLII
DADLRRPILHRLFGIPNVQGLTHTLSDTVEYDQVFTPTKISNLWVVTSGIIPPNPSELLGSKKMKAFLERAKQQFDMILL
DSPPISSLADASVLGSIVDGVLFIVKVNMANRDLIQKAKEQLTTVGANIIGVVLNDVDVKRDGYYKYYYYYNYEYYG
>gnl|bykdb|A0A2N1PQJ7 [Bacteria] Bacterial tyrosine kinase [Candidatus Wallbacteria][Candidatus Wallbacteria bacterium HGW-Wallbacteria-1] (length=690 residues).
MDPFSQRDNQQFKEFTLHDYFHVIRKRYLVVLAVMVLGFSFTLVFTLRQKPVYRASGSLEVRASQSYYQTDSIRLLAFSL
NTYAKVITSDELIREALENTTSKMTVAEVISGLRVNQEPGTFIINLTLQGHDQSSLATVLNSLMDALVRRTKTEHRRKIT
DAIANLRDQMGDIEANLRTSEKELKEFEALRGIAGEKRRYEEIQNKILELSKQLYQTTLDREQTALTIQSMKNRLRSVIG
TSGEINTQSGGGPGIAESVVRLIEGLARERGSLLRIYKPNHPKVLELDRRIDKLRRGEGEEAQGPTADYRQKMDELSFAL
AGLEIREKTLKSLIESERGKLSEAPDEDLVYIQLKRKLETAQKVYDSLVGRYSEINVVQSTLKAMAVIVERAVDPRRPEY
SRMSVSLFLALISSFIMGIALTFLIEHLDNTIKNHEEAESILGYQVMGLVPEIAPASARNLSTSDSPASFMDLKLVTMHD
PMHIAAEAFNSLRINMKFALTDRPQKTIIITSPIREAGKTLVASNLAISYARSGLKTLLVDVDLRKPMIHYVFNTDNIRG
LTNFFMDELTVDEVVVNSGIRNLDLITSGLLPDNPVELLDSRIFDQIIHALSTKYDHVIFDCPPLLGFPDSLLIASKMDV
VLYLVSLRNTKVQQARAGLKLLHNAEAAVVGLLCNRVKEDELGGYYYRYS
>gnl|bykdb|A0A0E9F2I6 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia trachomatis] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAITSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIESGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIIAQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVVLNKYDIQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A0E9FNN9 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia trachomatis] (length=235 residues).
MAKKKRNQFDVDEIYRGLRTNIEFSQMDDKIQVINVVSTAPNEGKSTVSTNLARIMAAKYKNVLLIDCDLRNPSVHKLLH
ISNRSGLSNIMSQFKEETPVREYDGVQEHVFPNGETLSVITTGHKVPNPSEVLGSRRLGAFLNQARKSFGYIILDCPPIA
VSSDSIPVCNVSDGVLFVVDSKTADKRKVKSAINDVQRNGGNVFGIVLNKVEEFSDKHYGYGYGYGYGQEDKDNA
>gnl|bykdb|A0A0U0XQN3 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia trachomatis] (length=261 residues).
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADAINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A1X6W5W9 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia abortus] (length=230 residues).
MSRLDSKNRPIIADINKKSPISEAYRTLRTNIDFSSIDHQIQVIMVTSPGPGEGKSTTTANLATVYAQAEKKVLVIDADL
RKPTMHQTFVKTNRWGLTSVLAGQSPFAKVIAKTHIDNLDLLTSGPVPPNPSEMLSSKRLSALLEELRTQYDVILMDTPP
VLVVTDAQLIAAKSDGVLMVIDSGKVKRESALKAKASLELVQARMLGVVLNNVDQRRNEDSYYYYYGTQE
>gnl|bykdb|A0A136K9F1 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobi bacterium OLB4] (length=752 residues).
MENNPTGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVYILTATNYYSTTTSIKINKPQESILS
SSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAKFILDTLQTIEDKSALYYLYSDPENISQGFRTVESMAKLLSDIVAID
QKRGLDVVTLVAESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASLEDFQKRSGLINL
DVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVTFLEGELSGKYVTDLQAKISELELQKSIELSNT
QTQAVRDKIIGDYEQRLQPLRNSLNEKVMKLEEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSL
LPSQALELAKIERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGVLIGLGLGFGYAF
GRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGGSPDELVVLNKSTSTAAESFKALRTRVQFSKLEEKPLKSILVT
SSIPGEGKTFVSSNLASSFAIDNKKVLLLDCDLRKPRLHNVFAADRFPGLSDYLFSNVELEDIIRDSQNENLKFITAGTI
PPNPSELLGSVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSANTVNNINPRNFL
GCVLNDFNVKGSYGYYYNYYYYYSKPEQKANA
>gnl|bykdb|A0A136N8H5 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobi bacterium OLB5] (length=428 residues).
MKEGAQSNTPDEMRSLTYKYFETKIVNNQNKIKEGLLKNYMNKYQEKFNKLPAQSIEYANLERERLANEKVYLMLLEKYQ
EALINEESQPNNVKIIDYGKVPKAPSKPNRFLIITIGLLIGLGLGYGFALLRNILDVSVKSPEDLENIGISLIGWVPTFM
REPKAGRHTHTEQELVLAYNSDSVPAEAFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISSNLAASFALSSRVLLL
DCDFRKPRMHNIFNMKRYPGLCDYLFGTVPIEDAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIKPKYDYILI
DSPPLATVTDAELLSSYVDGTVVVCLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYYYYYGSEKGK
EGASATNGKSSNGVNNNGNLKEKTIKPN
>gnl|bykdb|Q3B4U4 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobium luteolum] (length=763 residues).
MIVLMVGTLVVAMLFYLFKTPEYHAVSVVMIKEDKQSNDLLQTILGPEAGMDINASKKDIALFKSMPIARLTIEQLERNL
KGKPLELFGSRDYTSPLMALFTKLQPSSIGNAFPSETDGLSKEELLRQRCLLLTKRIRVEPVKDTNMLNISVASPFADEA
ELLTNTICEVYRQADISRNSEKYAQANSYIAKSLVEQQSKVDEADRALSLFMTHNEIYEVSGNTQQLLDKLVEADAQYNT
IQAEYHTVGNTLRFLEQRLSESDKAIGSQIEQTVNSKLGAIMDEIRGLESSYVALLKQKGADDPAVRAAKVRLEEVKSRY
ATLQRSQIAGEIGYAGRAKKFGFDMVSEKLQIERKLNELQFRAGELSRIRQYYEQQLSSLPNKQQEYLKLERDRNVAGKT
YAELKQKFDETSIFLGSEVGGVSLIGAAFRPFFPESPSLLKSLLLGVLFGGMLAIGYAYIEEAMDGTLQDECLYDEIGLR
PLSVIPTVGSARNPAVPPSGSSRMLSHVGNSFGKLLPDASSRQSPSGREDAAQLIPLITDNLTSSFAESIRILRTSIQYS
RQGSPPQSILISGTAMWEGKSTVCLNLGMAYALVGKKTLIIDCDLRRPSQHVKLNCLRGPGLTDYLLSSDGDSCVPNIQN
TRMENLFLLSAGLNVSGSSELLASKKMQGLLSVMRKRFDCILLDCPPFFLSDASQISALTDGVVLVSRLQYTERKMLQSI
IADPAVKDALLGVALIATPELSRKGYLGKYGNGVYEEDPLLLT
>gnl|bykdb|A0A0M8JPC7 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolinea thermolimosa] (length=539 residues).
MDIRPYLAPIFKWWWLLLAAAALATGTAYFILRDQPAVYTARTTLMIGRTLLEANPSSNDFWLNQQLSSLYSDMAYREPV
QEGVKKALGMTWLPKYVVKTFGNGQFIEIDVIDTSPERAMHVASELANQLILVSPGSKEVNSNNEAFIQEQLQKLQEQIV
ATEKELVARQDSLGGLTSAHEIEQAKAELRTLEDKLSLLRTNYANLLSSSKENITNILQVIEPASLPVRPTGPNRYLIIA
LCGMAGLVLGAGCAYLLEYLDEAIQNPEELARLIDAPIVGYISDLGRKANASLYVARHPRSLMAEAFRTLRANIELQNLD
NGPLALLITSPDTGDGKTSVAANLAVSFSQGGKRVILVDGDLRKPSLHEFFDISDRRGLTDVLQGKLSVEKALRTWDGGG
LRLITVGDEAVLPDLLLTAEKVENLLCELKPLADIILIDSSPFLVSDAMIFAAKVDGVITVIRPGYTSREMARVMKERIA
MAGGKIIGVVLNRIPLKRIGYYGGYRYYLPYGYYEKKKKREEDEDKKVPKKSELTFSGK
>gnl|bykdb|A0A0S7BVT9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Flexilinea flocculi] (length=254 residues).
MLTMDRKLLTNFFRKNQKINDQNIRSLKKITDENSPFQFVEAYKSLRTNIDFVSVNKRYQTIEITSAIPKEGKSGIAINL
SISFVEIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLTGCDLYASILHTKFHFDFLPAGLIPPNPVELLGSRQMGE
ILCELRNEYDFIVIDTPPVSLLTDAVTLCQFVDGIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDYVVPKDSSQS
KNYYNNYSDYYQHK
>gnl|bykdb|A0A160T936 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Promineofilum breve] (length=215 residues).
MALVTISDPRSPASEAYRSLRTNLSFYSLDAPLRTLVVTSPAAGEGKSSTVANLAVTMAQSGRRTVLVDCDLRRPTLHEL
FGLAMTPGLTSLALDETVDLPLQETSVENLWLLSSGPKPPNPADLLGAARMGRLIDQLLERADFVLFDAPPVMAAADAAI
LGAKVDGVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNAPQDRSMREYYG
>gnl|bykdb|A0A1F3AZM3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolinea sp. RIFOXYB12_FULL_60_12] (length=584 residues).
YYAYLDSQQLLQTYIQLLTTEKVLNAASEKLGYPVYAGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEE
LQAVRYLTSEQNLQSQIDQVQSQITTMQTQINDISEATVQDQLVQVKAQIEPLQTQVTTLETEIADLQKNRYPTEEENAQ
LAEKEATLAQVKPILTLYQQLYTNLVVLGQPVDTGTNTSTRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQV
EPAVASTSPISPRPFQSTALAAAVGLMLAAGIAFLIEYLDDTLKTMEDIERVMQLPVVGYIAEIQYESGSDESLYVTRQP
RSPVSEAFRLLRTNLEFAGVDRPIRRLLVTSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFLGLSNKVGL
SDLFRGVVAVRMVSQQVQDVETVSVLTSGSLPPNPTELLASVRMEQILQEAEQDADIVIIDSPPSLVADVQVLAGKVDGV
ILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRIPRGRSDYYGGYRHYSPYYSGYHYYHSMDGQDLKPSRMRRLFGKL
SPFNHNGHKKVEAGVVEENVIEKP
>gnl|bykdb|A0A1F8N3P4 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_13_56_8] (length=221 residues).
MSDNPDLVTLSDPLSPISEAYRTLRMNLQFAALDSPLRSLLITSATPGEGKSTTLANLAVTMAQVDQRVIMVDCDLRRPC
LHTFFGLPNNVGLTNMMLEDQALDDPPLQSTRVPGLHLLASGNLPPRPPDLLGSERLERVIERLLAEADILIFDAPPVIA
VPDAVVLSTKVDGVVLVLNAGETKREHAQHAVERLNRVNVRIVGAVLNNVPLDATLHRYYR
>gnl|bykdb|A0A1F8PQP8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_52_11] (length=554 residues).
MELRTYFRPLLKWWWLLLAAGLVAAVSSFVVMGRRPLIYQSRTTLVVGSSVYEANPQTGDFFLNEQLAGFYADLVQRTPI
QLETMKALNLEWLPSYSASTIPNTPLIEILVNDTDPSRAQAVANELATQLIKQTPTNDPVNTERRGFIENQLNLFEADIV
QTQIDINDKTASLDSLTSARQIAETQDDIRSLEQKLASLRSSYAALLASSDRGAGNTLRLIEPANLPGRPISPNTFTMVM
LSTVIALALAAAAAYLIEYLDDTLKSPDEVTKLLDIPVVGFISEVERGKSLEYYITNQPRSLIAEAFRSLRTDLEFSSVD
KPLKTIYVTGTEVEAGKTSIAINLAIVIAQSGKRVILMDADMRRPNVHRVLSLTNQKGLSDVFRGTIDIYNATIPYKEGN
IFIVPSGSPPPNPAELLSSKKMDQILESLKKVADVVIVDGPPFLVTDAQILASKVDGVLLVVRYGFSRKNAAISAVQQLK
RADARAIGVVMNRIPRTASGYYGYGMYHSYPGYYIAEEDGATQPSITDRLKPPRKSRPKDKSTGDALNLEKTES
>gnl|bykdb|A0A1F8QKW6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_57_11] (length=562 residues).
MEIKQYLEPLIKWWKLILVACLLAGISSFLIISRQPPTYQTRVSLVIGRAVYEPNPSGGEMGLAQQLAAYYANIAEREVI
RNATMTALNLRWLPAYASQAVPNSQIIEITVTDTDPVRAQAVANELANQLIKQSPSNPDLKEQKRQEFIRQQLELLETQI
QDTQEQIAQQENEMGTLNSARQIAEAQADLTAQRQKLTTLQTNYATMLGTSLGRASNSLNIIETAALPTRPIGPNRGTII
LMSIAIAFMISAGAAYLIEYLDDSIETPEEINRVMKLPVIGFIPEIDNDVHKATIVAEKPRSVVAESFRAVKVSLDFGQV
DVPAKSFLVASVSKTEGKSMIASNLAMTYALSGKKVFLLDADLRRPSLHTYLDLPNAKGLTTLLLHPEKSIQQCAQSLPI
GNLSVITAGNSVENPSDLIGSQRMKDILLELSERSDYLIVDGPPVLVTDSTILSTAVDEVLIVVGYGLTRRSEAAVALKR
LESAGAKIGGVILNRIPRNNRAYYRLYHYDYGMPAEDTRSIKLGKFHFPMKFNRPVNKKKKPASHDTSDLGDQVASRVDK
TI
>gnl|bykdb|A0A1V5YJ40 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium ADurb.Bin180] (length=231 residues).
MTDKTASDLLVTLSDPRSPISEAYRTLRTNLQFVSLDKPLRTILVTSAGPDEGKSTLIANLAIAMAQGERKVILVDCDLR
RPSLHKLFGLGSREGLTSMMVAEGGSAEPPLQETGVPGLTLLASGPLPPSPSDLLGSRRMDAVLATLKERADVVLLDSPP
VVAVSDAAVLATKVDGVLLVVSAGHTRREGVQAAKAKLEKVNANLLGAVLTNATMDTSLSRYYDAREEVSG
>gnl|bykdb|A0A1Y6K3L6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Brevefilum fermentans] (length=635 residues).
MDFRQFVNIAKRWIWLALVGALVAGGLGYYISSQETPLFQASTRFVILRAATTGYDYYAYIDYQQQIQTYSELLTTDALL
NQASEELGYSAQDVTASASQIADTQFMRLTVTHPDPVKAAEIANVLVKVLIDQNERLQSVRYEATERNMQQRADQALEQI
EILQAQIDQLSTASVQEQLTQVESEINELQEQIFALETQIVELETKISEFNPLFATEEQKAQHEANRTRAAELEAEVKQL
TPILALYQQIFTNLTVLGRVPDSSTNTSIEISQLQTNLNLYQQIYINSISSLENLNLTRAQNTPNVIQVEPARIPKKPIS
PKPMQDAALYASVGFLLMAGIAFLMEYLDDTIKTPEDVKQILGLPVIGLVADMETGRSKHKGQSKGVFVADQPRSPISEA
FRSMRTSLEFYSVDQQLQMLIVTSSGPEEGKTTIASNLAVIIAGSNKKVLLLDADLRRPNVHQRLMIPNRVGLSDLIRGR
LEINDVIQFSTEIPYLNLITSGSLPPNPAELLGTQKMLSILEDLRAKFDMIVIDTPPAIVTDAQILASKTDGVIYVIRPG
KTRSLVARTPLEEFERLGANVIGVVMNRIPHNRGYYYGGFEYYSPNVYGSEKYYVDSHNDQPFIPIQDIETEPKK
>gnl|bykdb|A0A2A6RLU6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Viridilinea mediisalina] (length=222 residues).
MSSNGSTAETTLVTLRDPGSPAAEAYRTLRTNILFSSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMAQAEQRVLVVDCD
LRRPSLHTLFGLPNEQGLTSAILAQNDDLPPAQATVVPGLKVLTSGPLPPRPADLLGSRRMAAMIERMSANADIVLFDTP
PVVAVTDAAALAPRVDGVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGAKQERGYTY
>gnl|bykdb|A0A2E0ZA41 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=214 residues).
MDLVTITNPRSPLSEAFRTLRTNLSFYSLESPLRSLVVTSPVMGEGKSSTVANLAVTMAQSGRKTVLVDCDLRRPSLHTL
FDRQVEPGFTDAILHNDEPVLQETAVENLWLLTAGTKPPNPADILGTPQVDQLIARLQEKADIILFDAPPVNAVTDAAVL
GAKVDGVLLVLSAGKTRREHAERAKEILEKARVNIVGATLTNAPVDSSMEAYYG
>gnl|bykdb|A0A2E6YFL8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=526 residues).
MQNSNITMPQLNDINTTFRRYVGIFLNYWWVFLILPAILGIGTYFYSSSQDTMYEATSTLLVEQRRTGGVAGVSDFTLSE
DLARMYMKQILSTPFISRVVEEPDVKYNVDELKLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFINYTVELRLA
EIAKIQTAALSQGLPNVQELVASNFTTLDSLSLLEPAAPPKSPAFPRTKRNTAIGVMLGFLLATFLSVLLSSITSTIKDV
ENIYNQFGVPTLGNIFRWGSQNDQNEVLTHTDPSSPYSEAFRHIRANFQFATANKQPPLFLITSPGPGEGKSTIISNLGA
SLAQNGKKVIILDADLRKPTIHRRFNLKKREPGLSTFLSDKDLTPSEIIMNPGIPNLDIIPSGPVPPNPSELLGTERMKN
LCNDLHSKLNYDYVLLDSPPILVVADGSVLASIATAGILIVDGFSTKIGSLQSAVNTLNGTAIETLGIIVNKLKNSRFSY
GYRYPYYYNYYYYQSYYQYNEAGEKTEKQEKRSTKSTIKKLFRWSK
>gnl|bykdb|A0A2H3KNY1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Chloroploca asiatica] (length=222 residues).
MGANGSSPETTLITLRDPGSPAAEAFRTLRTNLLFSSLDRPLHTLLVTSTAPDEGKSTTLANLAVTMAQAEQRVLMVDCD
LRRPSLHTIFGVPNERGLTSAVLAQDDGPLPIQPTSVPGLHVLTSGPLPPRPADLLGSRRMGALIERMRSEAEIVLFDTP
PVVAVTDAATLAPRVDGVLLVLHAGQTRRDRAREARRLLEQVKANIVGVVLNGAKVERGYAY
>gnl|bykdb|A0A2M8PN31 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Thermofonsia Clade 2 bacterium] (length=330 residues).
MKKPNARIVDRAVPPMFPSSPRHVLNIGLGFIGGIGLGLVCVFGLAFIDDRVKSTVDVENSLNINLICLIPKVARKNSFD
KARIVQNNMEPRAAESFRSLYSSIRISDVGRHSQVILTTSTLPSEGKSFVATNLAYTFASHGERTLLIDGDLRMPAIAQS
LQMEDEVKAHGGGLVGYFEGSTSWENMIVNEIAHNLDMLASVKNASVPSEIANSSHFIDIINVLRQTYDRIIVDTPPIGV
VSDAMALVPAVDACLYVVKHKGVKMRSIRDSIRRLRDVHMPILGAVMNQVDKVGSGYYHNYTDKNYHKYYGAYTPQKTQN
PKRVSKPKKK
>gnl|bykdb|A0A2M8PT60 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=220 residues).
MANAKLITLTDPRSPASEAFRTLRTNIMFSSVENPITTLTVSSPAQGEGKSTLIANMAVTFAQGGNKTILVDCDLRRPSQ
HEIWDVENERGLTTMILEDAAISSPPLVETEVDNLQLLPSGPVPSNPADIISSQRMNEVIGVLKARANYVLFDSPPVLAA
TDAALLASKTDGVLLVIRAGHTRRDQAARARQALERVHVRIVGAVLSNAPREDSGEYYGL
>gnl|bykdb|A0A2N2MQC3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-5] (length=300 residues).
MGKMFDVLQKLEREKTADQKKEEPAIVSDPDNQVLDNKIVSFFAPSSMVTEQFRRLRTHIIQPNQPNSPKTIVITSTLSG
EGKSLIAINLAIIIAVEMQSHALLVDCDIRNPSIARLFGLKDTKGLSNYLLGEAEIPDLLIKTSVDKLSLIAGGPLQENP
VELIGSERMKNLIQELKTRYKDRYIILDCSPLLATTEPTVLTEMADGILMVIKSGKTPRESVQQALRLLNKDKIMGVVLN
GMEYRTKALIQRHFGTNRYYHDYHYSKTHPEPDNWEKAALILKDIKMLLLKLIPHKKGER
>gnl|bykdb|A0A2N2PFW9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-1] (length=341 residues).
MGRVSESKASLEREITSVEADITRTQDALNAVTDDNQRMRLETSLAQYRSTYSSLLSSYQQIRLAEAQATDNIAIAKPAR
VPEEPIRPRTMTNTLLAAVVGAMIAVGAVFLIEYLDDTIKTPDDVARVSGLSTLGAIARLKETGGTRQLSEGKSTTAANL
AVVMAQTGQRVVLVDTDLRRPVMHKVFGAANNTGLTSALLNGDQVVLDGHLQGTEVENLSLLTSGPIPPNPSELLGSHRM
ARLVEKLVGQADLVIFDSPPVLAVTDAAVMGRQVDGVLLVVDAGQTREQVVAQAAAELQKTGANLLGVVLNRLDSRRGGY
YYYYYYYSEEEGGQRRRSASR
>gnl|bykdb|A0A2N5K785 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=224 residues).
MTNKATPNLSQLVALRDPRSPAAEAYRALRTNIQFSSLDKPLRTILTTSTAPDEGKSTTVANLAITIAQSEQRVILVDCD
LRRPTLHTLFGLPNEEGLTSLMLQEGGRVPLQKTEVPGLMVLTSGPLPPRPADILGSRRMEAVIAQLREHADIVLFDTPP
VNAVTDAAVLATKVDGVLLVFRAGATRRDRAGEARRLLDKVNANIVGVVLTDVKQEDGYSYYGS
>gnl|bykdb|A0A2W4MA80 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=222 residues).
MSLSNGTSPLIAIRDPRSPAAEAYRTLRTNIQFTSLDRPLRTLLATSTAPDEGKSTTLANLAVTIAQAEQRVILVDCDLR
RPSLHTLFDLSNESGLTNMILASEDTPPPLQETGVPGLSLLASGPLPPRPADILGSRRMEQIIARLSGMADMVLFDTPPV
IAVTDAAVLATRVDGVLLVFQAGKTSRDRARRTREVLEKVKANIVGVVLNGAELEQGYGYYS
>gnl|bykdb|A0A2W6B4S3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=520 residues).
MELRDLIRVAKRWVPIALIVALTLAIASYAFTKFTVKKVYTATVTMEVQAGVTGQSVPDPTISNLIVPTEAQVAAQGPTV
DQAMRRVQSTPGIAITPGEIAAIKASIQCKPNPDTSLFSCSASAHQAEVAALVANQLATVFTQGEQAFDQQRYQTVLTNI
RSSEAIARKNGDAALLSRLQGSEISVLVDAAQRASIVRITQQAQRPTSPSSPHPTLNAALAFLAALLLVLGVGFVSDRLD
DSVRGEEEIKELTGLPLLGIVPSIDMLKDRALSPNSLLFFTGKRSPEAESFRVVRTGIAFSRIDDPPRCLLVTSTVQAEG
KSTFASNLACAFAESGKSVILVDLDLRRPSLSKIVNTPMRGLTNVLLDQASSLESYLVAGALPNLRVLPSGPTPPSPAEL
ISSLRMAQVIQRLQTMADIIIIDSPPILAAADAAITAGLCDSAVLLVRPDRITRRGLTRAVETLNGVGVRVIGMVVNGVP
RTDADYYGYGNYYDYQAPAARGDGAKPVAITTDKKNAAGQ
>gnl|bykdb|A0A350FYF2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium] (length=585 residues).
MEINTYLRPLIRWWRLIVIVTMLAVIASAVSALLQPAAYVSRTTLVIGTTILDPNPDSGQIYIAQQLAGIYADIAEREPI
QQATMDSLGIDWLPLYQSKVVPNTQMVEISVTDTNPKRAQIIADELARQLMLQSPAIGGTETGDRQEFIREQLSSLQIQI
QETETKIEELQTSLVDLNSASQIANIETEIRDHTQKLNSLRESYANFLVNSQEGALNILSIVEPANLPTRSVGTSKLIII
ALAGLVGFSLGSGAAYLLEFLDRTIKTTSDVERIFNLPVIGYISEIYENGNNAAYVYENPNSIIAENFRLIRSNIEFFQI
SNPITTILITSPNQGNGKTTVASNLAISISHGEQDVVLVDADLRRPAIHNVLNITKNPGLSDVIRNKTDIDSVVRYWKED
GLKVITAGDIPPNITEVVGSKRIASILEELKEKHEIVVIDAPPLIIADSYNLASKVDGVILIMEPGQTSEEQAMTIKEQL
DRSNAHLLGIVFNKISEQSAHSSYDYQYRSLYSPKYYGDYISKSTNEPNTGSRSKKIMDFFEHGQLPPDMAESVELTITA
IKTQPKQIVERLRKSKKNGKNGKDG
>gnl|bykdb|A0A351G432 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=427 residues).
MFQKKICKPKWQMLKXALETREETRPYQPTPTLAPETLSQIQENRLDLQQKQGMLNLYQELYFNLLSSDSSGNPILTSGA
GSNQYQSTLALYQQIYANLLSDYEAVRLSRMENTTTVVSVEPATPKMQPIRPKPVTNTLLGSVAGLMLASGLVFLIEYLD
DTVKSPDELSRFSSIPIIGYLPSLNQSKLNGKNQSNVYVQENPRSPAAEAYRSLRTNIEFAGIANQTKTIMITSASPQEG
KSTTAVNLASILVQGGKKVVLLDADLRRPFIHRFYKFSNRVGLSEYFRGEVSLESTFNYVDPSRRLIAIPSGKLPPNPAE
LLGTEQMSALLQQLELISDYIIIDSPPLVVTDPVILATKVDGVLLVIQPGVTRISSVRASIDQLERAQARILGIALNNIT
RQNAYYYASYYQQEYYAPDEEEARSLN
>gnl|bykdb|A0A353H3Y9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=406 residues).
RYIDLRTNLETELANTDKQISSINARLAAIPTDTAGNAINPNDVATRAQLETSLSQYEQARSYLVSDYQQLMLSEVLSTS
TVVQKDPAVANPLPIQPQPMRSALLAAVVGFMIAAGVIFLITFLEDTIRDPEEVTRKWGVPVLGVISRYGSTATPIITVS
QPRAPVSESFRSLRTNLQFASVAAPLKTILVTSPSPEDGKTSVVANLANVVSQNNRKVLVIDGDLRKPRIHKIFQLPNRI
GLTDYFLHAQERLNGVIKKTEIKSLFVITSGNLPPNPSELLGSERMQEVVETLSSHFDPIFIDTPPLLAVTDALVLAPRV
DGVILVIDPAKTKRAALQHSIEQLKQVNANLLGVVLNNVKISRSHYYYNRDYYYGKPYGKAAEESGGSGADTDTTELELQ
KPALRD
>gnl|bykdb|A0A356DVN8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=595 residues).
YSYLNNQDIVDTYAQLLTTEELLFQASEALGFPVRKGQATAKQVDDTKFVVLTVKDPDPFKAATIANGLVSIMISQNENL
QSVQFAAAEKNLQDRIDQAEEQIATLETQISQISDEMLQSQIESVQLQMDDVQAQVNNLKTDMAQIYPGSLAVENIADLK
SLTEDLESLTEEEIAQLTAYQTKLDEITPILELYQEIYTELVVLGQTTGASNQNPTDLDRLKTTLNLYQQIYISSINNLE
TLKLAKAQNTPTVMQVETAAKPTVPISPKPTETALLGAAIGLLITAAIVFLIEFLDDTLKTPDEIKAILEVPVIGFIGEL
KQSSKKGEDALGVYVAKNPRSPVAEAFRSLRTNLEYSSVDNPVKTVLVTSSRESEGKSTIAANLAIVEAQSGKAVVIVDA
DMRRPKVHLQFSKPNRMGLSDVVTGKLGIDDVLKTYDQVENLSIITCGTIPPNPAELLGSERMSQTLKDLKMRFDVIILD
TPPMIVSDAQILSSKVDGLVYVVIPGQTRAITAMRPLEELRRIESKVLGVVANKIPRNRDYYYGGYNYYSPYSNHYSYHT
ESIVPNSEIDMDSKKVTPLGSVFEKYQRRDADKQN
>gnl|bykdb|A0A363U3C3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineales bacterium] (length=589 residues).
MDISVYLRPLLRWWRLIMIVTVLAVVASAVSTMFQPEIYVSRTTLVIGTTILDPNPDSGQIYIAQQLASIYADMARREPI
QQATMEALGIGWLPQYQAKVVPNTQMVEITVSDTVPKRAQIIANELANQLMLQSPAIGGTETGERQDFIKQQLDSLKVQI
QDTEKNIEELQKSLIGINSASQIANIEKQINEQTQRLNSFRENYASLLANSQEGALNILSVVEPANLPSNPVGTNRFFII
ALAGLVGFSLGTGAAYLLEYLDKTVKTASDVERIFGLPVIGYISAITDDEDSGTYVEKNPDSILAENFRLLHSNIEFFRV
SNPIRTILVTSPNQGNGKTTVASNLALSISHEEQDIIIVDADLRRPAIHNALKVPKNPGLSDILRNKADVKSVVKSWKDD
DGIKVLTAGNIPPNVTEVVGSKRIAMILSGLEKEYELVIVDAPPLIISDAYNLASKVDGVILVMEPGQTTEAQARTIKEQ
LDRSGARVLGIVFNKVTEEMAHSYYDYRYQSLYSPKYYGDYISTASREPNTGSRSRQLMDFFEHGKVPADVAVEVEHAIT
AIKTQPRKTMERLRKSKKSGTGRKNGKNG
>gnl|bykdb|A0A399ZSS8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=222 residues).
MTNSLITISNPRSPIAEAYRTLRTNLEFSNLDKTLRTLLVTSAGAEEGKSTMLANLAVTIAQSGKRVILVDADLRRPTQR
QIFGLKDNAGLTDMARDDAARAQPPLQDSGVPNLQVLTSGQLPPNPAEILGSKRMSEILAALLEQSDIVLLDAPPVLAVT
DAAVLSGKVDGVLLVVSAGKTKRENAKKAQAQLEKINARIIGVVVNNVQAEKGASYYYAESN
>gnl|bykdb|A0A3B9YZ03 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=248 residues).
MTSSSGAPVPSGPESAVKGTPDVIVYTDPRSPAAEAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIA
FAQAGMRVVIVDADLRRPAQHLRFNLPNSDGLSNLFGGATPRTPTLQPTAVPNLHVLTSGTEPESPADILASSDLDHIMD
HAGRDADLVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNAPYNERTFASYYE
ESPGRSAS
>gnl|bykdb|A0A3C0ZZ70 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=230 residues).
MIMANNRQESLITISNPRSPISEAYRTLRTNLEFSSLDKPLRTMVVTSAGPEEGKSTTLANLAVTLAQAEKKVILVDCDL
RRPSQHEIFEVENGVGLTTMVVDEEAFKNPPLQETPVPNLKLLPSGPLPPNPSELLGSRRMEEIIATLRERADLVLFDAP
PIIAVTDAAVLASKVDGVLLVINAGTTKRDHAQRAKALLEKVNARLVGAVLNNVRMDISLHRYYAEQKQA
>gnl|bykdb|A0A3D0CW09 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=222 residues).
MTIQGRAALITLTDPRSPVSEAYRSLRTNLEFASLTGPLRSLVITSPGPGEGKSTMLANLAVTMAQAGKKTIVVDTDLRR
PSQHELFGLDQEPGVTTMFMDPALQSAPPLQATEIEGLWLLASGPKPPNPAELLAAPQLRTIIEALTARADIVLFDAPPV
VVVTDAAVLASQVDGVLLVIQAGKTKRDQAAQAKTLLDQVRARLVGTALTNVKLDPKLQGYY
>gnl|bykdb|A0A3D0US14 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=215 residues).
MSLITLTDPRSPVSEAYRTLRTNLSFTGLDEPIRTLVVTSPAPDEGKTTTIANLAVTIAQGGRKTILVDCDLRRPTLHTL
FDLKPEPGLTNLLLEENGQPALQPTMVDGLQLLSSGPLPPNPADLLGSHKIDQIIATLLERADIILFDAPPVIAVTDATV
LGAKVDGVLLVISAGKTRREHAERAKEMLEKANVRIFGAALTNAPKDSSIGGYYD
>gnl|bykdb|A0A3L7VU47 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=225 residues).
MTNPVAASPTSTLIALSAPQSAAAEAFRSLRTNIQFASLDHTLQLITITSAGVDEGKSLVAANLAITMAQAEQRVILVDC
DLRRPALHSLFGVSNDTGLTSMLFANAGDAPPLQATSVPGLQLLASGPLPPRPADILGSRRMGEILQALRGLADVIIIDT
PPVLAVSDAVVLAPRIDGVILVMQAGRTRREPAKQARIVLEKAKAHIVGVVLNDAEMTQSSGYYG
>gnl|bykdb|A0A3L7X1Q5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=248 residues).
MTSSSGAPVPSGPESAVKGTPDVIVYTDPRSPAAEAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIA
FAQAGMRVVIVDADLRRPAQHLRFNLPNSDGLSNLFGGATPRTPTLQPTAVPNLHVLTSGTEPESPADILASSDLDRIMD
HAGRDADLVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNAPYNERTFASYYE
ESPGRSAS
>gnl|bykdb|A0A3M1DIE1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Thermoflexia bacterium] (length=219 residues).
MTQKPRLITLTDPRSPAAEAYRTLRTNLTFAGLDQPLEALVVTSPAMEEGKSLAVANLAVTMAQGERRTILVDADLRRPR
LHAIFGVSNDRGLTTMFVEPAAMANPPLVDVGVENLWLLPSGPLPPNPADLLGSRRMDEVLAALRARADILLFDAPPVIE
VTDAAVLGRKADGILLVMTTGRTRRDHALRAKEVLERAHVRLVGVVLTDVSVSRAHRYY
>gnl|bykdb|A0A3M1E8I5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Caldilineae bacterium] (length=221 residues).
NIQFMAVDHPTKTLLVTSPSLGEGKSTTAANLGVIMAQADLRTIVVDADLRRPSLHKIFQVPNAGGLTDLLRSPEMELAD
QLKRTEFENLQIITSGPLPPNAAELLGSQRMGHILKQLTGMADIVIFDTPPVLSVTDATVLAGRVDGVVLVIQAKRTRRD
AARHAVQRLQQVGATILGAVLNQSGKGSGYYYSYYTQTGARPVKQPRRAPQRRWWQIGSTR
>gnl|bykdb|A0A3M1EV88 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=224 residues).
MAVEEQAKLVTLSDPRSPVAEAYRSLRTNLEFSSLDEPLRTMVVTSPAPEAGKSTTLANLAVTMAQAGKQVILVDCDLRR
PSLHEIFGVSNTTGLTSVILDDTTSAPPLRETGVPGLKLLTSGPLPPNPAELLGSRRMADLIRALREQADIVLFDAPPVI
AVTDAAILASQVDGVLLVLNAGVTRREHAQRAKAALEKVNARLIGTVLNNVKLDTSLYGYYSAQ
>gnl|bykdb|A0A3M1M4P3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=224 residues).
MKREIPLVTLTHPRSSAAEAYRTLRTNLTFASLDKPIRSLIVTSAAPGEGKSTTLANLAVTMAQGDRRTILVDADLRRPS
LHRIFGLPNEPGLTTMFVDEASRTDPPLLETGVEHLWLLPSGPLPPNPADLLGSRPMEEIIASLLERADFLLFDAPPVIA
VTDAVVLSTRVDGVLLVVQAGRSRREHVQQAKQLLERVQARLVGAVLTNAPSDSVMGAYYTDEW
>gnl|bykdb|A0A3M1MN85 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium] (length=536 residues).
MNLKFLDYFSPIFRWWWLLIVCALVAGGVGYALVNPLPPVYQSGITLLVGNALDTPNPSSLEVEIPRRLTDAYAAMALRE
PVRDGVKKALGLDELPKYTAYTIPGSTMVRIEVTDTNPRRAQAVATELGRQLMAQSPGGTTRDSETQAFLEEQLHKIADA
ISETEQDIAAKQEEMATAEGASAILSLQADLDALNNKLATLQENYARLLASSQSNAINTLRVVEEATLPTRPIGPNKVLD
VAAATLGGLILATLGAYGIEYLDDRLKTETHIQHLVHYSLTGYIPTIYTQENPVTYLRKRPRSPAADAFRSIRNALGYLA
DAPYRTLLVSSAAAGEGKSTVAAGLAISLAQAGYRVILVDADLRAPSLHTMLGLPQKPGLSDVLQGKIPLAESIIMLENL
GIDLLTSGDIPDQSTELLASRAMQTTMAQLGQSYDVVVLDGPPFAVPDAVVLARRVEGMLWVIRVGYSRRTAVKYMQEQI
EQTLVNVLGVVINCGRGPRAHYYQVYGYHGYYQDGNGRERRKPAFRRLVENLRRTK
>gnl|bykdb|A0A3M1YX52 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=219 residues).
MGNTKLITLTDPRSEAAEAFRTLRTNLMFSSVENPIHTLLITSVAQSEGKSEVLANLAVTFAQAGHKTIIVDSDLRKPAQ
HEIWGVANERGLTSMMLEDTALAEPPLIKTEVEHLQVLPSGPLPPNPADLLSSQRMQEVIGILKARAAYVLFDSPPVLAA
TDAAVLGVKLDGALLVVQAGNTRRDHTARARDALERVHVRLIGAVLTNADRETAGSYYG
>gnl|bykdb|A0A3M1ZY58 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=220 residues).
MNKEAEKYLITLSDPRSPVSEAYRTLRTNLSFYSLDNPLRTLVVTSPAADDGKSTTVANLAVTMAQSGRKTILVDCDLRR
PSLHTFFGLPAEPGLTNMLLDDDEPPLQETGVENLWLLASGPKPPNPADLLGARKVDRVIERLKEMADVILFDAPPVVAV
TDAAVLGAKVDGVLLVISAGKTRREHAERAKELLQKAHVRLVGVTLTNAPKDDAISGYYG
>gnl|bykdb|A0A3N5NV84 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=269 residues).
MAAAIGLVLAVGGALLIEFLDDTVKTPDDLQRTAQLTTLGTISRVAGGEDKYRLIPAEEPLSHVAEAYRALRTNIRLSSV
DEPIRTLIVTSPSPREGKSTTAANLGVVVAQAGKSVILVDADLRRSSLHRFFALPSKEGLTNVLVQDELAVDGWLQETGI
DNLRVLTSGPLPPDPADLLGSKRMHHLIECLEHEADLIIFDTPPTIPVSDATVLALEADAVLLVVEAGRTRRGAIRRTME
DLQRAGAHVLGAVLNRVTSRPSKGYYYYE
>gnl|bykdb|A0A3N5PDS6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=233 residues).
DRPLRCLVVTSALAAEGKTTTVANLAVVIAQGGKRVVLVDADLRRPAVHRLFGMPNRGGLTDALVEEPAALNSFLRDTAV
ENLRVLTSGPIPPNPQELLGSQRMEDLLQRLQGEADVVLVDTPPSLVVADANVLAARTDGVLLVVNADRTRRVAVQQAAE
GLRQVGANLVGGVLNMVDIRRGRGAGYYSYYGYYSHYYGEEEGERHRGPRGWWRRLRRGKEAGSPRDGVSPAA
>gnl|bykdb|A0A3N5RU86 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=292 residues).
MELITVALAMAVGLSLSGSVAYVLEYMDGAIKSQDEIEVLLNTPVVGNIFEVKQGKNKQPFSIADNPRHPVTEAFRNLRT
FIEFTNRDKLHTILVTSAGSNDGKTWIAANLAISMAREGKRVVLIDADLRNPSLHQFFHEERENGLTDLFQGKQAVTDVL
KYNNKERVGLITAGELPQNTYELMNIKMMERILMELMDAVDTVIIDSPPFFIADSVLLSSLVDSVLAVVRPNHTLKQSAL
AMIEQIHRSGGNLTGVVINRIPFRQLKYYLKYPYNSLEKYHLASERMQKEPR
>gnl|bykdb|A0A426U8Y8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Viridilinea halotolerans] (length=217 residues).
MTTETTLVTLRDPGSAAAEAYRTLRTNILFSSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMAQAEQRVLLVDCDLRRPS
LHTLFGLSNEQGLTNAILAQGDELPPLQATAVPGLSVLTSGPLPPRPADLLGSRRMAALIERLSANVDMLLFDTPPVVAV
TDAAALAPRVDGVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGAKLERGYAY
>gnl|bykdb|A0A081GP61 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium sp. CACIAM 14] (length=857 residues).
MGGFPPSGAAGRFQAPYPDQPLQSPLTPTAEAQAGSGGLGGLVRTIRRRQTVFLLTFAVVTGALAINTLRQRIFSPVYQG
GFQMQISNPFEDKNGGGGGGSVEAIARTPLKPDVPSLIVLMRSPLLLGPVAQRQGVPLDLLAANLSINPESAAVENVLNI
SLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQAPAIEARVQKLSNEMLRFRERNNFVDPATAAGQILGA
RDGLVNQLRDLQNEQVQLDSQLQSIQSGKLQFSSSGAPTAIQQLGRNSVLVPGRANQNQGAEVAKGTPTPLDLLNQFEQE
LATAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAVKARLLSNLAQQDEINRQILLLNQNFRNNPQKLSEFENINQRLS
IAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGASPVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVE
KELQLPVLGLIPYLPLEPGVDIATSISKMSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVTVFAS
TLADLGLKVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDSSRKTTDLIQTIAENMDVLPAGPKPPDPAKLLNSSRCKEIM
DEIRALPGYDIIIVDAPPCLMLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKATGVDVLGIICNQVNFPSRLNDY
GYEYGYYYHYAYASASGYAKSANQGKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQQEDGSGASAATR
PPSEDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLRQRFGRGSQR
>gnl|bykdb|A0A0A2B4S6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Prochlorococcus marinus str. SB] (length=723 residues).
MLISDPLNNNKNNSANSIGGVFEQLALNSTDNDLPTLIELLKSPILLNPISKDYGIPFNKFSKSLKISTPGGLRTQSMAQ
GVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQSPKLEGKNKQVQKELSDFRERNQLIEPTVEGQ
ELKTRLDYLENELDNIKNERVKLNNLLNSIENGSLTAYGFKQAITTDLNLNERIPTEGVSFINLDLELLDQYILVKQKLA
IARTKYLEDSEIVKGLKYRVEQIEPTLKSNQISALISAREIIDKNIQNAKIKIKSLKEKFEKQPKLISEYKTLQQKALLA
AKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPVPVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKEN
LNLPLLAELPYIESFVNLRENNESIFNVEDKLNATKNEKSSESYLGYQRFFYQEAFRGMYTSIKFINTQNSLKILSISSC
IPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSI
PPDPTRLLGSDSMKKFIETIRSENKYDYVILDTSPILSISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKTNRPL
IGFVSNQIKKPKTFSKNRYYGYSNYSNNYGYNSNYISYYADNKIRDKFTKRNLTFENSKDNFLISKIKKFRNKVLDFISW
LDR
>gnl|bykdb|A0A0D6KL48 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix sp. PCC 7601] (length=485 residues).
MKLNTDTAVELTTLSQSPGVQQVLTEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTIGNSEYMPEQN
LQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVE
NQNVGNARVISEALVADKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIPQAEKAKGS
EGVGEVELPVLNNPYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRP
RQHKIWEQNNLVGLSNILVGQTELQTTSKEALMTLDIITAGTIPPNPAALLNSQRIATFIKEATQEYDFVIIDCPPLTLV
ADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSHKNGKVDASIS
KIRIL
>gnl|bykdb|A0A0V7ZGW0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocoleus testarum BC008] (length=681 residues).
MKVSAIIQRLWLPLLGLNGVIVGSVIMIATFSQKTWTANAQLILPDTTTNLDASLGTLGQLKEQGVAFTNELNPLKVLTS
IITSDDAIRPVLLSDPEKDKFRSLSSYKKLFKVKPTDQSTNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAR
EQFTQRQLKDAERNLQLVKSKLAQFKKSTGFVSDEEQTKNLVTAINTLRTTQTDVLAQAKATATRSQELSRTLGMAPQQA
INSLRLSENKEYQALRQKLTEVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQLNAVVPSADGIDANFGGNNFKDA
TIELIAQLIQVESESKGLQQQVLIIQNKLERLQTELKNISTLQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPN
LQVLDQPTVDPKPTSPKKSLIAIGGILTSVFASLALILFSESRNPLLKQKDLQDIELPLLARIPIFKSAPLGLTMESDAQ
IPFQRLASTISLMSLENHRLMVTSSTAGEGKTTVTLGLAKALMVLGFRVLMVDGDFRKAKLSRQFGHVMHPQSNDLPQPM
QISPGLDILPTAPNQNNKVMEFVARGGFEKYLNTIQTNGNYDYVIVDTAPVTSTSETALMAKVIANVLPVIRLGISDRYM
VQETIEQLMRHNANIIGLALNGIEQRSEGYIYKHDSSQVNS
>gnl|bykdb|A0A0V7ZMP6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocoleus testarum BC008] (length=675 residues).
MKKATKIAVRHWKFVLAWNKIILGIAVANIALLPRVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQQVNPLNVIS
SIATSDNVLKKVWEQDPQKTSYKQLSEYRGLFDVSPENDSTVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVIS
QSEFIQDEVRQAHRKLMDAQKKLNKFKEAGNVISDEHDAKQKVITINALNKSRVEALAEAKAAQAQTRILSARLSLPPQT
ALKSLQTKGTETSLSIREKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQEDRVSDNSVSSVAINPNLADRHIV
HKLILAESQAEAMSSKAQQLQIQINYLREQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLD
EPFVNNEASSPNIQLIILGAVLISIFGSVAIILLQERRDPLISPKDIQQKNFPVLASVPYMKGLDTSMGEGINEKVEFQR
LASAISLLHLENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQSLGYYGQSIGDLQLRPINVFEN
VDLLAMRVPEERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVALTSEAAIIGKIIHNILFVVRTGISSRNCFHDSVE
QLKRYRAEVIGLTVNDVDSHNEKYIYSYNVNQQIQ
>gnl|bykdb|A0A1B7WWU1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aphanizomenon flos-aquae WA102] (length=378 residues).
TKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPELPVSPKI
PLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQHGEKNPKNPQEGRQELPLLDDPYSPVSTSFE
MLQTNLGFTVSDKELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQ
LKNAVQEVSPLVKMLPAGKIPPNPVTLLDSQCMADLVEEASKDYDFVIIDTPPLTAVTDPLIVGKYVDGLLLVVRPGKVE
YSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGGKGERNKQNAEASVR
>gnl|bykdb|A0A1D8TTM0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens PAL-8-15-08-1] (length=676 residues).
MNRLIAIAIRHWKPVIGLNIVLSAIALYNASKVTEVWAARAKLIIPKSSSDLNANLGTLGDFRDRGVSFSQQVNPLNNLS
SIMTSNDTISQVWEFDPEKSLYPRLSGYKSLFDVSPEGESTIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQ
RSQFMRKELEQAAENLRQTQAALVAFKASSNLVSAEDQTREMVTAINTLTTEQAQVLAQAQASKAQVETLSARLELNPQQ
AIRSLSLGENQDYQFFRQELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYIFQARAAQPGVNATIGQESAAL
IRELILAESQTQAYYSQGKQIQTQIDQLGSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVF
EEPRADSKPSGPGRRPIALGTILASVFGSAAIVLFLESRNPLLSLQDLQAISIPVLRSIPPFKHLVLDVDPSFGTAIEFQ
RLASAVSMKPLKNRRLMISSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQRLGWDRYAMSEVPSTPVQIRP
GLDLLSLRPDEDKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVSLTSEAALMASVVPNVLLVVWLGKSNRNPFRDTL
EQLMRHRAQILGLVVNGVDTQPEGYLYGHKIAEVSS
>gnl|bykdb|A0A1D8TWE6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens PAL-8-15-08-1] (length=675 residues).
MKKVAGILNRHWTFLLVFNSLVLGASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSKLATKSHPLNMQAS
ILTSDALMSRLLESDLEKTDFQRLVQYKKLFAISPDQESTTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTR
VEFNKKALERAKQKLDQSQEALAKFQESSGLVNSKAQTEGLVRAITDLSISQAQAQAQAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQMKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLQAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLGHHHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEHSLATAEASGDYDYVLIDSAPVSMTSETALMAAVIPNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|A0A1D9G3S3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens JHB] (length=675 residues).
MKKVAAILNRHWTILLVFNSLVLGASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSKLATKSHPLNMQAS
ILTSDALMRRLLESDPEKTDFQRLVQYKKLFAVSPDQESTTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTR
VEFNKKALERAKQKLDQSQEALAKFQESSGLVNSKAQTEGLVRAITDLSISQAQAQAEAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLQAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLGHDHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIRNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|A0A1Q8BLE0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium 13_1_20CM_4_61_6] (length=211 residues).
MRAVSRIVITSPGPEEGKSTTAANLAIAFAQQGHRVLLVDCDLRRTRIHKIFDETNLPGLTSVLVGGETIASAIRQTRVP
GLNILPSGPLPPNPAELLGSAQMTALLDKLSENYDLLILDTPPLLAASDAAIVSRIVDGALVVVRAGRTERSALQTAVQQ
LATVGARVLGTVLNDPDAEVPKYARYYGYYYNNYYDYSNATEYSNGNGAKA
>gnl|bykdb|A0A1U7JBN8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Phormidium tenue NIES-30] (length=762 residues).
MPFPPSSTHEINGNGHGHAKPGFMTVMAPPSLVEQRDEVDFNQLVGVFRRRAGIFFGVAALSLAGFTLWHLSRPPAYSGS
ASLLVEPVTAVNTPGLETVTGAPSPSGSGLDYTSQIRVLRGPAVINPILAKIQQRYPDITYNSLLNGLNIVQEGESKVLR
ISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLTFLDEQLQEKWQEVAAIEGDLSEFQKRYDLVDVNATSESVTQ
RLNQMLADQEQLRVELSALAPLYENLREQVGFDPNTAIRVANLNESPTYQALLGDLREIEQTIAAESARFQADTPMIEAL
TDQRQQLLPLLEAEAQRLVGSAVEAETLGYQGSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQLLRAEIQRLADLSRSY
QQISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETSIAQTSNLPRNLLLSTVLSLMLGGVAALLRDRLDQA
FHSVDDLVKATQLPNLAGVPNAPALQKQPLLMVPNLSATMADVLTQNQSPHKLYTSFSFAEAFYSLEANLRMLSSDTPIQ
VVALTSSEPGEGKSTICAHLAIAAANMGRRVLLIDSDLRKPSQHLIFGHANRQGLSDLITQPLDDPMDLVQVIPGNPNLH
LLTAGARPPAPGRLLSSRKMQQIAEQYRCHFDLIILDTPPLAGGMVDAKLAAAHADGLLLVARLNRSERTEIQRVLADLG
NTVQAPLLGLVVNGVPHSRQSGYDYYYGYYGRPRVAAGIEDG
>gnl|bykdb|A0A1U7N3U5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea bouillonii PNG] (length=675 residues).
MKKVAAILNRHWTILLVFNSLVLAASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSKLATKSHPLNMQAS
ILNSDALMRRLLESDPEKTDFQRLVQYKKLFAVSPDQESTTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTR
VEFNKKALERAKQKLDQSQEALAKFQESSGLVNSKAQTEGLVRAITDLSISQAQAQAQAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLKAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLARALVDLGFRVLVVDGDFRQATLSQRLGHHHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIRNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|A0A254WHZ5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=689 residues).
MKQIFSIARKHWLPLLGFNSAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTSALNFKDVSPLDV
QLAILTSDAVMERVRVIDPEKSLYSKASSFSQLFVVTPQPATTLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVDSPEQSKGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGMLAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRLENPANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKAMRDSGGYDYVLIDSPPVGLASETNLMSAVVCNILFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLENEA
>gnl|bykdb|A0A2N6LHT1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5318] (length=534 residues).
KQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEEQENTLSAQLQELRSKEASLQQVTDAKALNQAYAAVRGGQDEE
LKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSGSVAGDQISQDLTSQLIINDV
ERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQP
SLPNKRTVLAIAIVVGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAIALEPSAQFLDHVGLVEPYRT
LFKNLEFRSSEPLRSIVVSSTITGEGKSVVGSHLAAISAMLSRRTLLIDADLRRPILHTLFNLAPRPGITDVIDSERSLE
ETVQRTNIPNLSVLTCGELYRLPSHLLESEAMKSLLIEAVRQYEFVVIDTPPLSACADAHTLGRQSDGIILVTRPGFTIK
EVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNSYEPLSSRRLSRGSSA
>gnl|bykdb|A0A2N6M0S2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5319] (length=541 residues).
KKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEEQENTLSAQLQELRSKEASLQQVTDAKALNQAYAAV
RGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSGSVAGDQISQDLTS
QLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEA
AQPPTQPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAIALEPSAQFLDHVG
LVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVGSHLAAISAMLSRRTLLIDADLRRPILHTLFNLAPRPGITDVI
DSERSLEETVQRTNIPNLSVLTCGELYRLPSHLLESEAMKSLLIEAVRQYEFVVIDTPPLSACADAHTLGRQSDGILLVT
RPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNSYEPLSSRRLSRGSSA
>gnl|bykdb|A0A2P8QV10 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=689 residues).
MKQIFSIARKHWLPLLGFNSAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVDSPEQSKGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGARPAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|A0A2S6V636 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. TS-821] (length=688 residues).
MNHIVNIIRRHWMPLLLLNGVVLAATLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTNLGTLGQIQNTALGFTRELNPL
QIQMAILMSDTVMERTLAVDPEKSLFPRLSDYKLAFSATPQEQSTIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQ
DTNVRKQFSQTDLEEAQAQLAKAQAELASFQQATGLTEVAEQTRALIAQQRELRTTYTNVLSQAQANQAQAQAASERLGI
NAQQAMNSLRLGENREYQAIRQKLSDAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQIAIAAPGASANQIDPTLG
GNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINRVNAELNNIAQNRAQLINLQRQYEIAEGVYKSILAQVEQTKTN
PFNVYPNVQTLDAPAIDPKPEEPSKRAIALGGILAGLFGSISLIFFLEKRNPMLRPKDLEQVEFPVLGRISRLKRADMER
NLSGEVAIELQRLASAVLMLEHQRLLVTSSTSGEGKTTVTLGLALALVNFGFRVLIVDGDLRQAELSQRLGQPQKKLKDG
QPSPVSVCLGLDLLPAPALSKGKIPEFFARGSFQQYLDQIQADGGYDYVLVDSPPIGLASETNLMSSVVRNVLFVVRSGK
SDRYAVMDGFEQLAQHHAQIMGLVVNYVEPKDVGYRYGRQRELIETEA
>gnl|bykdb|A0A2T1CC83 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pleurocapsa sp. CCALA 161] (length=391 residues).
VGALYNSQQDLIKRAKVLPQLEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPDKGNSGRAVLM
GMGLIMGAFLANLSVILLEMQDRSISSLAEIKKKFPYQTVGITRLEPPMYQGKIVTRDEPDSFSSEVYRMIQANLKFLTN
DKPPKVILVTSSVPEEGKSTVTANLAAAISQLGRSVLLVDADLRRSSQHHLWGVDNQKGLKDIVVDNVSPLSVIRQPMPK
LSLLTSGMVESNPLAILDSPKMSDFIGRSRREYDLILIDVPPLPVTADVLTVSKLVDGILFVTRPGIVEHESAELAQEAL
ATTGQKILGMVVNGVKANEFDRYSYHGRYGKKYFEKGNVQYESQNNLNGSQNLSNMPEGNNANSSVSRAKL
>gnl|bykdb|A0A2T1DKP1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][filamentous cyanobacterium CCP2] (length=456 residues).
VEQTRYRSGHPAIANLERKVDALNALLQERIGQVVSNGGPVPTGNLQLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQ
SAYRARANALPRLEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSERSSNRKMGLALGGGVGIL
LAVAAAFAADLLDRSVKTLKEVKDLFGYTLLGVVPLLNGKPVRQRSHFEGTAHPIPRVYVRELPFSSAAEAYQMLQANLR
FLRSDKEIKTVVVTSSVAQEGKSEVAANLAASMAQVGRRVLLVDADMRYPVQHHVWDLVSTIGLSNVIVEQFVPDVAIQE
VAPNLYALPSGIIPPNPIALLDSKRMASLVEGFARDYDLIIFDTPPLAGKADAAILGKMTDGILLVVRPGIIDSASANAA
KEFLKQSGQNVLGMVINGVDVRSEPDSYFYHTRERGKRNVAALDTITDSIPTEVER
>gnl|bykdb|A0A2T1EZA0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aphanothece cf. minutissima CCALA 015] (length=901 residues).
MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPLSLPGTGASGPGLFDPSSQQS
PLSPMGESQSGGGGLGGIVRTVKRRQSIFLITFALVTGVLAINTLRQRIFSPVYQGGFQMQISNPFDNPGTGGGGGGSVE
SIARSEIKTDVPSLIVLMRSPLLLGPVAQRQGVPLRALESNLSINQESARVDNVLNVSLRWPDPAKGKAILRQLAKDYTS
FSLTQRQAAVNSGVRFLDEQAPAIEERVQKLSQEMLKFRERNNFVDPAAAAGQILGAREGLVNQLRTLQNEQVQLDSQLK
SIQTGKLQFTPSGAPTALEQLGRNSVLVPGRGDSAAEAASGTKTPLDLLNQFEQELATAKGTFKENSPIVQSLLARRNQL
LPVVQRQAADAVKARLLANVAQQDEINRQILLLSENFRNNPQKLAEFENINQRLSIAREQYSSYIQARERYRLEMARSIS
PWEVIGPPDFGSSPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPLEPGVDIATS
ISKMSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLRVLVIDSDMRLPMQARYL
GVEQGDGLSTLLSDSSRKPTDFIHSIAENMDVLPAGPKPPDPAKLLNSSRCKEIMEEIRALPGYDIIIVDAPPCLMLADP
ILLGEKLDGILFLVGLGKVSRELAPQASRRIRASGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYASASGYAKSASEP
STGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQATAPVATNGGIGPSASSTSPLPPADSVPSRRHR
PSREGGGGPMGWLRRRFGNRG
>gnl|bykdb|A0A2T1FMA8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=689 residues).
MKQIFSIARKHWLPLLGFNTAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVNSPEQSGGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLKLITTGGMLAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|A0A2T2S1W0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium QS_8_64_29] (length=249 residues).
MSFLPVRDAPRSPLSESFRMLQANLRFSQADRRLQAIAVASSVPGEGKSTLVANLGLALAEVGQHVLIVDADLRNPSQHG
IWEYANAVGLSNLLVGESSLEQACHPASEGLDLLTAGQVPPNPVALLDSQRLATLLQQWRQAYDYVLLDVPPLQAATDAV
IVGKLTDGTLLVVRPGVAECDAVEASRDTLARLQQPVVGMVANGVNPRNERSSYYHYYNYGNNNGGPPRQGWRRWLPGNP
FARNGKGSQ
>gnl|bykdb|A0A2W4VXF4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya antarctica] (length=766 residues).
MPFSSKPAAREVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRAGIFWGVAALSFGGLTLWHLTRPPV
YNGSANLLVEPVTVVNTPGLEAVMELPGARSASGLDYTSQIRVLRGPDVIKPILVNIQRQHPEITYTTLLNDLVISQEGE
SKVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLEFLDEQLQEKWQEVDTIESDLSEFQKRYDLVNVTTTA
ESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRSQVGFEPSVAIGVANLNESPTYQGLLGDLREIEQTIAAESARFQSDTP
MIEVLVDQRQQLLPLLEAEAGRLVGSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLAD
LSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSVTEMTNLPRKLLLSTVVGLLLGGVAALVRD
RADTAFHSADELVKATQLPNLALVPNAPALQKQPLLMVPDLTATMADVLTQNQSPDNLYTSFSFAEAFYSLDTNLRMLSS
DTPMQVIALTSAVPGEGKSTICAHLAIAAANMGRRVLLIDGDLRKPSQHLIFSQRNHQGLSELITQGLENPTDLVLAIPG
NPNLHLLTAGARPPPPGRLLSSRKMQQITEQYRRHYDLIIFDTPPLAGMIDAKLTAAHADGLLLVVRLNQSERSEIQRVL
ADLGNTAQAPLLGLVINGVPQSRQRGYSYYGYYGRPAVASGIDERG
>gnl|bykdb|A0A2W6ZN45 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium sp] (length=804 residues).
MLTEAGSPTPHSPFGTGSTQVAASALSPTANQPDDASTNVLFKLIRSLKRRQALFLFVFFVTTALLAANALRQRIVAPVY
IGGFQMLITDPLANVGPSTPSSGVVESLAKTTSLGNSDVPTLIQLLTSPVVLKPIAEAQAIPLGSLIGSLAIGSTRADSQ
GVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLEFLGQQAPALQQRVNSLQRTLKQFRESNSFLEPLAQGG
SIISSRDGLLGQLRTLQVEQAELETQLASVRSGKLITLPSPGSSGSGVVGQGSPAAGNPQLGLATRPRADSVAPSSNTVV
TPQQQLSQLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQSQGIDQLSSQLFANQAQQNELNRQILLLNKNFKQSPEE
IRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGDVPIEPDLSREFLRALFIGLAVGIAAVLLREK
TDDAYHTPKEASQELGLPILGLIPYLPIVSSDSILKSLKELPGTERFAIKESLRSLFTTFRLLRADREIRLVVITSSTQN
EGKSTAASVFGNTLADLGLHVLLVDADMRLPVQHKHFAVDNVKGLSDYLGDTDDNIQDYIKPITSNLSLITAGSRAPDPA
RLLNSLRCSDMVQHLRALPGYDLIIFDTPPCLLLSDPVILGEKVDGILYLVGLGRVGREIAPQAIKRIKATGVDILGLMC
NQVAYPTRLNDYGYEYGYHYNYSYAGYRDTYSQRLASKDVAEALPDNPSDQAQSSAASGSAAKPDSNQSGSSGGLNRLKG
WFRR
>gnl|bykdb|A0A2W7AI98 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp] (length=766 residues).
MPFSSKPAAREVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRAGIFGGVAALSFGGLTLWHLTRPPV
YNGSANLLVEPVTVVNTPGLEAVMELPGARSASGLDYTSQIRVLRGPDVIKPILVNIQRQHPEITYTTLLNDLVISQEGE
SKVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLEFLDEQLQEKWQEVDTIESDLSEFQKRYDLVNVTTTA
ESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRSQVGFEPSVAIGVANLNESPTYQGLLGDLREIEQTIAAESARFQSDTP
MIEVLVDQRQQLLPLLEAEAGRLVGSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLAD
LSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSITEMTNLPRKLLLSTVVGLLLGGVAALVRD
RADTAFHSADELVKATQLPNLALVPNAPALQKQPLLMVPDLTATMADVLTQNHSPDNLYTSFSFAEAFYSLDTNLRMLSS
DTPMQVIALTSSVPGEGKSTICAHLAIAAANLGRRVLLIDGDLRKPSQHLIFSQRNHQGLSELITQGLENPTDLVLTIPG
NPNLHLLTAGARPPPPGRLLSSRKMQQITEQYRRHYDLIIFDTPPLAGMIDAKLTAAHADGLLLVVRLNRSERSEIQRVL
ADLGNTAQAPLLGLVINGVPQIRQRGYSYYGYYGRPVVASGIDERG
>gnl|bykdb|A0A328V843 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Arthrospira sp. O9.13F] (length=541 residues).
QYFKQRNYVVDLGTEFAISVQEMAQLNRNITTLEAELNAVQSLVNSLGNQVGLNLEEAIAVNTLSQSPVVRAALQELENV
EGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYLGSSRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDS
LYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPDEGKTAKVPLLALG
VMGGLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGIIPSFAAPPFYRYLTGGDRSSVQVPVVDTPGSLISEIYRMIQ
ANLKFLGSDRKVRVIVVSSSVPQEGKSTVSANLAAAIAQLGHRVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSE
AVKPGIDQLDILTAGVTPPNPLALLDSRRMTSLIRNFSEEYDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDS
AKAAKEILGRSGQRILGTVINGISKNESTKYFYHAQRYFPLQKSHRRDRSAPPKISSRSSS
>gnl|bykdb|A0A355DPN1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11162] (length=710 residues).
MLGVFCGVLAIAIPIALNKEPTYQSSMQLLIEPYVQQKQEGKPQTEEQFTDSNVEVDYATQLNLMRSSQLIQKAVDRLHP
KYPEIQVTDIKESFSLTGVQEEDTDIKDTQTKIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQL
PTARDNVIQAEKALEQFRETQNLIDPVQQATTITDALSTVEQEQQAIRAQYQETQARYRVLQQQLERSPQEALTSSRLSQ
SPRYQALLNELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEETQRVLGETSTQIAFSTQNLLTEGQLGSNDLT
LSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQV
VEPPKPGKQMGPDTRRDLMLSVVVGLFLGGLAAFGREALDDAVHSSEELKRQVALPLLGIIPELPRTGGSGLLVHLPFRR
TQVAAASTLPMVYWLPFRESLDLIYKHIQLLNSAATLRSIVVTSALPSEGKSTFVVGLAFSAARLHQRVLLIDADLRRPS
LHKQLNLPNEQGLATLLVEDSSIPSPQRLSLSGSEIDVLTAGPIPPDPVKLLSSQRMRQLMAGFEQSYDLILVDTPPILG
MVDALQAASFCNGVVIVGRISRVTQSELTEAIAMLSHLNAIGIVANGANGSTNRYIAYAEQNGSPLFQLN
>gnl|bykdb|A0A355DU96 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11162] (length=319 residues).
ASIPEAPVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLFKYTWLGMIPESRKKGLFWQQKINGNVPQL
VVRDVPHGITSEAYRMLEANLKFLSPDQVLKRIVVTSSVAQEGKSTVSANLAIAMAQVGRRVLLVDADMRHPMQHHIWDL
ANTVGLSEVIVHQTQFEFAVREVMDNLDVLPSGVIPPNSLALLNSKRMASLVEYFSQKYDFVIFDTPPLVLTADAMTLGK
MTDGILLVARPKVVDRVSATASKEFLLRSGQQVLGLVINGVSVEGEPDSYFHHAKAYYKEELITSTIPDSKTKKNHIRF
>gnl|bykdb|A0A433W046 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=689 residues).
MKQIFSIARKHWLPLLGFNTAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVNSPEQSGGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|B0BZC6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris marina] (length=707 residues).
MNESVSKVIKIIYRNRWTTVGTFLSVFTGIVVYLLITPRLYSAKVRLILDQRPATSISPLGRDIAQTPGDNNKGLATQEE
LVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATEVIPGTQIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRS
EARATRQFLENQIPRRQQELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGLALSKVID
QSSGKESYLSAKAGQNPELISLRDQLSNLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKLATISPRSRLNSDGTV
QVANEKVTQELSEKLVLSVVERNELRDKLANTRAYISKLDARRKQYPVLEKTLASLQRKKEGATESVNLLRQKLDEARIA
EAQLVSNLRIIEEANKPTLPSYPNIPSFLVLGMMAAVALSAGVTLSAEGMDGRLRDLESIAENTNVPVLGVIPKQKNSRL
FPSLPFAELYNNLPLLESVRALSKNIEYKNSTESKVLVITSAISGEGKSFVATNLAVLSAMLSKRTLLIDADMRRPSIHK
IFQLPQDPGLQDYLRGSVKEGLPAAIHRTSVKNLSVMTSGKFSYDNVFSFETQRAKELFTEVQQHYDVIVIDTPPVMACS
DALVLSQEGRQTVVVARLDVTPKQVLNRSIDILNSNNVNVVGLAINGVTASTDKYYRYLKEDYALAA
>gnl|bykdb|B0CA08 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris marina] (length=710 residues).
MSNYWLMLKRRGLPAGFTFLTVLSLALLQAFQEKPIYEAVGQLKFEESQRSSKLIGLDSAVDDESRQQSSLRWQRSLDTE
ILTMKSPRRLSMLALAIESQGLFSRPSVEQIKSGLDISQFDETNVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQAS
TQSAISFIEKQLPQVKQRVNSAETALRKFKETYQIADLEIAKSANATNLSQLQTALDEIDRELVEVQTQQLSLQNMLKVN
PQQAILGISTAHKNISTSLEEIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKIEKFAQSDAQLNFDSNQEDDLRS
QLIQLDIRRNGLSKQQLKLRQQLSSYRQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILES
ATDPEPSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVYPYRVLGEIPLFDESEAESLKLPTLSDPASH
LSEAYRMLQSSLKFHGLEHSPRVLMMTSAINQEGKSTTCANLAVSLAQMNHRVLLIDADIRLASQHQIWELGNQEGLTHI
LLNKHFNYHQELPTHKVADNLEIITAGRISSNPLPMLESEQFANFVQVQIEHYDYILIDAPPLVSVADPLIIGKVVDGIL
LVARPGHLEREYAQKAHELLIHSNLSVLGTVINGILNKNELYSYYSRYGHNSNQEKTAIKRNLLKQVISK
>gnl|bykdb|B8HQ70 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanothece sp.] (length=686 residues).
MFQITSTLRRHWKPLIALNTVLIGSTALIAAFYPRTWQASARFVVPINTNQLSADIGTLGQLRPGDGVVPSDLMNPVTLQ
AEIVKSPTLIGQVLAVDPERDQHTLQSFMPLFEAKPQSLSPLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDAST
RQTLPQQELQEASNNLRRTQTQLSVFRQANNITDINEQIRGLVNSISDLKTEYARALAQAQASNAQQQALSQHLRLTPQA
AMTTLRLGENKEYQLVRDRLAQVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNLRAAIGNSSLAGVDRSLAGSAA
GDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQQVTALNRLSNKQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSS
YPSVQVLDGPLNSPRPEPRRMLIILGGLMAIAFGSSALVLLLESRNPLLSPADIQKVKQPILAKLPRLKAPSQVWNLDAE
PLLGFHRLASAISFLDLATPRLMITSAMYGEGKTTIAIGLAAALARLGFKILLVDGDLRRARLTEQLSDRYQGSWNPRET
AVVPLSPGLDLMPAPAIPNDRIVNYVAKGGFEQQLQTLQQSGEYDYVLVDTAPITLTSETGLMTTSVNNLLFVVRPGTSS
RYSVLDSFEELSLRKVNVVGVTINGIETNSEEYYYGKQRELAATEL
>gnl|bykdb|K9P6R9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium gracile] (length=818 residues).
MGETQSGGGGLGGLVRTVKRRQSIFLITFAVVTGVLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSGGGGGGGSVETIA
RSEIKTDVPSLIVLMRSPLLLGPVAQRQGVSLGALESNLSINQESAQVENVLNVSLSWPDPAKGKAILRQLAKDYTAFSL
TQRQAAVNSGVRFLDEQAPAIEERVQKLSQEMLKFRQRNNFVDPATAAGQILGAREGLVNQLRTLQNEQVQLDSQLKSIQ
TGKLQFTPSGAPTALEQLGRNSVLVPGRGNSAAEASSGTKTPLDLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPV
VQRQAADAVKARLLANVAQQDEINRQILLLSENFRNNPQKLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPWE
VIGPPDFGSSPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPLEPGVDIATSISK
MSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLKVLVIDSDMRLPMQARYLGVE
QGDGLSTLLSDSTRKPTDFIHSIAENMDVLPAGPKPPDPAKLLNSSRCKEIMEEIRALPGYDIIIVDAPPCLMLADPILL
GEKLDGILFLVGLGKVSRELAPQASRRIRASGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYASASGYAKSASEPSTG
GFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQASVPVATNGGIGPSAGSSSSLPPAESVPSRRHRPSR
EGGDGPMGWLRRRFGNRG
>gnl|bykdb|K9SGV8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp. PCC 7367] (length=738 residues).
MNQLQQYLFIIRRRWPVATLVFVSAVLVTTFHAIFVMKPRYRASGEMLVTPGDQAIAITNVGVSKTVNQPRSLSGGYLNT
EMQIMRSKEVIQRALEIVERPISYGEFLGSFGVNVIPGTDVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAA
RLFIEEQLPKAEQDVENAEQQLRAFREQYNFVSASAEAEATIDRFRSTESRIEDMQVSLAKIDAQSDQLGNLVADEIDSV
EQALLRTALSQSPHTAGVMGELQQTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVAGIPPSESIDIDALFQ
IGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSNYRERYRELPKLEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQ
NIGNTRILSLASTPIDIVTPRRPRNVSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELLGFPLLGVIPNFKKVPLFPV
ASGNRIGRTVPELVVREAPNSPISEAFRMLQTNLKFLSLKKRLKVIVVTSSVPREGKSTIAANLAATIAELGQRVLLVDA
DMRHPAQHRIWQLPNENGLSDLLTGQSPLSEVAHHVMPTLEVMPAGSKPANPVALLNSQATSNLIDYGSSNYDVMIVDTP
PMAVAADASILGKIADGIVMLCRVGVADTNNLTFSKELLEQSGQNILGMVVNASLPEDDPYGYYYSYYYNYSSKPGQRQR
QEASRQDQDQNQQETINQ
>gnl|bykdb|K9TU02 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=689 residues).
MKQIFSIARKHWLPLLGFNTAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVNSPEQSGGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|L8M1L4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Xenococcus sp. PCC 7305] (length=788 residues).
MNNTIVRSDFVNLPAQETGFSLSDFKQILYRRWKPALALGIMAFGVVLIPKLLSTPQYRSEAKILLKSPQNQQSAEVQLN
ALNSRRNYYNLKDLSTDILVLKSYSLINKAIEKYPETFSGLSAAEVRTKLNIFPAMINDIPTDILNISFVDSAPEVAQGV
LDALSEVYVEYSLERERSQALNAIQFIEEQLPKAEEELNKAAFAIRSFRQKNNLVDPDEYVGRVADFRQSLEEELKRGEI
ALDIAQTKYRTISNQLIELGQDPETIVTTSVLGQDGVYQSLASQLKDLETQYTLASVQFKDNYPMMQDLKLQREQLRNLL
LERSTQILGEGISPAVLDKVLVSYTQTNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKANVEAD
FQRLPQLQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPAQPISPNIQKALVSSLVAGGLWAIA
IAFLLHQLDNRIKLVEEVKRITHLPLLGAVPQVFDPLIVIEDNTVKQSYSYRYSSFTESLRAIAMNISYTVVDTRKIKSL
VTTSSTSSEGKTTVTYNLALALTELDAKVLVVDADLRKPKIHKMAKISNEQGLSEVISDNKHSWTEVVQNVTGNLDVITA
GANVANPIALLRSQIMSELLKEWEAAYDYVLIDTPPIGAMADAQSLVHQVDGVMLVTGINKVNQKAIVNTLEVLQSSNCN
LIGFIANMVEKDLDYYSYSYYSHYYNQPSNGNGNGNGNGNGNGNGNGNGNGNREAGSMNSIMQQFRRR
>gnl|bykdb|X5JJE9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Richelia intracellularis] (length=676 residues).
MLDDKRVSISQLGQNLTQVSRQYGGPDPVSDQAELAKSQPVLERAIAIAMPKSNKLTMDALTATLDEGLKVKTIPTTNIL
ELTYAHENADLAAKMLNAVSQAMLEENIKNIKSEAKKVKEFLEKTEVPRARERLRLAEAAENRYRQRSGIVSFDEQSRSL
VESLSTLEQEERTLVSQLQEVESREASLRQITQAGNVGNAYNNVRTGQDEDLRKLRAELVEIEQKLIVARNSFTEDHPDV
IKLLQERDGVASLYQQRLGRIAPGNQGTPSSNIAGDQISQELTSQLVTTEVQRVALENRFRVVQNERANLQARLAQLPIK
QQPLTQLTREREEAAESLKTLQRKLEEARIAEAQKVEKLRVIEKAKPPRLPTSPKPAVVLVLATVFGAVLATGIILLLEI
TDNTLQDPLEAEELVKLPLLGVLPRLPESALILKPADQFLDRVGFVEPYRMLFKNLEFRSLEKLRLIIVSSTISGEGKSV
VASHLAATSAMLSRRTLLIDADLRRPVQHNLFNMVPKTGIGDVLQGGMTLQEAVQPTSVENLFILPCGELHGRPSQMLES
EAMQALLIEAQSLYNCVILDTSPLSDCADAATLGQHSDGLVMVTRPSFTIKEVLQRTVSELNKNRIPVLGIAVNGITGFS
ERYYRYPVKGYQPVLEKPVKRLVGSTAVESRTEISE
>gnl|bykdb|A0A399EFN2 [Bacteria] Bacterial tyrosine kinase [Deinococcus-Thermus][Meiothermus terrae] (length=532 residues).
MTPHTADSTEEISLERLIPLLLRAIRWALPAALLSATVTYFALKQQPLVYESASSLVAVQPGPLGSAGSFTTPLVSVAPL
DPQAYKEAALSTQVLGQALAMAGEPEGPQALMRLRQAAKVRTVDGRQSSIITLRVRDRDPARAARLANAWAAALRGWEDQ
RAREHFTRYRRSVEAQLEAILTEIRQARQLKDPDRLRSLDALRGNLARDRDLAHALEESAVGLLALLEHAQVPLAPSAPR
PLLGGAAAAVIASLLFFGFVLLREALVRAVRDSEEAARVTGLPVLGEFPRMPPNGKRELPAEAAAFLRTGVHHALADRHP
KVVLVTSPEKAEGKSSVAIALARAYARADLPTLLVDADLRRPVVHREFGIAKGWDLVESLRDFTYSVHAHPVAPNLEVLP
CLEAPENPAELLAEHWRDFLNNLVHTGRYKVVVVDSPPALAVSDALILAPHASGVLVAVSEGATDRKRLEATLEVLSRVG
ARVVGLAMTNLRRGPAASGQFTYGYGYGYGPVAVADRKEHKGLPKAGGPKSS
>gnl|bykdb|D7CW95 [Bacteria] Bacterial tyrosine kinase [Deinococcus-Thermus][Truepera radiovictrix] (length=539 residues).
MQQEISVSLGDVFRFLRRGFLLALLLAALGAGLAYVLSGLREPLYRAETTLLITRGDLNLGAFSAPVIVAPPLDASAYAT
AAESSEVIEEALVALGAETVTPQQVQGVRNRTAALPRESAAARDSSQLILQVEEGSAEGSAALANALARSLIEWDLLRAE
NALAQSIAQLDRSIANTQAEIARLQAEGAPPDQIGRLQNRLNNQLANRDEAEANIGTATSRLSVIQAAVPPLRPVSPRPP
LDAVIAGFLGFVLGYGILLLRNLLDTRLRSVEDLEAVSGLPILAEFAKSPKKTRRLPREASGYLRTNLLLATPKVHPKVI
LVTSPHHGEGKSSVAISLAESFTRANYRTLLVDADLRKPVIAREYNLDDKRHMPLRTHLENPHGSYEAAHVGVNLAQTLD
IIPTFRAAPSPTELLSLGFPSCLESWQQDYDVIVIDSAPLLDVADTLTIAPLCTGTVLVASLQETDPQALTDAVELLQRS
GVRIFGIAATFVPRGTGARARAASYRYAYEGELQDDPLVVAPLPPPTAAQPVKARSRPS
>gnl|bykdb|A0A1F9UED4 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFCSPLOWO2_01_FULL_59_12] (length=378 residues).
MEIKYADLAHRYKPKHPSLQRVMAQRQSLQAQIQTETQHILQSLKTQVSGQFKGNNIRVVDPAEVPLKPVRPILWMNLLM
ASFLGLFGGWGLALLVNYWDTTIKTQEDVEKFLEVPFFGYIPSIKLGKKDSLKGYLYSREAPESPVTEAFRGVRTRLLQM
AKTRSPKTLLVTSAGVKEGKTLFSSNLAIILAAGGLRILLVDADLRRPQLGAVWGKPDHNLGFQDLLAGEAPLGAVVQET
SVKNVSLVPAGFNCPHPAEILGSKRMGGVLAEMTSQFDLVIFDTPPLSYVTDAMILAPQMDGVLMVVRYGKTHPPIAKRH
VERFQETNTPLLGVVINDFQATPGTYSPYGYGCGYYSPYSHRGNGGKSDVRRPSPLSV
>gnl|bykdb|A0A1F9VII2 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYA12_FULL_49_49] (length=707 residues).
MTKETQQQLNLSDMLELLIRKRNVFLVLFSVVFFSSVLAGLFMPRVYEASSLIKVRGKKIIDPLVSEIAVAPQIAEEINT
LSKQIMAWPKLEQLVLQLNLVSVDASQKQMEDYITNLRKRVNVRFVNREIIQVVYQDGNPRRAQMVANTLTQNFIEESSQ
GKREEAKNAIDFINEQLKIYRAKLENSEQNFTVSKIDSDLRVAQNRRTLLKDRLANLQKIIPSQVTTEQNPVVSQLQARA
GQIESELARLLIDAKEGNPKVQELQTELTGLKARISSELEKTTVKESISTFNPMYLQTEQELKQMDMEISYLEKRRESLL
TRSVRGAKKLGEEGLANLERNKRVDEDIYQMLLRQLESAYVSERLQDSEKGNQFTVLEYARLPLKPVKPNFMKILLFGFF
GGLMLGGGGVFLLENIFKTFHTPEQAQAVLGFTGLGSVGTIAMETQNKDKKEFRAAVRDFLRNNKLFSKIRIAVPHIALK
RLDPSVAAELVVYHDPRSRIADDYRMLKTNIFHGLNDSGKIKKLLITSAIHGEGKSTTSANLAAAIAAGGSKVLLVDCDL
RKGLLHAFFSAPVNPGVSDILLNSIDPQKACRQTPVNNLWFLPCGAAKGNPTELMGSPSFKELINSLSSQFEIIVMDSPP
VLNMPDAMMLSKFSDAVVVAIESGKTHQKDVINIKSSLRQVGAKVLGFVMTRQDHYMPRYMHDYYYS
>gnl|bykdb|A0A1F9XD88 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYB2_FULL_50_12] (length=509 residues).
KESNVSSYREGVAVDISGMDYYQTQYKIIKSRSIAKRVIEELGPALNAGNRTANGDSVNSFLGSIIIEPIRGSRLVNISA
ESFSPELAVRMANTLSDVYVKQNLENRLFASREILKKLPADISLASLSNKDVMESLPSVVSNSLIQDLKAELIKYESEYA
NLSQRYKEKHPSMQTLQAKINLLKERIGTEMRNTVESIKTELSGEYKSNNVRIVDYAEVPKNPVRPQRKRNIIIAFVLGL
SLGAGLAFLVEYLDNTFKSGSDIEQYLDVPFLGIVPIVKEKGENNMFVLDGVKSPQGEAVKTIRTNLIFSAAEGKLKTIL
VTSCVPGEGKTFSSMNIAASFSQAGKKTLLVDTDLRRSSLTKCMKMDIGNGLSNYLIGEADCDNITRETEVKNLYFISSG
LHSPDPAELLGSQRMKEFVAQVSAKFDRVIFDSAPVLPVSDTLNIANLMDGVVMVVYSGKLSRAMVNMGKQKLQGVKAKV
VGALLNYVNVKARGYHGYSYYSYSYNEYY
>gnl|bykdb|A0A1F9Y6N7 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYB2_FULL_49_7] (length=184 residues).
MITSSVHSEGKSTTSMNLAIALADSGMNTLLIDADLRRGILHEHLSVPQSPGLSTLLHGSMLMEAAFARTQIKNLTLIPC
GTRPVRPAELLGSRAMEQLLNKGSTSFDAVIVDAPPVLNLPDASILSRLCDGVVLIVQAERTQREEALRAHGMLAQARAN
IIGFVLTNVQYYIPKYLYDYYYGR
>gnl|bykdb|A0A1F9YBZ2 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYB2_FULL_49_7] (length=720 residues).
MDKGAKELNFKDYLDILFRSKYTVLLIFFAIIGPLVFYVRTMPDAYTTRSQLVIEDLKYSSALDFTGLQGLRSSRSFNFY
QGIFKSRSFLQAIHDSLGTVSFRNELRDTAQEVIRAFIGSALSLQQTGYESFISLSAMARTPQLAYDLSRVATQIFKSMC
REVVAEEAENMVKETEKQLNLIRDKLETVEKDFNEFRERTGASTLGMADELKHLQTRYYELRSDQASKEALYEANRRLLS
VLEKRIEPKNTDNQQSGLYLKAKETLRQKEKEKKRLESLGLTLSTASQINEEITKLEQDVIRYSSKEERVDPKVVNQWQK
MRNVVVDNEMELDILKNNLAVYEKKINEYKRSHPDELSQSLELARLERARKVYEDTYNVLLEKVELAKIRRASETGGLTI
IDPVYYPTKPIPRKEAAYYIVGLFVSLLLAVGFVFFREFLDTTVKSNTDLENAFEIPIIGTIPHIDFAKKSEMEIKRRSS
TGGDKETTTIYPKELINFYKDESVVAESYRALRTNLFFASPDNPIRTLGVTSSGPHEGKSLTVSNICLACAQMGKRTLLI
DSDLRRPVIHHLFHLPRENGFTDLFIGKELEAVVKKTAMENLDIMTAGRFTPNPSELLASKKMEKILETMKAQYDIILFD
TPPVMAVTDAPIISTKVDGMLMVVKSYSTDKNVLERALINLENINARIVGFVLNDIDLTHRYASYGYYKYYYHYYRSQKD
>gnl|bykdb|A0A1L5KMJ5 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=382 residues).
MEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKK
ALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAV
DNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNE
HGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSV
GTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|K1YLM0 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=325 residues).
MPVASSILTIFGDGWQEFIDPIDVFKEIEHSKQNKMKISEALEKAGYGEDLEKRAEEGPEKEFDHDRIVVSQTRAGQEEH
SANNNSVQKSISGKWDERLFKAVNDSSYVPEIFKTLRSRILHPLSGEAIPKTILITSAIPREGKSFVAANLGISLAHGLD
QHSLLVDCDLRKPAMAKMFGLDNSPGLVDYLRDGVALSKLIQKTPIAALSVLTSGIPPENPAELLGSSKMSALVEELSSR
YDDRIIIFDSPPMLVAAEASVLAGQVDAMVLVVRQSTSGKAQIQKLIDIVGTERILGIVFNDQKTNLLQKRIIKGYASNH
GAYYE
>gnl|bykdb|K1YRR9 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=201 residues).
SSAEQPPKTILVTSMDAKEGKTSTTINIARVLSQGGKKVLIIDCDLRRPRVHAVFAMQNDRGLSNFLTGNLQENIIHKIP
GEEIYVISSGTIPPNPSELVSSRKLKTLVEKMAEDFDFVLLDSPPIQSVTDSLALTQIVDGTVVVIRVGVTTYEMLQSGL
KKLKDVQCHLLGCVLNGQRKNNSSGSYYYGYTTYYAKDSEG
>gnl|bykdb|K1ZAW7 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=276 residues).
KDAPKDNIFDKQKVQPSKPAPKDIALDDRLVSYFDPSSMVAEQFKRLRTYVIKPGTENSPKTILVTSTMEGEGKSMIAIN
LAITIAVDLNSNALIVDCDLRNPSLSRWFGFREQRGLSNYLLGEAQLPELLVKTSVDKLTILPGGTVRDNPVELIGSKKM
KSLVADLKMRYDDRYIILDSSPLLATTEPRVLSDMADGILFVIKSADTPRESVQQALKLIDKKCIIGVVLNQVEFKTEAL
IRRYFGTDRYSDYRYSAKQSEPSSSRQSASRTRIRK
>gnl|bykdb|W0FPE0 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium Contig783] (length=243 residues).
MAKKRKTTDGFDHIGNLLNFSGKEAYNLLRTNLMFSIRKEEDRARIVGVTSSIHGEGKSLTAINTAYSLAENGYKVLIID
CDMRLPTLDKKLGLKKSAGLSNILAGMDTDDDILFKDVIVKGLNVVQAGDIPPNPSELLGSAQFKSLIENLGGYYDFIIL
DLPPVGEVSDALVASKRVDGMVVVVRQDYTNQADLAYTMRQLELVNAKVIGFVCNYASGKDHKYGYGKYGKYKKYKYAQK
PAK
>gnl|bykdb|W0NTY4 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium B3TF_MPn2] (length=364 residues).
MVEQSKRFRRGMRQRPAKAPEEAPVDPPVEASVEVPADVTETAPVQRRGLLSGSGRSAEEIAREDRALRSAFPFLDLDDV
EAESPERAEEVAPVAAPEPLILNPESEVMPEPEAEQPSEQPPEDDGWNDLGPMPVQRQQMMRNLIITASRKNPVHAAFDV
LRARLVQALSDNGWRRVAITSPTRDCGKTFVSVNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEIE
TRDQFFKFDQNDMSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFDLPPALANDDVIAFKSNFDGVL
IVIDGTRTSGAEVREVMRRLGEDVPLLGVVLNKAEDATGDEYGY
>gnl|bykdb|X2LJV2 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium lac193] (length=310 residues).
MSRLFEASQRAVTDTEADPGVSATAPIAGAGDATQVFPLERRLRPSPTESSALARVPTHAGVALPAPPPVGAQKEIAIAS
DGPGALKLVTAGLEQASFNEYRQLAATLLQTNADKPVLVVAVTSALPGEGKTLTSANLALILADAYRRRVLLVDGDMRRP
TLHTLFGAANSLGLGDCLKAAHLVPGSTVEIGRGLTLLPAGRPDRDPVGQLSSPRFKEFLDHASKTFDCIVFDTPPAVLL
PDAELIASAVHTVLLVVQAAKTPYQDVQRAVAALGRERIAGVVLNRVAQDTRRASGYHQYYAGFHDASEP
>gnl|bykdb|A0A0J7HUK3 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Chitinispirillum alkaliphilum] (length=770 residues).
MSFRKDKKDSVPWDHYLHLFLRNIWFILPVSLTVLVLWIVVMGRMNMFTPEMQARAVLRFDDPQALSGVDERVSYESESR
ASLVKSRSFLEQIAAKHSLQLMTSRVQREDVFDSVWVGPDAPRGSYSLRIHNNMYRLVYSNKEQGIDNRVVQRGKLSSLG
TTEFPGVYLSFSPSFKEEPFEVNFSVIRLRDAVDFILNNLEVRQSEPLGTILSITLSGRDYPLITQVLNSIVEDFVHNKS
NLRYSRTEEIISILQEQLSVAETEMRKAESELRAFRNANPSVGLPDAMLPPSSIPDLIENEAGYRSYVLQARSLRERYNH
VSSNDIIPMLNEMVAFISTHRAPTAAGLQRELDYLTERERMFRQDYSPSHPHAIENRNRLRALGRKVNSALGTVISDFER
RIAENQNRINNLNNDLAALPAKEIQLSNLQRQFEVNADIYSTILGRYKEARIASSIELGDVSIIDHAVQPERKYNFRNLV
LIFGAGLLLSMTAGFGPVMAVDHFDRKARTEKDLSRLTSLLLLESVPVKGKWSGPGWRPENGEVDPKLVSADYSRNFVDE
TFRSLRAKVLLSLFDEKKKRIVISSLNMSEGKSFTAANLAVTMAQQNIRTLLIDGDMRRGLQHESFGLSRKPGLSNILMS
TEPLSSSLLKRKIRPSHISNLSLLPCGSSIPNSAELLNTQRFRDLLDLCSEQFDMLIMDTPPLSVTTDAVGVMDSFNKYL
VVVRSAHTNISHLNKKISEFPGLRKKILGIVFNGAPYRRPEYYQYSSYRY
>gnl|bykdb|A0A1J5EXB2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacteres bacterium CG2_30_45_31] (length=536 residues).
MNDTIHFSVAFLMAKQGQEFVLSQVDPLIAFRNLSEQLSVSEKGKKTGILQMTYANRYPDRAASILNTIANAYVRQNVAM
LSAEAEKTLLFLEGQLPALRMKLDSSEKALTEYRHSVGTVDLTGEARVVLEKQVDLQQQLLTLARQKQEMTRLFKEDHPS
VIAISEQEATLRKEMGKVAISAKELPLTQQEVIKLQEDVNINNALYSSMLNNIQELRVVRAGEIGNVRIVDYASHEIFPI
KPRRKLIFAGILLGSLLLGAGFIFLLRMTMRGVRSSSEIERDTGVSVYAKIPESEHDTGSRKKGSNVQTLMEADPDDFAC
EALRTLRTALDFSFLERGQKVLVITGLLPSVGKSFVSENLSVLFAGMKKNVLLIDADLRRGRISHRNKKGLTDVLHGHAS
LDEVIEKKNNGGISVLGAGSIPTNPSELLASDMFANIIAKVRENYDLIVIDTPPILLVTDAQLVCKYADFALMIVRYGAH
NMEAIKEGMQLIDRSGIHNKAIVLNRCQYEGGRYGYGYGYGYRYHGKYGYKPSVNV
>gnl|bykdb|A0A3C0PF94 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacteres bacterium] (length=789 residues).
MNSMQSRNVLPVPKVMGMDYYIPHYLNLIWRWKWYICIVTPVIFVAWAIGVIKFGNTRPALESSAVLQFMQSSGTTGPID
NETMLVQKSSCDAFIHSRSFIENISDKLSLRLSVKKYFRSEIFDSISIDKDAAVGKYDFVVGNDGYSIYYSNKKLRINKK
IVISGRLIELSSFFLPSILLKLTNDFVSEPHSFTFFISTQRQAVDNVLKYLSTKFPGSGERDNSIMAITLQEHDYPLGTQ
VVNEIADEFVQHNSEQRLNTKNENVEVLEKQLQEARNNLAGADNALRQFREVNSNVGVTNSAASSVSELVTLENSVNSLK
SSITEANVLQARCQIANSDDISDDKMTALNEAITYLASRQSVAAPALQSDFNEASADKKRVDAEYAPQHPRVIENRKKIA
RIAANISKALSDAVAKMRADAVGAVNRKDALTSENQRLPAQELRYSDLMRKRDNAEELFTNLLSRYNISKMSAASQSSFV
TIMDHAVVPNSPSRLQSMLRVLLIGLVIALVFGFGLPAGIDYLDKRARNEGDCRRFSALPFLEGIPKKNDSEKNNVSKKE
KIDDKLVAAGFEPDTFDEMYRSLRTKILLHLHGEAHKMLVVTSLNAGEGKSLTASNLAIVMAQQKLRTLLIDGDMRRGVQ
HNSFVLEKKPGLSEIISSPDELTTMPVSSFIQKAHIPDLSLLSCGMPIPNPAECMNSSKFRDLTAMLAEWFDVIVLDTPP
LRVAVDAAILPEAFSHYIIVVRAVKTNIVALEKKIVDFPGLYQKVLGIVLNGAPIDKKMHNYTYSYYRH
>gnl|bykdb|A0A010ZC45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. ASBs410] (length=232 residues).
MRKVSFRRKDKLDFKANEAFKTLRTNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
RYKVDGNTYGLTHYMTGQRSMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAKLLEEQRDNYDYIIVDAPPLGSVID
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKIDMEHDAYYGNYYGKYYGKYYGNYGE
>gnl|bykdb|A0A011QU98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium sp. AK22] (length=233 residues).
MIFSKKKKADTGERPGLVVVNKPSSVVSEQFRTIRTNIQFSMVDEDLKTVVVTSAGPASGKSTIAANLAATFASKEKKVL
LVDADLRKPTVHKTFKVRNTDGLTTLLTDRNAHLDEMIYRTHTEGLYTLTSGAIPPNPAELLASKRMEEIKQEMLALFDL
IIFDMPPVLAVTDAQVMATKADGVLFVIPQGSANKDEVMKAKDLLEKVQANVLGAVLNRVDKSDDSYYYYYGE
>gnl|bykdb|A0A011RN54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium sp. AK22] (length=231 residues).
MSVNSHKHRVDKQTAIIVKTKPGSVVSEQFRTVRTNIQYSMVDKSLKSIVITSAVQGAGKSFVAANLSSTFALENKRVLL
VDADLRKPTVHRTFNFNNHSGLTTLLTHPNEALSDLVYLTDMGNLSVLTSGPIPPNPSELLATKRMEELIEMMESEYDLV
IFDMPPILAVTDAQIMSGRVDGVIFVIPNGKATKDEVMKSKKMLDMIHANVIGAVMNRMVPSKHSHYYYKE
>gnl|bykdb|A0A017RSD4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fervidicella metallireducens AeB] (length=249 residues).
MEKINLITYNSPKSPITEAYRTLRTNIQFSSFDEKVKVIVITSTGPGEGKSTTSSNLAVTMAQGGNKTLLIDCDLRKSML
HRKFNLSNEIGLTNLLVDELNLDRVIQNTRVENLSILTAGTKPPNPAELLGSEKMSSFVQEMKKIYDYIIIDTPPVIMVT
DAQILSQYADGVLLVVASGEAEKDAVLRSKELLQKVDAKILGVVLNKIDASSKGRYNYYYQYYYGNDVKNIDDKRKNKLL
SIFTNKRSK
>gnl|bykdb|A0A017RXI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fervidicella metallireducens AeB] (length=226 residues).
MIMHRKPKSPVAEAYRTLRTNIQFASFDKDIKTVVVTSSGPTEGKSTTAGNLAISMAEMGKKVLLIDCDLRRPSIHKKFK
ISNQEGLSNLLVENAKVEDVAVKFMDNLLILTSGKIPPNPAEMLSSNKMRNFISEMKEEFDFIILDTPPVIAVTDAQILS
TMADGVLLVVSSGQAEREAVERSKTLLVNVGANILGVVLNKVEINSRRGYGYYYYYGNEKEGNKVK
>gnl|bykdb|A0A023CJC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus genomosp. 1] (length=231 residues).
MAASNRKKFQKMERNLITLDDPKSPISEQYRTIRTNIQFSFIDEKMRSLMVTSSSPSEGKSTTAANLAIVFAQQGKKVLL
IDADLRKPTMHYTFRLNNYTGLTSVLTHSSSLLSACQETNVENLYVLTSGPIPPNPAELLSSKMMDNCLQQLHESFDLII
FDTPPVLAVTDAQILANKCDGTILVVASGKTEIGAAVKAKELLAAANAKLLGVVLNQRKQREGHHYYYEYK
>gnl|bykdb|A0A023DB77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus caldoxylosilyticus NBRC 107762] (length=231 residues).
MARSNQKQTKKLERSLITIEDPKSPISEQYRTIRTNVQFSFVDAPMRSLMVTSAGAGEGKSTTAANLAVVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNILTNSAPLLPSCQETRVENLYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLI
FDTPPVLAVTDAQILAHQCDGTVLVIESGRTEIEAAVKAKELLEAANAKLLGVVLNKRKHRQGQYYYYQYK
>gnl|bykdb|A0A023PE61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus bombysepticus str. Wang] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A023VJQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus iniae] (length=239 residues).
MSQLNLVRSKREHYQHAEEYYNSIRTNIQFSGRDYKAIVLTSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVLPNPTTLLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILNKVDQQLGSYGAYGSYGDYGKTKKSSKSKKHSRK
>gnl|bykdb|A0A024DFW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. VT 162] (length=227 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|A0A031IFB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. RIT341] (length=231 residues).
MAKKSKMNKDARKLITVTQPKSPVAEQYRTIRTNIEFMAVDREIQAILVTSATQGEGKSTTSSNLAVTYAQQGKKVLIVD
TDMRRPTVHYTFRVANGLGLSSLLTRQAEKEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLVAQLREEFDVIIFD
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|A0A037ZBB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium tetanomorphum DSM 665] (length=245 residues).
MGKVDLISVKDPKSPISEAYRTLRTNIQFSSFDKKIQTIVITSSGPGEGKSTTSSNLAVVMAQGGSKTIIIDCDQRKPRL
HKLFSLSNESGLSDLLAGNTEFSQAVHKTEIENLDILPAGTRPPNPSELLSSKKMGSFIEELRGEYDCIILDTPPVIAVT
DAQLLASKADGCVLVLSSGEVEREAAMKAKELLEKVQAKIIGVVLNKLEVSEKGYYGYYYHYYYGNDGEKIKKKKSKNSK
EDLAV
>gnl|bykdb|A0A059NV95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus karajensis] (length=231 residues).
MARKNKKAANSVGRSLIADINPKSPIAEQFRTIRTNLQFTSVDKELETMLVTSASPSEGKSITTANTAVVFAQQGKKVLL
VDADLRKPTIHYTFRVNNTKGLSNYLVGDQPVYKLVSQTEIENLDTMTCGPIPPNPSELLGSKKMQTFIDEAKETYDMII
FDTPPVLAVTDSQVLSKFVDGCMLVVRSKQTDKEAAAKAKEHLEQTKANLLGVVLNDQDIKSSNYYYYYGH
>gnl|bykdb|A0A060LYA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus lehensis G1] (length=231 residues).
MVRSTRTKKGQGQKKRQLIADVNKHSPITEQYRNIRTNIEYSAIDTDIHSLLITSAGPGEGKSTTASNLAVVMGQNGQRV
LLIDADMRKPTAHYTFSLMNTHGLTNVLTRQQKLVDVAQETSIENVSLLTCGPVPPNPAELLNSKMMEMVIKEACENFDM
VIIDTPPVMAVADAQILSSKVDGTIIVTSSGKTDRDQLEQTKANLVKAKANILGVVLNNKPIDQNTYYYYQ
>gnl|bykdb|A0A060QT77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|A0A060RGH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGEDRRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A061CBF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. lactis] (length=260 residues).
MALFGRKNHLDNETIKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAG
KKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRSKEMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDL
KQEYDMVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGYGYGY
GYGYGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A061CJK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. lactis] (length=258 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMANAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANRVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIVEDL
KQEYDMVVLDLAPILEAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGY
GYGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A063XHQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A063YHW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. CAMR5420] (length=232 residues).
MARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLSTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAIKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A068NE48 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLITHQQPKSPISEQYRNIRTNIEFAAVDKNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTDKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A069DFE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. TCA20] (length=229 residues).
MPRSTSNQHNLVTAVNPKAPISEAYRTLRTNIQFSAIDDQIKVLMVASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
RKPSLHQVFTVSNHAGLSSAIAAQYPVQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEERKEMYDIILFDTPP
VLAVTDAMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNLQLSKNQSNYYYYYGER
>gnl|bykdb|A0A069RKE1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptoclostridium litorale DSM 5388] (length=257 residues).
MNLLNELIVYQKPKSPISEAYRSLRTNIEFANVDNDKKLILITSSKQAEGKSTTVANLAVTMANMGKKVVIVDGDLRRPR
VHKIFGHTKIGGVTEILLSHCSYKGCVKKTEVENLDIITSGQTPPNPSEMLSSNSMKQILEEVRNDYDYVFIDSPPVAAV
ADAVILSGMADGVVLVCACGRVEVDMVRNTLQALENAGAYVIGSVINNIDVHDKKSGYYYYSPSYYGYCEDSNEKRKRKK
RKKKQAQSGLKAASGND
>gnl|bykdb|A0A072NPK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus azotoformans MEV2011] (length=235 residues).
MNLRRKKKLNTTNSKFRSLITHFDKKSPISEQYRTIRTNIEFSAVDKSYKTIVVTSSGPGEGKSTTTANLAVVFAQQNKK
VLLIDGDLRKPTVHYTFQLDNTIGLTNILTGQSTCDAAVKSSEVEHLSVLTCGPIPPNPAEMLGSDAMKKLLEHVAEQFD
IIIIDSPPVLAVTDAQILANLTDGIVLVTKSGQTEYDMAIRATELLKNSRAKLLGAVLNHKDQKQSNYYYYYGNK
>gnl|bykdb|A0A072XGX5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum C/D str. BKT12695] (length=234 residues).
MLIVEKEPKSIAAESYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
HISNEKGLSNYLVGEVSFEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEKSKKRRKSKK
>gnl|bykdb|A0A074IX11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVKSKENFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKIDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A075JRS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus sp. SK37] (length=233 residues).
MARRKNQSRPNNKMRHLIAKLNPKSPITEQYRTIRTNLQFASVDEELTSMLVTSSGPSEGKSMTTANLAVVYAQQGKKVL
LIDADLRKPTVHYTFRLDNLRGLSNVLVGEHTVEETVNRTDVDNLDVISSGPIPPNPSELLASRKMQTFLDDAKQSYDLV
IFDTPPVLAVTDSQILANIVDGTLLVIRSKKTELEAAQKAKEALEPAKAKLLGTVLNDREKKGSNYYYYYGTN
>gnl|bykdb|A0A075KI59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pelosinus sp. UFO1] (length=230 residues).
MTTTRKLIVHEDAKSPVAEAYRTLRTNIQFSKTDGELKSIMFTSTGPGEGKSTTTANTAVALAQSGKQVILVDCDLRKPV
QHKIFGKKNRGLTNILVEEVMADTYIQDTQVENLRLLSSGPIPPNPSELLGSIKMLELIDYLKNQADYVIIDAPPVIAVT
DASVLASRVDGVTLVINSGFVRPEMAQKAKDLLVKANGHLLGVILNRVEIEEEHAYYYYYYGSDSKKIAK
>gnl|bykdb|A0A075LU31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus goriensis] (length=230 residues).
MAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNIEFASVDTAMRSLLITSSGPSEGKSSTTANLAVVFAQQGKKVLLI
DADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQLIKKAQETYDMVIF
DTPPVLAVTDAQILANTCDGALIVVRSEKTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYYYYGS
>gnl|bykdb|A0A075SHU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis 6407] (length=228 residues).
MATLEIARKKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVVS
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTAIESGKVSPNPTALLQSKNFENLLATLRRYYDCVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A077J9G2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. X] (length=233 residues).
MVRKNKKKLVQNNKRSLVTMFNPKSPISEQFRTIRTNIQFSSIDQEVRTLMITSSGPGEGKSTTAANMAVVFAQQGRRVL
LVDADMRKPTVHYTFNQLNTYGLTSVLTRQMTLEKAVKETNEKDLFVLTSGPVPPNPAELLSSMAMERFFREAQEQFDMI
VFDTPPLLAVTDAQILANKCDGTILVVASGKTDKDQLVKARDLLDSVQSKLLGAVLNNKEMKNTNYYYYYGTK
>gnl|bykdb|A0A077UJH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSVVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSSYQESIISTEIEDLDVLTSGPIPPNPSELITSLAFANLYDTLLMNYNFIIIDTPP
VNTVTDAQLFSKFTGNVVYVINSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A077UW86 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAIIPTEIDNLDLLTAGPVPPNPSELIASERFKELVDFFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A078M2N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalicoccus saudimassiliensis] (length=235 residues).
MFGKKNHRKFQSGPRELVVDRKPKSPVSEHFRTIRTNITYSNIDNPVKSVLFTSATPNAGKSTVAANVAVAYAQAGKNTL
LIDGDLRRPTTHYTFEMQNVRGLSTAIINELPLNEVTRESGIENLDVITSGPIPPNPSELLSSKKMNLFMKMVTDHYDMV
IIDSPPALAVTDSQVLSQLTDATILVTNVDDNNRDSILQAKELMEKADANIIGVVLNNKKMDNKKDSYYYYYGSE
>gnl|bykdb|A0A080UG06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=231 residues).
MARKKTLRSLMSIRNIITMTEPKSLNSEQYRTIRTNIEYSSIDSQVKSLIITSAGPGEGKSTTAANLAVVFAQQGKKVLL
VDADLRKPTVHFTFRLDNADGLTSILLKQISFEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVI
FDTPPLLAVADPQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
>gnl|bykdb|A0A080UMB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=226 residues).
MGFRKKKAKRGLAQISVLQNKSLVAEQYRTIRTNIAFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETFQLENVTGLTNVLVGTCSLSETVQQTPIDNLYILTSGPTPPNPAELLSSKAMGDLILDIYDQYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKIDTVQKAKDALEQSKAKLLGALLNKKKLKKPDLYSY
>gnl|bykdb|A0A081BI99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus oryzae JCM 18671] (length=247 residues).
MPLFRRKRKINNDSLKNGVGLVAIDDSKSIVAEQFRTVRTNIQFSSVDEQVQTLLITSSDPSEGKSTVSMNLAAVWAQQG
QKVLVLDADLRRPTVHRTFSLSNRAGLSTYLSHLASYEDIIQESGMENLSVITSGPIPPNPAELLNSKGLSDLLEQLKAN
FDVVILDAPPVNTVTDAQLLAHKTDGVILVVPQGIAEKSSVAHAVDMLKKVHANILGTVMNRFQSSKAAGYYGGYYGGYY
GVDEKND
>gnl|bykdb|A0A081LFN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus zhangzhouensis] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSAPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A081NSB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTIDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGYGEDNGK
>gnl|bykdb|A0A081NZL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus tyrfis] (length=226 residues).
MSKSAKRRPVIAHSHPKSPVSESYRTLRTNIQFSSVDRLCRTLMVTSSSPMEGKSTTINNLAVVYAQSNRKVLLIDADLR
KPTAHHTFHLSNRYGLTDVLTSQCTLEMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPV
LAVSDAQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGNE
>gnl|bykdb|A0A081PNQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGETNRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A081PWY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=236 residues).
MPTLAIAQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLSISSVKPGEGKSTTSINIAWTFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIENLFVIQSGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTPPIGVVI
DAAIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNTEVEKYGVYGGYGAYGSYGNYGNYGKK
>gnl|bykdb|A0A081PYH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNVQLSGNDLKVIVVTSVDSSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVFSPNPTALLQSDNFGIMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVVESGAAKRREVQKAKSQLEQAGKPFLGVVLNKFDVQREKYGSYGGYGNYGKK
>gnl|bykdb|A0A081Q1Y0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MYIEVIHNSKSLVAESFRTLRSNLQFSEFGKNIKLIVITSANPNEGKSEVSINLAASLAQQGKKVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKRSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMEETLRAFEDFYDYVIIDTPPLLAATDA
QVLASIADATLLVVDIKSSKRRQVVEAKRRLDHVGARLLGVVMNKIDSHKDTYYYYY
>gnl|bykdb|A0A081Q9T1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEIAQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A081QKT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A081QSB1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLVIAQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSIMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFATMIDTLRKYFDYVIVDTAPIGMVI
DAAIIAQKCDASILVTAAGETKRRDILKAKEQLEQTGTSFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A081S992 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEISKKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIDNLFVIQAGPISPNPTALLQSENFHTNIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDILKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A084A7R4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris GE214] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNTNILGVVLHGVNSSESPSYYYYGVE
>gnl|bykdb|A0A084GXZ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus indicus] (length=232 residues).
MARKDRKQLFQTQSRSLISMTAPKSPIAEQYRTIRTNIQFSTVDEEITSIIVTSAGPGDGKSTTAANVAVVFAQQGKKVL
LVDADLRKPTAHYTFKIDNHSGLTNVLTKQISVTQAAKYTDQENLYLLTSGPIPPNPSELLASKGMKQLIEDAKRDFDLI
IFDTPPVLVVTDAQILSNLVDGAILVVSSGKTDLEGAKKAKDALLQSQAKILGTVLNNKKQQDSQYYYYATK
>gnl|bykdb|A0A084JIG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sulfidigenes] (length=217 residues).
MHIVEKEPKSIVAESYRTLRTNLQYSSFDGEYKVIVITSPNPTEGKSTVAGNLAISLSKGDKKVILIDCDLRKPVLHKRF
KLSNATGLSDIILAKETRVIVGQRYNENLIVITGGTVPPNPSEMLGSKYMTNLIAALRELYDYVILDTPPIQLVTDAQIL
SAKADGTILVVKAEETKKSSVHNAIDLLRKVNANIIGIVLNGVENKGNSYYYEDGKV
>gnl|bykdb|A0A084JQH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] celerecrescens] (length=233 residues).
MRKVTFRRKDKLDFKANEAFKTLRSNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
RYKVDGNTYGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVID
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYYGKYYGKYYGSYGES
>gnl|bykdb|A0A087END6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGDLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNISNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGAVMNMSKDNMTNDYYYYYSK
>gnl|bykdb|A0A087LB64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARSNRQQFKRLERSLITAEDPKSPIAEQYRTIRTNIQFSFIDRPLRSLIVTSTGPGEGKSTTVANLAVAFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQVTEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQVLANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A089I9N8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H7-0357] (length=229 residues).
MSQQPNKQQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQVIMVTSSGPEEGKSTVSANLAAAYAQSDKKVLLIDSD
LRKPTAHKTFSLSNRLGLSSLLSQQANLDEVIQESGVDNLYLMTSGPIPPNPAEMLSSNRMSSVLQELRQRFDIVLIDTP
PLLAVTDAQIVSSKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089IMT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H7-0737] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVSNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089K8S8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R5-0912] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQADLSEVIQESGVNNLALMTSGPIPPNPAEMMASNRMSAVLQELRQLYDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089KIQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R7-0273] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSIDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
RKPTAHKTFSLSNRHGLSSLLSQQSNLNEVIQESGVPNLFIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089L5M6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R7-0331] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSIDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
RKPTAHKTFSLSNRHGLSSLLSQQTNLNEAIQESGVPNLSIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089MVS2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus borealis] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQVIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQAELSEVIQESGVHNLSLMTSGPIPPNPAEMMASNRMSAVLQELRHLFDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAIKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089NNP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus graminis] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDKQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQAELEDVVQDSGVTNLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A091BU30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus JB1] (length=237 residues).
MPQLELVRAKAQMIKNLEEYYNTIRTNIQFSGRNLKVIALTSAQPGEGKSTTSTNLAISFAKAGFRTLLIDADTRNSVMS
GTFKSKERYDGLTSYLSGNAELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYVIIDTPPLGRVV
DAVIIAHSSDASLLVTKPGADKRRTITKLKEQLEQSGAVFLGVILNQFDIRRDYYGSYGSYGSYGEYGKSSKKEDKK
>gnl|bykdb|A0A091C8N8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus muriaticus 3MR10-3] (length=231 residues).
MKKERTNTKTQPVSLISLVDPSSSVAEQYRTIRTNLQFASSADQQVQTLVVTSSGPREGKSLTSANLAVVFAQTGQKVLL
VDADMRKPTIHKTFQLSNEAGLSTVLSTGVSLEETAQKTTIENLSILTSGPKPPNPSELLGSEKMNQIMEEARHLFDMVI
FDMPPVVTVTDAQVMSSKADGTLLVARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
>gnl|bykdb|A0A091CF20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus muriaticus PMC-11-5] (length=231 residues).
MKKERTNTKTQPVSLISLVDPSSPVAEQYRTIRTNLQFASSADQQVQTLVVTSSGPSEGKSLTSANLAVVFAQTGQKVLL
VDADMRKPTIHKTFQLSNEAGLSTVLSTGVSPEETAQKIVVENLSILTSGPKPPNPSELLGSEKMNQIMGEARDLFDIVI
FDMPPVVTVTDAQIMSSKVDGTLLIARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
>gnl|bykdb|A0A094WDF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus alcalophilus ATCC 27647 = CGMCC 1.3604] (length=230 residues).
MARRELKSTGKKRALIAHERKKSPISEQFRTIRTNIEFSSVDKQIKTLLVTSPGPGEGKTTTAANLAIVLAQNGNSVLLI
DADLRKPTVHHTFGVLNTRGLTSLLTKKEDLEHTVQASEIEGLSLLPSGPNPPNPAELLSSKTMEHLLQSLGEKYDMIVL
DTPPVMAVTDAQVLGNRVDASVLVVSNGKTDRNQAVKTKELLTQTSSKLLGVVFNNKEVKKGHYYYYYGE
>gnl|bykdb|A0A096BIK4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptoniphilus lacrimalis DNF00528] (length=230 residues).
MAKLELSEQRLHSVKKAEEYYNALRTNIQLSGDGLKVIALSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSDKFEAMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKDQLEQTGTPFLGVILNKFNIQLEKYGSYGSYGNYGSYGKK
>gnl|bykdb|A0A097APZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter kivui] (length=236 residues).
MVAARNLIVADPKSPFAEAFRALRTNLQFTSVDKKVKSILITSSLPNEGKSTVVKNLAYSVALTGSKVIVIDADLRNPTV
HKLLYLPNSRGLTNLLIDEGDYEAYLNIDNSYSNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTV
TDAVVLAPVVDGIILVIQAGKTEIEAVSRAKEILESVKANILGVVLNRVKESHKGYYYYYYYYDDNNPQHKKRRKR
>gnl|bykdb|A0A097RAE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A098D0V9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus garvieae] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGKKVLLID
SDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNTNILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A098EIC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus massiliensis] (length=235 residues).
MARKRQKKVLQETARKVISFTNPRSYVAEQFRTLRTNINFSSPDSDIRSLLVTSAAPSEGKSTASANLAVVFAQEGKRVL
LVDADMRKPTTHYTFHMGNTQGLSSVLTRQIEAEAAIRETEIERLDLLTCGPIPPNPAELLASKSMDALIEQLKETYDII
IFDAPPVLSVTDGQILASKCEGTILVVNSGTTEKEMALKAKEAIASSNSRLIGAVLNNFILPKDNYYYQYYGAEK
>gnl|bykdb|A0A098EJV4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus massiliensis] (length=228 residues).
MSKSKKKIDRTGRKLVAYTMPKSFVSEQFRNVRTNIHFSTPDKEIRSLAITSAAPGEGKSTAAANLAVVFAQEGKKVLLI
DGDMRKPTMHHTFEIRNTVGLSSVLTRRLPVEAAIKKGPISGLHLLTCGPIPPNPAELLASETMAQLIQHLGKSYDLVIF
DSPPILSVADGKLIADHCEGTVLIINSGTTEKRGALKAKEMIEMTSSKLLGIVLNNFTSTKETYYYQY
>gnl|bykdb|A0A098FGJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSVHYAFNLSNIHGLTSVLTKKMDFRKTILNSNVLNLDILTSGPIPPNPSELLNSKAIETAIDELKEIYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVILNGVETDNSNYYYYQS
>gnl|bykdb|A0A098L087 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus thermoleovorans B23] (length=235 residues).
MKPLARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKK
TLLIDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFD
LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A098M8F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus wynnii] (length=228 residues).
MSQQLSKQRQLITLTNPRSPVSEAFRALRTNIDFSSVDERIQVIMVTSSGPEEGKSTVSGNLAASYALSDKKVLLIDADL
RKPTAHKTFTLSNRYGLSSLLSQQVDIEDAIQDSNVPNLSIMTSGPIPPNPAEMMASNRMTAVIQELRQRYDVIIIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAIKAKANLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A099DJJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium mexicanum] (length=238 residues).
MFKFGKKKSKHIKYDKTGRELITVHKPKSPISEQYRTIRTNLEFTAVDDDLQTMVITSASSGEGKSTTSSNLAVVYAQQG
KRVLLVDCDMRRPTAHFTFRLSNGIGLSTVLAKKTTVEKATHSTQVENLDLIAAGPIPPNPSELLSSKMMDRVLEELKTN
YDIIILDAPPMMQVADTRLLARKVDGVVLVVGCDKSDRQMVVKAKEQLTLAEAHILGVVLNKREPQGSDDYYYYYAYE
>gnl|bykdb|A0A099DKC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium mexicanum] (length=231 residues).
MSKRQDKHRDSGRSLITLANPKSPIAEQYRTIRTNLQFTALGATLQTIVVTSASPGEGKSTTASNLAIVYAQLGKKVLLM
DCDMRKPTVHFTFQLAGQTGLSTVLAKRTTFDRSVQMTKVPKLHLLAAGPIPPNPSELLASPMMKQLLDEVKEKYDLIIL
DAPPLMHVADSRLLASETDGTILVVGCDNSNRDLVLKAKEQLILSGAHMLGIVMNKRERAGKDAYYAYTYE
>gnl|bykdb|A0A099HWI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. NCR] (length=237 residues).
MINITAFNDPKSPIAEAYRSIRTNIQFSRVDNEMKTIVVTSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVH
KMFSKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIMD
AGVLANYADGTILVVGAKDVETERAKISKERLEKVKANIIGAVLNKYIEKNGSYGYYSYYYEQSDGSRVSKKKKKKR
>gnl|bykdb|A0A099I0N3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium innocuum] (length=238 residues).
MERKIAPKRSDPKKHTKKSQFDNMEVYRQLRTNIEYSSFNKDIQVICVTSSNPAEGKSSVASNLATVAIAKYEKVLLIDC
DLRKPVQHKIFKVSNKLGISNLMKEKSEIDLEIGGYFQKFKDNSTDGKLYVLTSGKSVPNPQEMLESERFKELIEKFREM
FDYIIIDCPPLNAVADAIPVSSIVDGTLFVVSAMDTDKSEAKNALTMLQRNGANVLGCVLTKVDITSKSYYSYYGNYS
>gnl|bykdb|A0A099SBU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. HMP27] (length=245 residues).
MNESYLISIKNPMNPISEAYRTLRTNIKFSSFDKEIKSLVITSSGPNEGKSTTACNLAIVMAQTGSKTILIDCDQRKPSI
HKVFGLSNECGLSNILADEVEFKDAVYKTQIENLEMLPSGTKPPNPSEILSSEKMKRFLQRLKEKYDSIIIDTPPIVAVT
DAQLLSTYVDGCILVVASGQTDRGAAMKAKGLLDKVGAKILGVVLNKVDTSNKGYYGARYYNYYSEDYECKKRKRLFNIG
VRHFG
>gnl|bykdb|A0A099SCK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. HMP27] (length=233 residues).
MKVSELITIRKPLSPISESYRTLRTNIKFSSVDKEIRVIVVTSSGPGEGKSTTASNLAAVMAQAGNKTVIIDCDQRKPRL
HKVFGLSNERGISDILAKEIKFDDAVQSTEQENLDIITSGTKPPNPAELLASATMKEFLESLKEKYDTIIIDTPPIVAVT
DAQLLSRHADGCILVIASQQADRDAAIKAKELLEKVDANMLGVVLNKVDTTHKGYYGAYYSYYAEEDGSDKNK
>gnl|bykdb|A0A099SE90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. HMP52] (length=232 residues).
MAFSLITHEQTKSPISEAYRTLRTNVQFTGVDTKTKKIMITSSGPREGKSTTVANLAVSIAQSGKTVLVIDADLRNPTQH
KLFELGNFEGLSTFLVQDEQNKDFIKETEVPGVKVLTGGPIPPNPAELVGSQRMKRLIEEVSEQFDMVLIDTPPIIAVTD
AAVLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADMKTSEYYYYYYYHGSDDHKKKKRS
>gnl|bykdb|A0A099VVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=216 residues).
MRTKEMLNENLFFQEQMAHIRTTIELSGQRDTQAISVTSSLSSEGKSSIAIGIARSFAEAGKKVLLIDSDFRRPSVHKKL
GLSNAVGFCDVLKEDYTLTECMKDIGVQGLDILTSGLVEDSPSILFDATTLKKFILEVKKEYDLVIIDTPPVLLVPEVKT
ILNHSDATLLVVKYDEVRKEEVERTYRVLNQVSATCLGIVFNRVKVKVKDRYRYYY
>gnl|bykdb|A0A099VXM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=225 residues).
MSRPKITKRKLITAVNPSSPISEQFKTLRAGIHFSSVDKEYRSILVTSPEPESGKSTVSANLAICYAKQGNKTLLIDADM
RKPTSHRTFGIPYNVGLSNMLTDSKTEFKDVCHPTEIENLMVLTSGTMVPNPNELLGSNRMEQLLKHLSEQFDQIIIDTP
PILASSDALVLTPYVEGAIVVLCSDKTLKERAKIAVQQLQKTHIPIIGTVLNRVTNNSDNYYYYQ
>gnl|bykdb|A0A099VYT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=227 residues).
MVIQKKAKQRTLITNEKGTIPEQFRNIRASIQYVADKKKIKTIMATSCRQGEGKSSLIANLAMFMSKSGKRVLLIDGDLR
LPTIHRIFKLKNYVGLSDLLKDDQFHRYEGIQKIDDYLDVMASGASPYNPSELLSDSLLPEILKEYETVYDFIFIDAPPI
GLSDTIITANYCDATILVLENGKTTKTQLKECIEKCKMQNIDVLGIIRNKVKRRRHESSYYYDYVKK
>gnl|bykdb|A0A099W1Z2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=231 residues).
MMRRKVKKVQRDDRKLIVQNKPLSPLSEQFRMLVENIELMSIDKKIKSLLVTSADPSSGKSLISSNLAIAFAQKGKKTLL
VDADLRKPTIQKYFRNGVNLGLMGLIKKESDLHGAIFESESPNLFILQTGIIPINPASILASDRLKEIFAELEAAFDYII
VDTPPILAVADAQVLSGMTDASLLVIRNDYTVTERARKASQRLEQSSRLFLGAVFNNQKQKEDHYYYKERN
>gnl|bykdb|A0A099W967 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=238 residues).
MKKSKKKSKAETRHRRQKSTEPQKLVAKLSPKSPHSELFRSIRTNIEFSSVDKVMKSILITSSEPDSGKSIICANLAVVF
AQQGKKTLLIDADLRKPTVKKIFPGAASHGLTGILTNKITVSEAICETDVEDLYVLPAGIVPPNPSELLGSEKMKQVYAE
LYELFDQIIFDTPPIQLVVDAQLLCSFVDGSILLVRSDHSSRENSKKALEKLRSGSAHVIGSIFNNQKMKMEGYYYAN
>gnl|bykdb|A0A099WC17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=227 residues).
MSHRRQKTDEPQKLIAKINPKSPHSELFRSIRTNIEFSSVDKPMRSILITSSEPDSGKSLICANLAVVFAQQGKKTLLID
GDLRKPTVKKIFPEAVSHGLTGILTNRVTIDEAIRETEVENLYVLPAGVVPPNPSELLGSEKMKQVYAELYEIFDQIIFD
TPPIQLVVDAQLLCSLVDGSILLVRSNHSSKENSKKALQKLQTANAHVIGSIFNNNKMKMDGYYYAD
>gnl|bykdb|A0A099WC93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=231 residues).
MIRRKPKDSQRDDQKLIVQNKPLSPLAEQFRMIVENIELMSIDKKIKSLLITSADPSSGKSIISSNLAVAFAQKGKKTLL
IDADLRKPTIHKYFRNEVSLGLMGLVKKESTIEGAIFESDSPNLYILQAGIIPANPTSILASERLKEVFAELEELFDQII
VDTPPILAVADAQILSGMTDASVLVIRNDYTVTERARKASTRLEQSSKLFLGAVFNNQKQKQDHYYYQEKE
>gnl|bykdb|A0A099WCP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=226 residues).
MVIKKQYSERQLIKKEKGVIPEQIRNIRTNIQYLADKRNLKVIMVTSCRQGEGKSSAIVNLAYFMAKNNKKVLVIDSDLR
LPTIHKPFQLQNFSGLTDFLNELMDEKETIQQVAENLDVVTSGPLPYNPTELLSKKRFKTFIDTQRVDYDFIFVDAPPSG
LADSKIIGSVCDSTIIVVENGKTTKNQLKTCIDTCKMQNIDIIGVIRNKIRKKKHDSNYYYNYVKE
>gnl|bykdb|A0A099WD98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=225 residues).
MMRKAKNKEDKKLTVFTQRNTQIAEQFRMIRTGLQFLAEKRSAKHFMVTSSASGEGKSVVIANLAAFFAQQDKRVLIIDG
DLRRPTQHDIFQVENYYGFADILKEETNVKKAIQKTAVENLDVLVSGMLPYNPAELLASFDFDAFFAELDAAYDFIFIDA
PPAIVADTPIIASKVDGVIVVVGLRTVKRSKLEQTIREVKTAGANVVGIICNKAKPTKKTAYYYK
>gnl|bykdb|A0A099WF84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=231 residues).
MRNKNKQKKNNRKKLVTYFDPRSPISEEFTSVKTNIEFTTISQASQVLMITSAEPDAGKSIMASNLAVVFAQQGKKTLLI
DLDLRKPTQHRVFFSNNEIGLTGLLVKSECRTKAIQDTEIDKLQVLASGHIPPNPTEILNAPKLAELIETLREEYDQIIL
DAPPVLVASDARLIARLADGIIFIIKSGASEYKKIAKSIELLQQTQTKILGTVLNNPNAQAARMYYTYSDK
>gnl|bykdb|A0A099WGM2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=234 residues).
MMRFKIKPKKKPNISIMQKESNSISSEQLRTIRTSIQFASTEKLSTMVVTSPEPGAGKSFISMNLAISFAEQGNKVLLID
ADLRRPTVHTTLRLSNELGLSNYLAGQGKLEDCLQEITMHENLFVITSGIIPPNPAELLSSTKMKEFTKIVSDMFDIVIF
DAPPVLPVVDPLIIGNIVDGLILVLRSEHTDQSDAVQTLDKIKQSKIKMIGAVLNGRKNRGDSYKTVYYTKNQK
>gnl|bykdb|A0A099WGS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=216 residues).
MRTKEMLNENLFFQEQMAHIRTTIELSEHQAIQAISVTSSLSSEGKSSIAIGMARSFAEAGKRVLLIDSDFRRPSVHKKL
GLSNAVGFCDVLKEEYRLADCLKDIGIQGLAVLTSGLVEDAPGTLFDAARLKKFMLQVKQEYDLIIVDTPPVLLVPEVKT
ILNHSDATLLVVKYDEVRKEEMDRAQRVLNQVSATCLGIVFNRVQVKVRDRYRYYY
>gnl|bykdb|A0A099WHQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=225 residues).
MNKQDFSKRKLIAATNPSSPIAEQFKTLRAGIHFSSVDKDYQTILVTSPEPESGKSTVSANLAICYAKQGKKTLLIDADM
RKPTSHRTFGIHYNVGLSHLLADSGIELEDVCHQTEIDNLMVLTSGALVPNPNELLASKKMEQLIQQFAEQFDQIIIDTP
PILASSDALVLTPYVEGAIVVLRSEKTLKDRAKTAVKLLQKTHVPIIGTVLNRVKNHSNSYYYYQ
>gnl|bykdb|A0A099WIC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=222 residues).
MQKERSKLLIRHQKGSRIAEQFRIIRTNIEFISKKRALKTIMITSTKPQEGKSTIIANLADVMGRQELKVLIIDADLRLP
SQHYILGVDNSLGLTDILKEKATIETVIQNTSLFNVDIIAAGQSPNNPSELLSKTVLKDLLETVKKYYDYILIDAPPVIV
ADTTIVAQKIDGVIMVAEENKTPKQKFQKALNTLKSTNTPILGIILNKTKQEKSSKYYYYNK
>gnl|bykdb|A0A099WLQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=228 residues).
MLSLSRKKNKPPVNRLAQLGGNKSVNEQFRIIRTNIEFVSMGQNNVYLITSSIPGEGKSTITSNIAMTFGQQNKKVLLID
GDMRRPTQDKLFRRLNNVGLSTLLANQHTLEEAIQPIEEYNIDFLPSGPVPPNPAELLSSTKLEKLLEECKQKYDLIFID
SPPLIDIADGPILASKVDGTFLIVRAYKTYKAEIQKSVQILEQSNSKVMGYILNDVKKQGQGKNYYVY
>gnl|bykdb|A0A099WNP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=222 residues).
MQKERSKLLIKHQKGSKIAEQFRMIRTNIEFISKKRSLKTIMITSTKPQEGKSTIIANLADVMGRQDLHVLIIDADLRLP
SQHYILGADNSVGLTDILEETVDLEAVIQNTVLVNVDIIPAGQSPNNPSELLSKAALPALLETVKKQYDFILVDAPPVIV
ADTTIIAQEIDGIIMVAEENKTPKQKFQKALTTLKSTHTPILGIILNKTKQDKSSKYYYYNK
>gnl|bykdb|A0A099YA02 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae] (length=252 residues).
MGIFKRKSRVDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQEG
KSVLLIDADMRRPTLYSTFDLAGQEGLSTVLSSNQSEVNLNDVIQESGIEGLDLLPCGAVPPNPAELLSSQRMKVLLEAV
QAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAIELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
GYGYGYEKESEN
>gnl|bykdb|A0A0A0DE45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sinensis] (length=236 residues).
MPRLELSRSRKASIEKTEEYYNALRTNIQLSGDNLKIIALTSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSVMS
GVFKSKEKITGLTDYLAGKTDLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYIIVDTPPIGLVI
DAAIIAQKCDASLLVTEAGAVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGIYGAYGNYGNYGTKKEK
>gnl|bykdb|A0A0A0E6N1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus niacini] (length=226 residues).
MKTTDPSRKLIASLDPKSPISEQYRTIRTNIQYSSVDEELKTIMVSSSGPGEGKSTTAANLAVVFSQLGKKVLLVDADLR
KPTVHRSFAVNNLFGFTTVLTKQATLANTVVETEEKDLFILTSGPIPPNPAELLSSKSMEQFMEEAKEQFDYVVFDTLPL
LAVADPQIIANKVDGSILVVFSGKTEIDQVKKAKELLVNAQSKLVGVVLNHKEMKDNDYYYYYGAK
>gnl|bykdb|A0A0A0I9D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium novyi A str. 4552] (length=234 residues).
MLIVEKEPKSIAAESYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
HISNEKGLSNYLVGEVSFEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEKSKKRRKSKK
>gnl|bykdb|A0A0A0U203 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=229 residues).
MLTRKKDKFAKRSVITMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQIPFQKAVLPADEANLDILTSGPIPPNPAELLSTDAMKDLLSEATDVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKRQTKHSDYAYYGQ
>gnl|bykdb|A0A0A0WSD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A0A0Y931 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus iniae] (length=239 residues).
MSQLNLVRSKREHYQHAEEYYNSIRTNIQFSGRDYKAIVLTSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILHKVDQQLGSYGAYGSYGDYGKTKKSSKSKKHSRK
>gnl|bykdb|A0A0A1E060 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGTQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVAKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A0A1GUU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hokkaidonensis JCM 18461] (length=243 residues).
MGLFSRTKKLSTDTIDNGVKLIAAAKPKDVISEQFRTIRTNIDFSSVDKQLKTLLFTSSNVSEGKSTVSANTAVTWAQQG
KRVLFIDADLRRPTLHTTFGLNNTQGLSTILTQSLDFHDHVNDSGIENLTVITSGPVPPNPAELLNSKRMKELLAQVEQE
YDVVMLDVPPLLSVTDTQVLAASVDGVILVVRQGVAQQAAVKRSVELLEMVHAKLLGYVLNDVAPKNGYGYGYGYGYGYG
YEQ
>gnl|bykdb|A0A0A2HID6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=236 residues).
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNSIDKVIQQSGIDNLHILTSGIKPPNPSELLSSKKMKKFIDMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTAFGQVERELAIRAKQLLQKVNAKILGVVLNKVDINSGNGYRYYNYYYEEDGKKKKRSKK
>gnl|bykdb|A0A0A2TSP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. Tol-M] (length=242 residues).
MAYSLVTFEQTKSPIAEAYRTLRTNVQFTCVDSDTRKIMITSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQH
KLFGLDNAQGLSVALVQDKDYRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
AAILAQEVDGVILVLASGEVNKEFAQRAKELLDKVGAKILGAVLNKADTKTSEYYYYYYYHGSDDTKKKHKRRKDRSAPS
EG
>gnl|bykdb|A0A0A2TXU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. MAEPY2] (length=227 residues).
MPRLTNEKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPAVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEVYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKRRNAYYGENA
>gnl|bykdb|A0A0A2TZ57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus yanchengensis Y32] (length=231 residues).
MARKKNLLMKARTLITNFNPKSPISEQYRTIRTNLQFASVDRDLRTMIVTSPGPGEGKSMTAANIATVFAQQGKKVLLID
ADLRKPTMHYTFRVDNSKGLSNYLVGSDALFETAAASGIENLHVMPCGPIPPNPAELLGSKAMNGLIEEAQQEYDLVIFD
TPPVLAVTDSQILANMCDGALLVVRSKQTENDSAQKAKELLENAHAKILGVVLNGKQIKKSNYYYYYGTNA
>gnl|bykdb|A0A0A2U1F1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. Tol-M] (length=242 residues).
MAYSLVTFEQTKSPIAEAYRTLRTNVQFTCVDSDTRKIMITSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQH
KLFGLDNAQGLSVALVQDKDYRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
AAILAQEVDGVILVLASGEVNKDFAQRAKELLDKVGAKILGAVLNKVDAKTSEYYYYYYYHGSDNTKKKHKRRKDRSAPS
EG
>gnl|bykdb|A0A0A3HN53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sinduriensis BLB-1 = JCM 15800] (length=236 residues).
MFNKKNKKNKKQAKKPRKLVTMSDDNAFISEQFRTIRANINFSLPGQESKTILITSSLAGEGKSTIAANIAVVFAQEGKK
VLLIDADLRKPTLQFTFNIRDHIGLTHVLIGKNYYFNAIQETPIPGLDVLPCGAIPPNPTELLSSKNMDTLLIDLKEKYD
LIILDGPPLITISDSQILGNKCDGTLFIISSGISKKEDLLKSEEILSTSKAKIIGIVLNNYKLSKNDYQNYYTYTN
>gnl|bykdb|A0A0A3HUS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus manganicus DSM 26584] (length=236 residues).
MAKKKSSKPNSSTSTAPKTLISFTEPKSYIAEQFKTLRTNINFTLPGDDAKKLLVTSTIPGEGKSTITANLGFVFAQEGK
RVLIIDADLRKPTLHATFNLPNKIGLSNMFTKQVSFVHAIKETFIYDLYVLPSGPVPLNPSELLSSKTMDQFLKTIEDYF
DVIIFDAPPILTVTDAQILSNKCDGTVLVINSGTVNRKELLKAKSALLSSHANILGVVLNNFNSKTNNYYEKLYKS
>gnl|bykdb|A0A0A3HYW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus manganicus DSM 26584] (length=230 residues).
MLRRKEVDPLRRKPKNLITLSEKNSYIAEQFRTIRANIKFIQEEQKFKTAVITSSIPGEGKSTNAANIAVVFAQEGKKVL
LIDADLRKPTMHYTFRLQNEFGLSNILSGLSKSNFGIQETLIDGLDILTSGPIPHNPAELLASTYLDILLEEVRSNYHII
IFDTPPILAASDAQILANKCDGTILIANIGYVKKWELEKTNASIHASKANLLGIILNNYKLAKSSYYYYE
>gnl|bykdb|A0A0A3I189 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus manganicus DSM 26584] (length=234 residues).
MFKKKNKIGNAMARKLIVQAAPKSYISEQYRSIRTNIKFSMPDQDLKTLLVTSSGPSEGKSTTSANIAGVFSQEGKRVLL
IDADMRKPTAHYTFKLRNSHGLSNLLTKQCEIHEAIQQTNVEGLWVLPSGVIPPNPAELLASNQMEFVLEQLKQDFDLII
LDAPPILSVTDAQIISHKSDATILVVNSGATGKEEVAKAKDILDKSKANVIGVVMNNFALQKDHYYYQYYGNEG
>gnl|bykdb|A0A0A3ID23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus boronitolerans JCM 21713 = 10a = NBRC 103108] (length=233 residues).
MFWKKKKKKKLVKMARKLVTIANGQSFISEQFRTIRTNITFSMPDKEIKTILVTSATPGEGKSTNAANIGVVFAQEGKRV
IIVDADLRKPTMHYTFLLQNARGLSNLLTRHFTMSEVINSTDIANLFVLTSGPIPPNPAELLASNVMESVIENLKKEFDI
IIFDAPPILSVTDAQILSNKCDGTLLIVNSGVAENESVLKAKSNLEASKANILGVILNNYKMPLHQYYEQYYY
>gnl|bykdb|A0A0A3IGK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sinduriensis BLB-1 = JCM 15800] (length=233 residues).
MLKRKRKKSNTMSRKIVAATHPKSINAEQYRTIRTNINFSMPDQELRTLLVTSASPAEGKSTTASNISVVFAQEGKKVLL
IDADMRKPTSHHTFKLTNMYGLSTVLTRQGEVEEAIQKTDVENLWVMTSGPIPPNPAELLASKNMDFLYSRLQEDFDLLV
FDTPPILSVSDAQIVSNKVDGTVLVINTGQSEKESSLKAKELLLSAKANILGVILNNFNLEKNQYYYQYYGEG
>gnl|bykdb|A0A0A3INZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus odysseyi 34hs-1 = NBRC 100172] (length=241 residues).
MFGRKNRDRKKQIKLLKAGRKLITLLDGSSIISEQFRTIRTNITFAMPDCEVKTILVTSTIPGEGKSTTTANLGVVFAQE
GKRVLIIDADLRKPTLHYAFGLFNTVGLSNVLVRKRAFYESIQETSVSGLAILPSGPIPSNPAELLSSKTMDALLDELKN
LYDIIIIDAPPVLPVTDAQVLANKCDGTLLVANAGVITKELIIKAKSILATSQANMIGVVLNNCKMPRDHKRYYGYYGAG
H
>gnl|bykdb|A0A0A3J677 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus massiliensis 4400831 = CIP 108448 = CCUG 49529] (length=222 residues).
MSVPLARKLITSTSPKSIISEQFRTIRTNIEFSSPDQTIKTILVTSSVPGEGKTTTAANLAVVFAQEGKKVLIVDSDMRK
PALHYTFDILNEKGLSNVLTRHQNHFLALSNTNIENLFIIPSGPIPPNPSELLSTQKFEIFLEEVKELYDLIIFDAPPLL
SVTDAQILSHKCDGTILVVKSGFVDKVDVLKAKTSLNTVHAKILGVVLNNYNTTNSNYYEYY
>gnl|bykdb|A0A0A5G2V2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus litoralis JSM 072002] (length=231 residues).
MWKKQRKPSRHQARTLITDLNPKSPIAEQFRTIRTNINFSFVDTDMETLMVTSSGPSEGKSSITANLAVVFAQQGKSVLL
IDADLRKPTLHYTLRTNNTVGLSSCLVGTQTLEETVQTTAIDNLYAMTSGPIPPNPSELLGSRAMRKLIHDARAKYDVVI
FDTPPVLAVTDAQILSNLCDGTILVVRHKQTDIEQAKRAKELLDKAEGKLIGTVLNDMNKQKQNYYYYYGD
>gnl|bykdb|A0A0A5GCT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus marinus BH030004 = DSM 16465] (length=233 residues).
MARSKKKSLLNKARTLITNTNPKSPISEQYRTIRTNLQFASVDSELRTMLVTSAGPSEGKSMTASNVATVFAQQGKRVLL
IDADLRKPTVHYTFRVDNMKGLSTYLVGQGSLSETVSESHIENLDILPSGPIPPNPAEILGSQAMSTLIQEAQQSYDLVI
FDTPPVLAVTDSQILANACDGVLLVVRSKQTENEAAEKAKELLEKAQAKLLGVVLNGKEIKNSNYYYYYGNSS
>gnl|bykdb|A0A0A5GPK9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus halophilus JSM 076056 = DSM 19796] (length=232 residues).
MARRKKNVTQKARNLITNLNPKSPISEQYRTIRTNLQFASVDNELRSLLITSTGPSEGKSLTSGNLATTFAQQGKKVLLI
DADLRKPTAQYTFRVPNVKGLSNYLVTKDSTLTDLVHQTEIEHLDVLPSGPIPPNPSEILGSKAMVRLLEEALELYDQVV
VDAPPVLAVTDAQILANLVDGVLMVVRSKQTDNEAAIKAKKLLDAGNSKLLGVVLNDKEAKSSNYYYYYGQS
>gnl|bykdb|A0A0A6S102 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus uberis] (length=240 residues).
MVQLELVKSKKNLYDIAEEYYNSIRTNIQFSGRHLKVITLTSVQPAEGKSTTSTNLAISFAKAGFKTLLIDADIRNSVMS
GTFKANEKYEGLSSYLSGNAELSAVISYTNIPNMMLIPSGQVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADATILVTEAGVIKRRFIQKAKDQMEQSGVQFLGVILNKVEDTIDSYGGYGSYGSYGDYGKSKRKKKSSRKK
>gnl|bykdb|A0A0A7FX28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii str. Sullivan] (length=215 residues).
MFVLEKQPKSVEAESYRILRTNIMYSSFDKKIKRILVTSSEPGEGKSTTSGNLSLAFAQDEKKVILIDCDLRKPSLHKKF
RISNNRGLSDVIIDRDKLNKCIQKRTEYLDILTSGKIPPNPSEMLGSQAMTSLLDELSNIYDVIILDSPPVLAVTDAQIL
STKVDGTVLVVRAEKTKKDTVLATKGVLDKVNANILGTVLNAGDKNKDNYYYYYG
>gnl|bykdb|A0A0A7FZ06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii str. Sullivan] (length=217 residues).
MFIVSKDPKSIAAENYRILRTNIQYSSFDKEIRRVLVTSSEPGEGKSTTAGNLALTFAQDGKKTIIIDCDLRKPSLHKKF
NVSNSIGLSDVIIDKKNIEKSVKKIEGNLDILTAGKIPPNPSELLGSKALNNLLEALEEVYDVIVIDSPPVLAVTDAQIL
SKKVDGTVLVVRSNYTKKDTVMAAKDVLIKVKANILGTVLTRTDSNKHGYYYYYGRE
>gnl|bykdb|A0A0A7M6J2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=227 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYRNYGRK
>gnl|bykdb|A0A0A7P9W0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0A7U4K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis BSO 464] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTKVVLVDADLRRPTVHCSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGYYGTDDKK
>gnl|bykdb|A0A0A8HNH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus hyicus] (length=235 residues).
MFKSKKHKKTTTNKKKLIVDHTPKSPVSEQFRGIRTNISFSNVNDDLTSVVITSARPSSGKSTVSANLAITYAQSNYRTL
IIDADMRKPTQHFIFELSNKEGLSSLLSGQSSGDIAIKQTHIDNLDVLTSGPVPPNPSEMLNSKAFRNVFESALDVYDFI
VIDTPPVNSVTDSQLVAKISKQVVLVIDVNNNNRKEIQRAKDLLEKSGANLLGVVLNKLKGKSDEYYAYYGAEER
>gnl|bykdb|A0A0A8VVA9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIQTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDLKKAIQNTEVNNLQILTTGKMPPNPSEMLESKKMKEFAQTLQESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKLRLEKVKANIIGVVLNKYVGEDSNYGYYSYCYEQNDGSRSARHKKKNKK
>gnl|bykdb|A0A0A8VWV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIQTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDFKKAIQNTEINNLQILTTGKMPPNPSEMLESKKMKEFAQTLEESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKERLEKVKANIIGVVLNKYVGEDSAYGYYSYCYEQNDGSRRARHKKKNKK
>gnl|bykdb|A0A0A8X8D4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus selenatarsenatis SF-1] (length=234 residues).
MVNKKSTKKKLMDNKRKLVTKLDPKSPISEQYRTIRTNIHFSSIDKEITTLMVTSTGPGEGKSTTAANLAVTFAQQGKQV
LIVDADMRKPTVHYTFNQTNSVGLTSVLTNQTPLLDAVKLTDVANLMVLSSGPIPPNPSELLSSRAMKQFIEDASKNFSV
ILFDTPPVLAVTDAQILANQCDGTILVVSSGVTEQDQALRAKEMLTSAKGKLLGVVLNNKKMDGKEQYYYYGAN
>gnl|bykdb|A0A0B0D0Q7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus sp. BBL2006] (length=231 residues).
MARKPKKTMQTRGRSLIANDNPKSPISEQFRTIRTNLQFTSIDKDLETMLVTSASPSEGKSITTANTAVVFAQQGKKVLL
IDADLRKPTIHYTFRTDNTYGLSNYLVGNRSIFDLVRESEIENLDILPCGPIPPNPSELLGSRKMEKFIREAKQSYDMVI
FDTPPVLAVTDSQVLSRFVDGVMLVVRSKQTEQEAAHKAKELLLKSKANILGAVLNDKDIKSSNYYYYYGS
>gnl|bykdb|A0A0B0D234 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus sp. BBL2006] (length=223 residues).
MQTSARSLIANDNPKSPIAEQFRTIRTNLQFSSVDKELETMLVTSASPSEGKSITTANTAVVFAQQGKKVLLVDADLRKP
TIHYTFRTDNTYGLSNYLVSERPLSDLVRESHIDNLDLLPCGPIPPNPSELLGSKKMKKFINEAHQKYDMIIFDTPPVLA
VTDSQVLSAFVDGVLLVVRSKQTEQEAAIKAKEQLLQSKATILGVVLNDKDVKSSSYYYYYGK
>gnl|bykdb|A0A0B0HRS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. P1XP2] (length=229 residues).
MRRSINDRSLIVSANPMSPISEVYRLLRTKIHYLSKDHESSVVMVTSSQAGEGKTTTICNLAVTYALEGKRVLLIDADLR
KPSLHRIFSLSNDHGLSTLLTGNANMEDAIQETMVACLSLLPSGPVPANPSELIASATLQELLESVKQEYDMILVDTPPV
LTATDPVITSTLCDGVVMVVAVGRVKKDHLKKAKEQLDHVNARMLGIVLNRINRDDQQLFYMKHYGAKG
>gnl|bykdb|A0A0B0HS13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. P1XP2] (length=231 residues).
MSRSQNNRRHLIVLTNPRSPISESYRTLRTNIDFSSVDQVTQVIMVTSAGPEEGKSTVVGNLAVTYAQDNRNVLLIDADM
RKPTVHRTFQLSNIAGLSSVLSRQFSLDEAIQATEIPNFYVMTAGAIPPNPAEMLNSKSMAQLMAELREQFDVILIDTPP
VLAVTDAQLLASQSDGVLMVINTGKVKKEIALKAKETLQRVNARMLGVVLNNVKRKASEEYYYYYYASNDN
>gnl|bykdb|A0A0B0IBL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus okhensis] (length=231 residues).
MSRKAKVTQARQRRNLITDTGKSSPISEQYRTIRTNIEFSAVDKDIRSILVTSAGPAEGKSTTAANLAVVMAQNGQSVLL
LDADLRKPTAHYTFGVSNMSGLTNVLSKQQTLEETIQQTKIDNLSVLTCGPIPPNPAELLNSRRMSLVLERAQEIFDTVI
LDSPPVMAVADAQILASKCDGTVLVISSGKTEKEEVKKAKEQLQNAKATILGAVLNNKKIESGSYYYYSNN
>gnl|bykdb|A0A0B0QDM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus altitudinis] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A0B1Y2E3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. A1] (length=232 residues).
MLFKRKTKRIPMARKLITVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMSFLLHEVKEQYDIVM
IDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
>gnl|bykdb|A0A0B2FA58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. IHB B 3415] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQADLSEVIQESGVNNLSLMTSGPIPPNPAEMMASNRMSAVLQELRQLYDVVLIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A0B2XEX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus curvatus] (length=243 residues).
MGLFKKEKSLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKRGLTSLLTDETFDLTNTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVPPVISVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGAE
EIK
>gnl|bykdb|A0A0B3VM38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terrisporobacter othiniensis] (length=230 residues).
MLGLYDSGSFEINEAYREIRTNISLNTDIKTIVFTSAEMDEGKTTTVCSIAKCFSDLENHRILLIDCDFRKKSVAKTLEI
ENKKGIADMTMNDMDRKECIKKVEGFDVLTCGVSPSNSSVLLESKKFRDIIESLKGDYDYIFIDSPPLGRLNDAAILARY
LDGTIIVNASEYIDQQMAKVTRDKLEKVNANVIGVILNKFKAGDHKYYKYYGYYKEEKGKKSFFKKRKRR
>gnl|bykdb|A0A0B4RE03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. PAMC 21323] (length=236 residues).
MVKKKNKPEAHGRKLVAFTNPKSRVSEQFRTLRTNIHFTAPNRDIRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLI
DADMRKPTMHQTFKISNSKGLSNVLIRRVSLKMAIQTSGIENLDLLPSGPIPPNPAELLSSSNMDLLFEDALDTYDLLIF
DTPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKAAITAASKSRLLGTVLNNVQVQKDFDYAQYYTQTTTN
>gnl|bykdb|A0A0B4RE18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. PAMC 21323] (length=221 residues).
MPRKLVVRTNPHSIAAEQYRTIRTNINFSIPELGSKIILFTSASKEEGKSTTAANMAIVFAETGKRVLLIDADMRRPTLY
RTFQLSNNTGLSNLLLGKGNLKQSVKASGIPNLDLLMSGQIPPNPAELLESGILDELMAEMREVYDYVLFDSPPILSVTD
AKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKSFILGVVLNNYPLTSENYYYHNYSE
>gnl|bykdb|A0A0B4RE70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. PAMC 21323] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSFVSEQFRTLRTNINFSSPDSEIHTMVITSAAPSEGKSTTAANLAVVFAQEGKKVLLI
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSLQEVIRTTSVDRLDLMTCGPIPPNPAELLASKSMDTLIGQLKNMYDLIIF
DAPPVLSVADGQILANKCEGTILVLSSGNTEKDMAIKAKEAIESSNSRLIGAVLNNFELPKDNYYYQYYGNTE
>gnl|bykdb|A0A0B4SBN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. WP8] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A0B4WAQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum Prevot_594] (length=236 residues).
MNRKLELITIKDPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSQKMKKFIEMSKEHYDYIMLDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTESGSGYRYYNYYYEENGEKKKRSKK
>gnl|bykdb|A0A0B5APV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus malaysiensis] (length=233 residues).
MAAKKKQGSNNHSRNLIAKVNPKAVASEQYRTIRTNIQFSAVDNAIQTMIVTSSGPGEGKSTTASNMAIVFAQSGKRTLL
IDADMRKPTAHYTFNVMNTRGLTNVLTKQNDLSEAIQEVDVNKLHVLTSGPIPPNPSELLGSRGMDYFLEQAKEAYDIII
FDTPPVLAVTDAQILANRCDGAILVVRSQVADKEKALKAKELLESANARILGAVLNDKKMDTGDDYYYYYGNE
>gnl|bykdb|A0A0B5NEV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0B5Q6G6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSARKLHKAVENQEYRGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVVTSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A0B5QHH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=240 residues).
MKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAASFAQNEKK
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A0B5QHR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=242 residues).
MLMVRGLRKGIASQQYNGFIVEKKPRSMVSEAYKKLRTNIQYSSFDKEIKTIVVTSAQASEGKSTVSGNLALSFAQIDKK
VVIVDCDLRKPSVHKNFKISNLVGLSEVITGQVNLGDTVQKYNDNLYILPSGKIPPNPSEMLSSSAMAELIENLRDKYDI
VILDSAPLGAVADAQILSAKVDGTILVIKAQRTNKESVIEAKNFLNKVGANIIGVVLNSVETIKEKNYYYYETSEEPRQV
TE
>gnl|bykdb|A0A0B5S7Y2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAVVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSNTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAFGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGVTEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A0B6A6P9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTASNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGTN
>gnl|bykdb|A0A0B7GNH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDMDNLDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|A0A0C1KET2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus constellatus] (length=230 residues).
MPRLELAKNKEKALKKSEEYYNALRTNIQLSGENIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GVFKTRDKITGLTDYLAGAADLSNGLCDTNVENLFVIEAGQISPNPTALLQSKNFGMMIDILRNHYDYIIIDTPPIGIVI
DAAIIAQKCDASALVVESGNVKRKALQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A0C1PL30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTKVVLVDADLRRPTVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGYYGTDDKK
>gnl|bykdb|A0A0C2E807 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus roseus] (length=235 residues).
MFGKNKARNYVSGPRELIVEKKPKSPVSEQFRTVRTNIMYSNIDTEIKTVLVTSATPGAGKSTTAANLAVAYAQSGKKTL
LMDADLRRPTTHYTFEVTNQRGLSTVIVNDVPVENIVRETEIENLDIVSSGPIPPNPSELLSSKKMTHLLKTFSMHYDMV
IIDSPPLLAVTDAQVLSKITDGTVLVTNVAENNRDKLREAKDLLNKADANILGVVMNNKKMNTKKDDYYYYYGSE
>gnl|bykdb|A0A0C2Q590 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A0C2UF46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Cohnella kolymensis] (length=230 residues).
MSKPILRTKKRHIIVHNNPKSPVSEAYRSLRTNIQFSSVDTRIQTIMVTSASPGEGKSTTAINLAATYAQAEHKVLLIDA
DLRKPSIHHTFLCSNRFGLTNWLTNSRPVSEVVVKTFVPNLYLLPSGAIAPNPSELLSSKKMSKLLEELKQEFDIIILDS
PPVLAVTDAQIIASISDGVVMVADSGKVKIATAQKAKEKLEHVNAKILGVAINNIKRSSHDDYYYYYGET
>gnl|bykdb|A0A0C2UFI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus badius] (length=234 residues).
MVLKKQKHKSLGQTKRKLITNVDPKSPISEQYRTIRTNILFSAVDRDIQSLLITSAGPGEGKSTTAANLAIVFAQQGKNV
LLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKSISAAVKETDMQNLSVLLSGPIPPNPAELLGSRVMAEFLEEARRLYDL
VIFDTPPVLAVTDAQVLANQCDGTVFVVNSGQTEVDNAVKAKELLQAAKAKLLGVVLNNRKAKETNHYYYYGNK
>gnl|bykdb|A0A0C2UT93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. VKM B-2647] (length=236 residues).
MSSSRRNERWPLITNTNTKSPISEAYRILRTNIEFSNVDRNLKCIMFASSQFGEGKSTTASNLAVTYAQTNRKVLLIDCD
MRRPSQHHIFMLSNRYGLSSYLSHQVDLDEIIVDSTIPNLSVIVAGPIPPNPSELLASKRMSAMLEQLREQFDMIIIDTP
PIMAVADAQIAATLCDGVLLVMDSGRVKREIAMKSKQKLEHVKARILGVVLNKISRKNANSYYYYYYGDRDQGEEA
>gnl|bykdb|A0A0C2VGB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus campisalis] (length=233 residues).
MAAKPKKSNMDSKKRNLIAEYNPKSVASEQYRTIRTNIQFSAIDEDIRTITVSSSSPGEGKSTTAANLAIVFAQQGKKVL
LVDADMRKPTVHFTFNMMNTIGLTTVLTRQSELDKTANQTDIENLDILSSGPIPPNPSELLSSRVMNRFFDTAKNMYDLI
IFDTPPVLAVTDAQVLSHQCDGTILVVRAGIADKDKVTKAKEAIVSAKAKILGVVLNDKKMKSNDEYYYYGNN
>gnl|bykdb|A0A0C2W152 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus soli] (length=232 residues).
MANKGRKNNSQVQSRNLITKYNPKSVASEQYRTIRTNIQFSAIEDDIRTLSITSSGPGEGKSTTAANLAVVFAQQGKRTL
LVDADMRKPTVHYTFNMMNTSGLTNVLTRQIELVDAAKKTDVEKLDILTSGPIPPNPSELLSSRIMERFFETALEHYDLI
IFDTPPVLAVTDAQILSNQCDGSILVVRSRVADKDQTLKAKELMVAAQAKILGVILNDKKMENGEDYYYYGN
>gnl|bykdb|A0A0C3ADP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGDLKSVMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0C5CFM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans] (length=210 residues).
MSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTIVGNLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGL
TTVLTKQGTLLETVSKCDVENLHLLPSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILLDTPPVLAVTDAQVLTNQCDGT
ILVVSSGKAEVEAVKKAKELLESANANLLGVVLNNKKTQNTHYYYYYGKD
>gnl|bykdb|A0A0C7E9T9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIKTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDFKKAIQNTEINNLQILTTGKMPPNPSEMLESKRMKEFAQTLEESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKLKLEKVKANIIGVVLNKYVGEDSAYGYYSYCYEQNDGSRSARHKKKNKK
>gnl|bykdb|A0A0C9NVR6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei NRIC 0644] (length=248 residues).
MNFSLKEILPHHKVDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDVCKVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRMGKLLD
WARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKFANAKILGSVERVKAKHGDRGYGYGY
GYGYGNEK
>gnl|bykdb|A0A0D0FE92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thermoamylovorans] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSTGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTFGLTSVLTKQAELMDAVHMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAHAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A0D0FFR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thermoamylovorans] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSTGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTFGLTSVLTKQAELMDAVHMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAQAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A0D0FWQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thermoamylovorans] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSSGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTVGLTSVLTKQVELMDAVYMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAQAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A0D0HRJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus ayderensis] (length=233 residues).
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
LIDADLRKPTVHYTFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVV
LFDTPPVLAVTDAQILANQCDGTILVVHSGKTDIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A0D0Q3J4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. L_1B0_8] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSRSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLDSAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0D0QHU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. L_1B0_5] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSRSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLDSAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0D0SIP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus gallinarum] (length=234 residues).
MAKKNKGASKISPLFTYDKPKSIISEKFRGIRSNIMFSNADKEISSILITSEKASSGKSTISANIAITYAQAGYRTLIID
GDMRRATQHYVFNLTNNSGLSNLIIGKTLEIDAIKETHIENLDVLTSGPVPPNPSELITTRKFRELYQKLATEYDFIIID
TPPVNTVTDAQLYAQIVRDCILVIDSEKSDKNEVKKAKELIEQSNGKVIGAVLNKAAKDNSSSYYNYYGDGNDD
>gnl|bykdb|A0A0D1A945 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus wasatchensis] (length=240 residues).
MGLFRRNKKLSTDTSANGVKLITAMKPKDVISEQFRTIRTNIDFSSVDRQLKTILFTSSDVSEGKSTISANTAVTWAQQG
KKVLFVDADLRRPTLHTTFGLNNTQGLSTILTQNLDFHDHVYDSGVENLSIITSGPVPPNPAELLNSNRMKALVTQMQEE
YDLVVLDVPPLLSVTDTQVLASSADGVILVVRQGAAQQAAVKRSVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYGYE
>gnl|bykdb|A0A0D1C0F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum B2 450] (length=236 residues).
MNKKLELITIKDPKSPISESYRILRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNIRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSRKMNNFIETSKKHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLEKVNAKIIGVVLNKVDTEFGNGYRYYNYYYEEDGEKKKRNKK
>gnl|bykdb|A0A0D1GF85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIDNLDLLTAGPVPPNPSELIGSERFKELVDMFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0D1J0C4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRINIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0D1J9K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0D1KC27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=221 residues).
MTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLEN
TVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQILGNV
ADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|A0A0D1R2D1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis Sbt003] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0D1RD30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis Sbt003] (length=229 residues).
MVLKKNKVRQHRQLITHAQSNSVIAEQYRTIRTNIEFAAVDKPIQSLLIASPTSEAGKTTTAANIAVVFAQQGKKVLIVD
TDLRRPVLHELFQVDNKFGLTSTLTGAQILEDCIKRTEVNGLYLLPCGPIPPNPAELLGSETMKETILHLHKIYDFIIFD
TPPILSVSDAQILANQCDSSLLIIRCGVTEKADALKAKHILGNAPGKLLGVVLNDKEQEKGEAYYYSQN
>gnl|bykdb|A0A0D3VC93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. IHBB 10380] (length=229 residues).
MRRSINDSSLIVSMNPESPISEVYRLLRTNIHYSSIDQALKTIMVTSAQAGEGKTTTISNLAITYAQEGKNVLLIDMDMR
KPSLHHIFSQSNRQGLSTVLTGHTSVQDAIQETMVSHLSLLSSGPIPGNPSDLIDSTAMREMLEQLEQEYDVILMDSPPV
LSVTDSVIASTLCDGVIMVVAAGKVKKVHLKKAKGQLDHVNARLLGIVLNRMNRDNQSNFYMNYYGMKG
>gnl|bykdb|A0A0D3VD82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. IHBB 10380] (length=228 residues).
MPRSINENHNLVTSINPKSPISEAYRTLRTNILFSSIDEQIRTIMVASAQAGEGKTITVSNLAVAYAQEGKKVLLIDVDF
RKPSLHKVFTVSNQTGLTSVLSNQCELQDVVRETFVEHLDVITSGPIPPNPSEMLSSRKMKTVLEETKDLYDVILFDTPP
VLAVTDALIVSSFCDGVILVVNSSKVKKEVVKKAKANLEHVNARFLGVVLNNINVGKDNPYYYYYGEK
>gnl|bykdb|A0A0D4CMJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae LM1] (length=252 residues).
MGIFKRKSRIDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQEG
KSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEAV
QAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGITQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
GYGYGYEKESEN
>gnl|bykdb|A0A0D5NGD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus beijingensis] (length=229 residues).
MPRQINNSNLITFYVPKSPISEAYRTLRTNIQFSSIDKKIRVLMVASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLR
KPTIHRIFGLSNRTGLTSVITGQFHSSEAIQSTEVENLSILPSGAVPPNPAELLASQKMKAFINEMKDTYDIIIFDTPPV
LAVADSLIVSSVCDGVVIVIQEGKVKRELVKRAKESLERVNAKLIGVVLNNVKKSKKNGYYYYYHETAE
>gnl|bykdb|A0A0D5NL38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus beijingensis] (length=228 residues).
MPRLISNSNLVTLHTPKSPISEAYRTLRTNIQFSSIDNKINVLMVASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLR
KPTMHRIFGLSNRVGLTSVITGQIRPSDAIQSTEVINLSLLPSGTIPPNPAELLASQKMKAFVNEMKGAYDMVIFDTPPV
LAVADSLIVSSVCDGVVIVVQEGRVKRELVRKAKESLERVNAKLIGVVLNNVKKSKDGYYYYYRETAE
>gnl|bykdb|A0A0D6A0S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acetotolerans] (length=262 residues).
MSLFKKKRGIDETIKKGAKLITVADPKSPVTEQFRTIRTNIKFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKKVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEILNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
GYGYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A0D6DUY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus piscium MKFS47] (length=230 residues).
MSKKEKKINGNRYLITSLNPKSPISEQYRTIRTTIDFKMLDQGLKSFLVASSEAAAGKSTTIANLAVVFAQQGKKVLLID
ADVRKPSVHLTFKLQNRIGLTNVLTRLISVNDAIQGTRISENLSIISSGPIPPNPSELLSSSAMQNLIDSASKNFDIVLI
DTAPLSAVTDAQILSRYVGGAVIVAHANQTKKESLSKTKKLLEQVNANILGVVLHGIELSDTAYYYYGTE
>gnl|bykdb|A0A0D6J4Y4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=221 residues).
MPTLEIAQKKLEFIKKAEEYYNTLCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGRK
>gnl|bykdb|A0A0D6Z6K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subterraneus] (length=228 residues).
MKKAMASTKRMLVTFLDPKSPISEQYRTIRTNIEFSSIDEDMQAIMVTSSGPSEGKSTTAANLAVVFAQQEKQVLLVDAD
LRKPTVHYTFNLTNTFGLTSVLSKQMQLVEAVDESEIDNLGILTSGPIPPNPAELLGSKAMNQFLLEAREHFDVILFDTP
PVLAVTDAQVLANKCDGSILVVYSGRTEMDGAAKAKELLENAKSKLLGVVLNHKKLQSSDYYYYYGNK
>gnl|bykdb|A0A0D6ZHJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=257 residues).
MAFGRKKHLDKDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGEEEEKKGLFGRKK
>gnl|bykdb|A0A0D7XCU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=233 residues).
MSRLAIRKKRSRKYQSALVALHQPNAPIVEQYRTIRTNIEFSSFEKPFKSLLITSGLPGEGKSFSASNLAVVFSQQEKKV
LLIDADLRKPTIHKIFELDNHSGVTNVLMKKTTLENVVQQSPAENLHVLTSGPIPPNPSELLSSQAMEDLLAEAYNQYDL
VILDSPPLLPVADAQILANQVDGSILVILSGKTKLDNAIKSRDALNSSKSELLGAVLNGRKVKKARQYNYATM
>gnl|bykdb|A0A0D7XMP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=229 residues).
MLTRKKDKLGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAAAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A0D7XT59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A0D8BUQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus kaustophilus] (length=232 residues).
MAVSNRKKFQKAERSLIAFDDPKSSISEQYRTIRTNIEFSFIDEPLRSLMVTSSAPSEGKSTTAANLAVVFAQQGKKVLL
VDADLRKPTVHYTFRLNNYAGLTSVLTSASSLSSTLQGTAVENLTVLTAGPIPPNPAELLSSRIMDRLLHELQEMYDLVL
FDTPPVLAVTDAQILANKCDGTVLVVASGKTEIAAAAKAKELLEAANAKLVGVVLNQRKQRGGSGYYYYQYK
>gnl|bykdb|A0A0D8J3F4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruthenibacterium lactatiformans] (length=226 residues).
MNKNAPFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPVIHRYLKID
NSAYKGIISALADGSLAESIINVKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVTDAAVLS
QYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENADR
>gnl|bykdb|A0A0E0VM88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus 71193] (length=231 residues).
MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVID
GDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVD
TPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E0VTK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus 71193] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1AEK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus Z172] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E1AK49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus Z172] (length=229 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1L3M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum CDC_1436] (length=236 residues).
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTKGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIDMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTDSENGYRYYNYYYEEDEKKKKRSKK
>gnl|bykdb|A0A0E1VNZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus USA300_TCH959] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIASERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E1VPM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus USA300_TCH959] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1XAG4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus MN8] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKSLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E1XD26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus MN8] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMHKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1XI08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus subsp. gallolyticus TX20005] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGEDRRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A0E2BPF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus casei A2-362] (length=246 residues).
MAWFKRKNKKALADRSLKQGVALVTNYAPDSRISEEYRTLRTNISFSQADGDIKTLVITSAAAAEGKSTVSSNVAVTFAK
QGLNTILVDLDMRRPMVNATFGQQNIGGLVKLLTTDGEKLEEQLPLYAKPTQIENLTVLVAGPTPPNPSELLGSKSMLAL
LKYLREHYDRVVLDTPPVLSVTDAQIVAAHADATVLVVPYGLAQKKFVLQAKDLLTKVDANIIGVVMNRMPAQGGAGYYY
YGGYYK
>gnl|bykdb|A0A0E2H9X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] clostridioforme 90A8] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGSGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMIDADIRKSVLV
SRYQLEREVSGLSQYLSGQRSLENVIYDTNIENFSMIFAGPYSPNPAELLEESLFGDMISKLKERYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMERNGYYSKYYGKYGKYSKYGHYGKYDRYGK
AEA
>gnl|bykdb|A0A0E2HSZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] clostridioforme 90A8] (length=235 residues).
MEQILNLQNTGGKDYHFEEAIKTLRTNLQFCGSSLKTIMFTSSLPDEGKSEIAFSVGASFGSIGKKVLLIDADIRKSVFI
KRYEIKGSPSGLSQYLSGQKTMEDICYATDIENFYMILAGPYSPNPAELLEDQLFKELLEKAKEKYDYIIIDTPPMANLI
DGAIIAGQCDGAVIVIESDTISYHLAQKVKVQLEKSGCRILGAVLNRVGEDYENGYYKKYYGKYYGKYVVGGGEK
>gnl|bykdb|A0A0E2HUR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=232 residues).
MARTQKQKATQTHAVSLVTLTNPSSLIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPEEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVDNLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDIPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0E2I0A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=226 residues).
MKNNMKKKGVPLISASKQSSMISEQYRTVRSNIQFSSFDQDIKTIVVTSAGPEEGKSTVSANLAIVFANSGKKTLLIDAD
LRKPSVESTFRSTSNSDGLTNLLKKRNESAFVFIHETNIAHLWTMTSGPKPPNPSELLESSRMNEIIDELSVNFDLIIFD
LPPVVPVTDAQILASKTDGTIIVVRERKTLKQELFKAKELLTIAQANILGIVYNGVKKSKDINYYY
>gnl|bykdb|A0A0E2J4N3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus intermedius SK54 = ATCC 27335] (length=230 residues).
MPSLELVKSKIRELRKSEEYYNALRTNVQLSGDNIKVIAITSVQPGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSTMS
GAFKARNKITGLTDYLAGAADLSNGLCETNIEKLFVIEAGQNSPNPTALLQSKNFEMMIDILRNHYDYIIIDTPPIGLVI
DAAIIAQKCDASLLVVEAGNVKRKALQKAKEQLEQTATPFLGVVLNKYDVQLDKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A0E2LW59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei] (length=248 residues).
MNLSITNLLHRHEEDQETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALDNCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKRVLLIDADLRRPTVHASFRKLNVEGVTTVLTAKRQAEEVVEATFVDNLSVITSGPIPPNPSELLNSKRMVQLLE
WARKNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVSKMGKTLKSDLKRTVEVLHLAKAKILGSVERIKNPRGDRGYGYGY
GYGYGNEK
>gnl|bykdb|A0A0E2Q2B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus M17PTZA496] (length=246 residues).
MPLLKLVKSKVNFNKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTNISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A0E2RH33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus TH1477] (length=246 residues).
MPLLKLVKSKVDFNKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKYDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A0E2URZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis] (length=239 residues).
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTTSANIAISFAKAGLKTLLIDADIRNSVMS
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGANGNYGKPAKKKSRKRR
>gnl|bykdb|A0A0E3STS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0E4CSD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus varani] (length=238 residues).
MSQFILGRAKAQMVKAMEEYYNAIQVNIQFSGSNIKVIAVTSVQPGEGKSTTSTSLAISFATSGYKTLLIDADIRNSVMS
GTFKAESAYHGLTSYLSGHVDLSQVVHDTSIDNLSIIPAGQVPPNPTTFLQNARFDNMIERVRNGFDYIIIDTPPIGLVV
DAAIVAQKADGSLLVTESGAVSRRFVKKAVEQMEQSGAQFLGVILNKVDTTKDRYGSYGSYGAYGNYGNYGKKTDKDL
>gnl|bykdb|A0A0E4CYT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus riograndensis SBR5] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQADLEDVVQDSGVANLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIIASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A0E8T7I3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0E9GXU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A0A0F0CCY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. FS41] (length=247 residues).
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
QILDEAR
>gnl|bykdb|A0A0F0CD69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. FS41] (length=239 residues).
MDQILNLKNTGEKNYHFEESIKTLRTNMQFCGSSLKTIMFTSSLPNEGKSEITFSVAASLGSIGKKVLMIDADIRKSVLI
KRYEIKGNPNGLSQYLSGQKSLDEICYATDVENLDIILAGPYSPNPAELLEDSLFRELLEKAKERYDYIIIDTPPMANLI
DGAIIANQCDGAVIVIESGTISYHLVQKVKGQLEKSGCRILGAVLNRVDKEYENGYYKKYYGKYYGKYYRNTGGGGIEA
>gnl|bykdb|A0A0F0CFD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. FS41] (length=249 residues).
MKQIITLNRDMKDDYHYNEAIKTLRTNIQFCGNGIRTIMLTSSLPDEGKSDITFAMAASLAQIGKKVVMIDADIRKSVLV
SRYQLETEVYGLSQYLSGQKTLADVLYDTNVENLSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYSRYGKYGKYSKYGKYGKYGK
YEKYEKAEA
>gnl|bykdb|A0A0F2CIN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus cristatus] (length=232 residues).
MPILELAKKKKLSISRVEEYYNALRTNIQLSGEDIKVIAVSSTFPGEGKTTTSTNLALTFAKAGHKTLLIDADIRNSKML
GGVFKSGEKVSGLTEYLARNTDLSQGLCETDEENLFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMV
VDATLIAKVCDASLLVVSTNEVKRKMVQKSKMQLEQSSTPFLGVVLNKYNVQADKYGFYGSYGHYGDNLSKE
>gnl|bykdb|A0A0F2CWA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALIQSENFANMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A0F2DFW5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKIIVVTSANPNEGKSEVSINLAASLAQQGKRVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKKSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAATDA
QVLASISDATLLVVDIKKSKRRQIIEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
>gnl|bykdb|A0A0F2DRS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKLIVITSANPNEGKSEVSINLAASLAQQGKKVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKRSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMEETLRAFEDFYDYVIIDTPPLLAATDA
QVLASISDATLLVVDIKKSKRRQVTEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
>gnl|bykdb|A0A0F2DXP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=237 residues).
MPILEIGQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDVIKAKEQLEQTGVPFLGVVLNKFNTEVEKYGAYGGYGAYGAYGSYGNYGKKK
>gnl|bykdb|A0A0F2E2R2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A0F2E7J6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis] (length=233 residues).
MAKLELSEKRQAFVKKAEEYYNALRTNIQLSGDKLKVIAISSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFISREKITGLTDYLSGTKDLSQGLCETNVENLFVVQSGAISPNPTALLQSEKFEVMIETLRKYFDYIIVDTAPIGVVI
DAAIIAQKCDASILVTEASATKRREVQKAKTQLEQTGTPFLGVILNKFNIHLEKYGTYGTYGGYGNYGSYGKK
>gnl|bykdb|A0A0F2JBL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. I2] (length=199 residues).
MITSAGPREGKSTTVANLAVSMAQSGKSVLVLDADLRNPTQHKLFGLDNREGLSVALVQEQDYRSYIRETAVSGVMVLTG
GPIPPNPAELVGSKRMKRLLEEVSEQFDIILIDTPPIVAVTDPAILAQDVDGVILVMASGEVHKDYAQSAKELLDKVGAK
ILGVVLNKADMKTSDYYYYYYYYHGSDNPKKKPKRHKNR
>gnl|bykdb|A0A0F2N5U0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c4a] (length=248 residues).
MLKKNGGIKFFDTDQKNELRELYALDNPKAPVVEAFRTLRTNVSFASVDKTFKTLLITSPTLGDGKSTITANLGMVMAQA
GKKVLVMDADLRKPMQHHIFSVSNLRGLTNILVQGEPLAEVAHEVSANGLFFVPSGPIPPNPSELLASNRMLKLLEEAQK
DYDIVLIDSPPMIAVTDSSILSTRMDGVMLVVRAGVTRVDLINDAIGQLKKASANFIGLVLNQVRVPSHDYQYYYYYGHK
NKEAEMRF
>gnl|bykdb|A0A0F2PBH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c8a] (length=251 residues).
MRNSKNLSKMLFAQNNPMAPVSETFRTLRTNIYFSIEARSKGTILITSALSGEGKSTVAANLGVVMAQAGKRVVIIDCDL
RNPVMHKYFNIINNQGLSNLLSHDLVLGDTIHTTGTEGPSLITSGPIPPNPSELLASQKMMDLLQHLSAHFDTVLIDTPP
VIAVTDAVVLATRVDGVLLVLKSESTALDKAKRAKQQLEMANAKIIGVVLNDVKIKRSDCNYYYYNRDYKQAQREADVLL
KQAAATKDDNS
>gnl|bykdb|A0A0F2QB88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiaceae bacterium BRH_c20a] (length=218 residues).
MITYSDPKSPEAEAFRTIRTNLYYYNLDHRFKKVMLTSTGPAEGKSTIIANLAIVLAQTGKKVLLVDADLRRPTLHSIFD
AGNLVGLSSCLEKKLSLMEVVQKTKIENLYIITSGFFPLKPSELNSSKIDELFEDVEAYDYILFDTPPAGTFTDALVLSE
KVDAVLVVINSKKVPIDLAQQTIEKLRNAKTEIIGVIFNNVQYEKDFYKNYYYYGDKK
>gnl|bykdb|A0A0F2S779 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c23] (length=236 residues).
MAYSLITLEQTKSPISEAYRALRTNVQFTRVDSESQKIMVTSSGPREGKSHTVANLGVSMAQSGKSVLIIDADLRNPTQH
KLFGLDNGEGLSVSLVQDQDYHKYIRETTVPGVMVLPAGPVPPNPAELVGSKRMKRLIEEVSEQFDMVLIDTPPIIAVTD
AAILAQEVDGVILVLASGEVNKGYAQKAKEQLDKLGVKILGAVLNKVDLNTNEYYHYYYYNASDDTEKKHNRHKAR
>gnl|bykdb|A0A0F2SLH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c23] (length=236 residues).
MTFSLITLEQSKSPISEAYRTLRTNVQFTSVDSKTKKIMITSSGPREGKSTTVANLAVSIAQTGKSVLVIDADLRNPTQH
KLFGLDNGQGLSISLVQDQDGHTNIRETAVPGLMLLTGGPIPPNPAELVGSKRMKRLIKEVSEQFDVVLIDTPPIIAVTD
AAIIAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVLNKADMKTSEYYYYYYYHGSEDSKKKHKGHKKR
>gnl|bykdb|A0A0F3FR10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii] (length=217 residues).
MFIVSKDPKSIAAENYRILRTNIQYSSFDKEIRRVLITSSEPGEGKSTTAGNLALTFAQDDKKTIIIDCDLRKPSLHKKF
NVSNSIGLSDVIIDKKNIEKSVKKIDENLDILTAGKIPPNPSELLGSKALNTLLEALEEVYDVIVIDSPPVLAVTDAQIL
SKKVDGTVLVVRSNFTKKDTVMAAKDVLIKVKANILGTVLTRTDSNKHGYYYYYGKE
>gnl|bykdb|A0A0F3HAI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis] (length=230 residues).
MNTLEISKNKLQEVRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRTKIQGLTDFLSGRSQLDHILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A0F3HHE8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|A0A0F3HK81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis] (length=227 residues).
MVKLELAQQKLNSLKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSHGLCETDVENLFVVQSGAVSPNPTALLQSANFERMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASVLVAEAGVAKRREVQKAKSQLEHTGKPFLGVVLNKFDVQREKYGSYGGYGNYEKR
>gnl|bykdb|A0A0F3RS81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus spicheri] (length=251 residues).
MAWFKRKSKKLDNNSLKYGVGLVTYNDPTGMVSEQFKTVRTNIQFSSIDNKLHSIMFTSSEPSEGKSTVSNNVAVTYADQ
GTQVILMDADFRRPTVHKTFNVSNQKGLSNYLSGNATLEEIVQPTMLEGLSVITSGPVPPNPSELLTSQKMAQLLDKLAE
QSDLLIVDAPPVNTVTDAQLLGARVDGVILVVPQGIALKAGVRHAKQALETVHANILGAVMNRVTAQKSGGYYGGYYGGS
YEGYYGTDDKK
>gnl|bykdb|A0A0F4LRK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mellifer] (length=237 residues).
MFKKKSKTQLASQKTAAVSLISLLNSRSTIAEQYRTIRTNIQFAASSDHPVKSIVITSSGPSEGKSLTAANLAIVFAKSG
KKTLLLDGDMRKPTVWKTFRLSNQKGLSTLLVSPDDIADSIQKTTIDNLSVLTSGPQPPNPSELLGSTREEVIMDQLTRL
FDVIIVDMPPVVTVTDAQIVASKADGTILVAREGVSEKAALLKAKQLLEIAHARILGVVYNGVDSANDAGYYYYSDK
>gnl|bykdb|A0A0F4VQE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. IBUN125C] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0F4WIN2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. IBUN22A] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0F4WPP9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. IBUN13A] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0F5I5I3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Quasibacillus thermotolerans] (length=235 residues).
MALRRGKKKQAPGQAQRKLVTKTNPKSPISEQYRTIRTNITFSTVDETIRSLMITSASPAEGKSTTTANLAITFAQQGMR
VLLVDSDMRKPTMQYTFNVPNNIGLTNVLAKQKTIKEAVSRTDVSGLEMLSSGPIPPNPAELLGSRAMKEFFKEAYMLYD
MVIFDTPPVLAVTDAQVLANQCDGAVLVVNSGKTEVDAAAKAKELLEAANARLLGVVLNNRSLKESNYYYYYGNK
>gnl|bykdb|A0A0F5R3J7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. D9] (length=231 residues).
MSRLTRNWTLITASNPKSPISESYRMLRTGVDYAGVDDPVDLLMVTSCRAGEGKSTTSANMAVTFAQAGQKVLLIDADMR
KPSQHHIFSLSNRGGLTGVLQGRSTLEQGVQAAEVDNLDILTAGPTPPNPSEMLGSRAMAALLELAKEQYDQVIVDTPPI
LAVTDAHIVAGKCDGVVLVIDSGKVKSDTARKAKETLENAGSRMLGVVLNNVDRDGNSGYYYYYYGGEEQA
>gnl|bykdb|A0A0F5R7R3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. D9] (length=231 residues).
MPRSTSESSLITYYEPKSPISEAYRTLRTNIQFSSFDEPIQVIMVASANPGEGKSTTASNLAVTYAQEGKKTLLIDADLR
KPSVFQVFSVSNRVGLSTVVSGQCRWADAIQDTHVEQLDVLPSGPIPPNPSELLASHSMKSLLQELQAQYDIIIFDTPPV
LAVTDSLIISSLCQGVILVVQAGKVKSELVRKAKSNLEHVQARILGVVLNNMKSRKGDKYTYYYYGTKEAK
>gnl|bykdb|A0A0F5RRC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. UMTAT18] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKSIHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVENLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAK
>gnl|bykdb|A0A0F6FSG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. kurstaki] (length=233 residues).
MALKLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0F6J796 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis T01-328] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0F6S2G1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6S2G4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6S2U6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIALTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6S316 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UW27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UW46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIALTKRERVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UW57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UW75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSIMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UWI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFRPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UWJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGKKA
>gnl|bykdb|A0A0F6UWT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKGQLEQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UWV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=234 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGKLRTLRQKSLISQII
>gnl|bykdb|A0A0F6UX04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIALTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRPSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UXU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UXZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKIKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0F6UXZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIHTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UY94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UYB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UYB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGKKA
>gnl|bykdb|A0A0F6UYI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UYK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UYK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIGYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UZ84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=230 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYGNYGNYGRK
>gnl|bykdb|A0A0F7HJC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus halodurans] (length=237 residues).
MFGKKNKHLDYTSGPRDLIVAKEPKSPISEQYRTIRTNITYSSVDTPIKSVLFTSSLPSAGKSTTAANVAIAYAQAGKKT
LLLDADLRRPTTHYTFEMNNQKGLSTAIVNEMPLENVIKETEIENLDIVTSGPVPPNPSELIASNKMEHFFKTVTMQYDM
VIVDSPPILAVTDGQLLSKLVDGTILVTNVESNNKDSLTHAKDLLHKADSNLIGVVLNNKKQKSSKDSYYYYYGNEK
>gnl|bykdb|A0A0F7HK70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus halodurans] (length=237 residues).
MRDRKMNNEVASAKKIIVATKPHSPVSEQFRTIRTNIMYSSIDRPIRSVLFTSAVAGAGKSTIAANVAIAYAQAGKKTLL
LDGDLRRPTCHYTFKVSNQKGLSTAIVNDIALEDLVNQTEFDDLDLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMII
VDSPPLLSVTDAQLLSKSADGVILITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRTIKDKSKDDYYYYQASHDV
>gnl|bykdb|A0A0F7PWI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius str. Ren] (length=220 residues).
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
>gnl|bykdb|A0A0G3Y412 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 12AMOR1] (length=232 residues).
MARSNRQQFKRLERSLITAEDPKSPIAEQYRTIRTNIQFSFIDRPLRSLIVTSTGPGEGKSTTVANLAVAFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A0G4CTU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. tolworthi] (length=233 residues).
MALNLFKKKQNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0G8EEC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNILGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0G8EWK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VVFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A0G9F8V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A0G9GUB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=219 residues).
MSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGL
SSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLLANKVDGT
VLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDSSHHGYYGYNSGYGYYSDEDK
>gnl|bykdb|A0A0G9L7G5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C8] (length=217 residues).
MFIVEKEPKSIAAESYRTLRTNIQYSSFDKEYKVIMVTSSEPGEGKSTTAGNLALCLAQGEKKVILVDCDLRKPSLHKKF
KISNIVGLSDVMIGKEELVTAMHRYNNNLVILTSGKIPPNPSEMLSSKAMTTLLDALKKNFDYIILDTPPVQAVTDSQIL
ATKADGAILVVRAERTKKDSVQNAISLLKKVNANIIGTVLNGLDNSRNKYYYYYGEK
>gnl|bykdb|A0A0H0YRN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus casei] (length=252 residues).
MKLTKVFNKFTRHNQEDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAAAALDRCQIVMFTSSTMSEGKSTVSANVA
VTWAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKTKPSDVVEQTFVDNLDIITSGPVPPNPSELLNSKRMTSL
LEWSRDKYDIIVLDAPPVLGVSDVQVLVPKTDGVVVVANMGKTLKGDLKRTVEVLKLAKAKILGSVERVRAKNGDRGYGY
GYGYGYQESDGR
>gnl|bykdb|A0A0H1RIT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A0H1ZAC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=232 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGDYGNYGKRDRKRK
>gnl|bykdb|A0A0H2WXD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H2WZS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H2XG22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H2XGL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H2YPY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILENNPKSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKKVILIDCDLRKPVVHKEF
QISNSRGLSEFLIGNVEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVIEAVKGLRAVNANIIGTVFNGEENQRGKYYHYYKKD
>gnl|bykdb|A0A0H3E402 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=226 residues).
MGFRKKKAKRGLAQISVLQNKSLVAEQYRTIRTNIAFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETFQLENVTGLTNVLVGTCSLSETVQQTPIDNLYILTSGPTPPNPAELLSSKAMGDLILDIYDQYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKIDTVQKAKDALEQSKAKLLGALLNKKKLKKPDLYSY
>gnl|bykdb|A0A0H3E6Z7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=231 residues).
MARKKTLRSLMSIRNIITMTEPKSLNSEQYRTIRTNIEYSSIDSQVKSLIITSAGPGEGKSTTAANLAVVFAQQGKKVLL
VDADLRKPTVHFTFRLDNADGLTSILLKQISFEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVI
FDTPPLLAVADPQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
>gnl|bykdb|A0A0H3J709 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium pasteurianum DSM 525 = ATCC 6013] (length=234 residues).
MLIVKDNPKSPISESYRTLRTNIQFSSFDDNMSTILVTSSTPSEGKSTVSSNLALAMAETNKKVLLIDCDLRRPSIHKKF
GLSNEKGLSNLLIGQHSFNEIAQEITSNLCVLTSGTIPPNPSEMLSSKKMELFLKEAEKNFDFIILDTPPVVSVTDAQAL
STIVDGVLLVVSSGHAQIPEVHKAIELLQYVKANIIGIVANKVKSFRRGYKYYQYYYYGEGDGKNKKHRSKSSK
>gnl|bykdb|A0A0H3JNK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3JSP3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H3JU05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3JUZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIASERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H3JYT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3K5M2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=231 residues).
MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVID
GDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVD
TPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H3KAR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3N0D2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYSEYGNYGKKA
>gnl|bykdb|A0A0H4LEI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus farciminis] (length=249 residues).
MKLFKSKRKKLDNYSLKHGVGLISYDDPTSTVSEQFKTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWAKQ
GDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRLAD
KFDLLILDAPPANSVTDAQVLATKVDGVVLVVPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGGHY
GGYYGADKK
>gnl|bykdb|A0A0H4LV19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=251 residues).
MQLSFSKLFHRHQEDQETQKNGVMLVAFAEPKHVVSEQFRTVRTNIEFAGAALDRCQVVMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTIHATFRTLNIDGVTTILIGKDEAGAVVEETFVDNLSVITSGPIPPNPSELLNSKRMANLLN
WARENYDIIVLDTPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLRRTVEVLKLANAKILGSVERVKAKHGDRGYGYGY
GYGYGTNTGKK
>gnl|bykdb|A0A0H5SXP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Herbinix hemicellulosilytica] (length=230 residues).
MQINFTNINKLSFRANEAYKTLRTNIQFCGNDIKTICITSCIPNEGKSNVSFNLARSLAEFGKKVIFIDADLRRSVLVGK
YKPDQAVIGLSHYLSGQNSIDEILYETNIDNLDIIFTGPVPPNPAELLGIDIFGELLRIFRKVYDYIIIDTPPIGSVIDS
AIVAQKCDGVILVIEANAISYKLAQRAIRQLNKSKSKILGAVLNKYDYGSRYYGYESKKYKKYLDYYTEY
>gnl|bykdb|A0A0J1DM87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium 1109] (length=233 residues).
MPLRDSLIVHNDPKSVGSEAFRTLRTNLQFTSPDRQLRVILVTSAAPGEGKSTISSNLAVAFSQAGLRTLLLDCDLRKPT
VHKIVGLHNSPGLTSLLVGEVKREDVVKDVGVPNLSVIPSGPVPPNPVELLGSQAMRNVLNAVREEFDMVVVDAPPIVAV
TDAAVLCPLVDGVLLTVAAGEVPRELAQHARSLLENANANVLGVVLNRINPSAQKNYQYYYYYYSEVAETSDD
>gnl|bykdb|A0A0J1FRN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus acididurans] (length=253 residues).
MTYSLITVEQAKSPVSEAFRTFRTNVQFTSVDSETKKIMITSAGPREGKSSTVANLAVSMAQTGKSVLIIDADLRNPTQH
KLFGLDNSRGLSMALVQEYELDTFIQESSVPGIMVLTGGPIPPNPAELVGSKRMKRLIEEVSGQFDIILIDTPPIVAVTD
AAILAQEVDGVILVVASAEVNRDYAQRAKEQLDKVGAKILGAVLNKADLKTSEYYYYYYYHGSEAPAKKRKRHKHEKKTT
FFNLLHRNQKDVS
>gnl|bykdb|A0A0J1GBR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Robinsoniella sp. RHS] (length=478 residues).
MQLYNDKIDIIYDDDKILDVRNFIDNMWNGLKRWKILLLLVFLMTTGGIVAVKSWNYTLLYQAKLTYVVTKTGDAATDVV
ITGRLSASFPDILANTGLSSDIKQKVQIKEEKLPGSIRMYNTSSSNMLNVMITSADYNQANAMMEAFQETYPVYASKNVG
TVELNVIDYTLATENPVNPYPQLKYILMGILSGGCCVFVLLVCYALTRKTIRRETDMKKIVNLDCLAYIPKVKEKKRTNK
EVRHILISDKKVSYDFRQAIRSIQSRTAKHLKEENAKILMITSSLPSEGKTTFAVNLAQAMADEGKRVVLVDCDLRHPSI
GTMLGIESSGEGLQDVIENKLELEKAVKKYRDHIMVLCAGKAREDTANVLSNPRFQEILDSLGSEYDYVVIDTPPVSFFT
DASMISEYADAGIYLVRQDYVEARYVREGMEMLANSELKLVGYVLNYVEAGFLKYGYHNYYYGKSYRYYKQKVSDGEN
>gnl|bykdb|A0A0J1HTP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus anthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQPTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J1ID87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium CEB3] (length=247 residues).
MGLSNLITARKPKSPISEAYRTLRTNVQFTAVDGEVKKILVTSAGPGEGKSATVANLAVSLAEAGKHVLIIDADLRNPTQ
HKLFGLSNLEGLSTALVQERALRDLIRETKFTGLAVLSSGPIPPNPAELLNSKRMKRFLEEATGEFDTILIDSPPTIAVA
DASILAQSVDGVILVLASGEVNRDYALRAKEQLEKVGAKLLGVVLNKVEMKTREHYYYYYYGHEHKKRRHRREGNLPGPV
DKSGLGF
>gnl|bykdb|A0A0J1IJ51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus circulans] (length=236 residues).
MAASKKAKKGGLALNNRRKLIAKYDPKSPISEQYRNIRTNIIYSSVDEEIRSILVTSSGPGEGKSTTTANLAVVFAQQGK
TVLLVDADLRKPTVHYTFNLNNTAGLTSILTNQMNLMEAVHQNDEQNLYILPSGPIPPNPSELLGSKAMSHFLEQALEEF
DIILFDTPPVMAVTDAQVLANLCDGSILVVGSGKADKEAVVKTKELLASSTGKILGVVLNNKKADKKGSYYYYGTN
>gnl|bykdb|A0A0J1J7S4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Robinsoniella sp. RHS] (length=251 residues).
MKKVNFEKIDALNFQSSEAYKTLRTNIQFCGEKIKVVSFTSCLPNEGKSTLVFRLASSMAEAGKKVLMIDADIRKSVTVA
RYQADKKVQGLSEYLTGQCALDDCLCGTNIENMDFIFTGPVAPNPSELLGSDKFEELIARLRPEYEYIFIDCPPLGSIID
AAIVSTVSDGAVFVIEADIISYKFAQKVKQQLEKSGCKILGAVLNKVDMDGKGYYGRYYGKYYGKKYGGYYGYGYGEKDV
QNAAKEAVAGN
>gnl|bykdb|A0A0J5GMQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. LL01] (length=231 residues).
MARPNKQVKENNKRGLITHTNRKSPISEQYRTIRTNIEFAAVDEPIRTIVVTSTSPGEGKSTTSANLAVVMAQNGNRVLF
IDGDMRKPTAHYTFGVLNTKGLXNVLTRQVSLEEAVSQTKIENLEILTCGPIPPNPAEXLNSKGMELLLEKTKEQYEVII
IDTPPVMAVTDSQLLANKCDGTVLVVCSGKTDRQMALKAKDLLSQAKAKLLGVVLNKKEVKPGDNYYYYYE
>gnl|bykdb|A0A0J5R6D2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudalcaliphilus] (length=230 residues).
MARRELKSNGKKRALITHEKKKSPISEQFRTIRTNIEFSSVDKAIKTLLVTSSGPGEGKSTTTANLAIVLAQNGNSVLLI
DADLRKPTVHHTFGILNTRGLTSLLTKKAESDKAIQESEIENLSILPSGPIPPNPAELLSSKTMELLLDSFTQQFDIVLL
DTPPVMAVTDAQVLGNKVDASVLVVSNGKTDRNQAVKTKELLESTSSKLLGVVFNNKEVKKGHYYYYYGE
>gnl|bykdb|A0A0J5YVE4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus firmus] (length=223 residues).
MEHKRKLVTKNDPKSPISEQYRTIRTNIQFSSVDEEIRTIMVTSSGPGEGKSTTTANLAVVFAQQGKRVLLVDADLRKPT
VHYTFNLMNTSGLTSVLTNQMTLMESVKAIDMKNLFILPSGPIPPNPSELLGSKAMDYFMNAALEEFDIILFDTPPVLAV
TDAQILSNKCQGTILVAGSGKAEKEQLVKTKELLEAAKGKLLGVVLNNKKMKESQHYYYYGVN
>gnl|bykdb|A0A0J6CWX1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobacillus macyae] (length=223 residues).
MKRNQMLVTHLNPKSPVAEQYRTIRTNIQFASINEQIQTYMVTSPMAGEGKTTTITNLAVVMAQQEKKVLIIDADTRKPS
VHYAFQRNNIKGVTNVLTGQLSLKGAVIPTAVPNLDILASGPIPPNPSELLASPQMEQLLKEACRHYDIVLVDTPPVLIV
SDAQIMANRCQGSILVVNSGKTESDSANQAKDALIHAKAKLLGVVLNRKNKRRDKTFYYYGRQ
>gnl|bykdb|A0A0J6ENT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus glycinifermentans] (length=230 residues).
MSRLAIRKKRSRKYESALVALDQPNTPIVEQYRTIRTNIEFSSFEKPFRSLLITSGLPGEGKSFTAANLAVVFSQQEKKV
LLIDADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQTESLHVLTSGPIPPNPAELLSSQAMADLLKEAYEQYDL
VLLDSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
>gnl|bykdb|A0A0J6LCC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. LK2] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIATVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYSSN
>gnl|bykdb|A0A0J6NBG5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0J6WVZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera cerevisiae DSM 20462] (length=236 residues).
MEEINLVTRYKAKSPFAEAYRAVRTNLQFSGAGSAIQCIIFTSAAPREGKSTTAANMAIMMAQDGKKVLLIDADMRKAVQ
HIIFNLPNKGLSNCISMNTPFEEVVQKGIAAPNLDILPGGPMPPNPAELLNSANMAALLRQVRNVYDYIFIDMPPIMVVT
DAAVLASKADRVVLVVRSGVVPPARLQSAKERLEQGGARLLGVILNCVPQYRCDNYGYGAYYDEKAEKQHHESAPL
>gnl|bykdb|A0A0J6WZI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera cerevisiae DSM 20462] (length=238 residues).
MEEINLIAQYDAKSPIAEAYKAIRTNLQFASVGTAARVITFTSATPAEGKSTTISNVALTMAQDGKKTLLIDADMRKPVQ
HRIFGIPNQGLSNCIAMDVSWEETVQHDVVPHLDVLTSGPVPPNPSELLGSERMQKIISQVRTQYDYVLIDMPPVLAVTD
AVVMASRADGVVFVVKSGSISPEEANMAKTKLEQGGAHILGVVLNEVPRRQHGSYGYEYYYYYDEEHVKHRNSKKVNN
>gnl|bykdb|A0A0J7DER0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLNFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J7EYB2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J7H1I5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J7IDF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J8GB34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=219 residues).
MSNTKRNKRRKDSYSPTSEQFKLIRTGIDFSGIDEKKQVILITSPESGTGKSTVSSHLAVAYAEKGARTLLIDADMRKPT
LHKRFSKNLHLGLSNVMTGDISLEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMSELIESLRDSFDKIIIDTPPVT
IVSDALVLADSADGTVLVCRYHKTLKEKAKHAVNQLRLSKAKLIGVIFNGTKNAENYYY
>gnl|bykdb|A0A0J8GCD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=224 residues).
MLKLSERKLIAYANPSSPIAEQFKTLRAGIHFSSVDHKYKTILITSTEPESGKSTVSANLAVVYAQHGQKTLLIDADMRK
PTGHLTFGIRSNIGLSNLLASSDLAAAEVCSQTAIENLDILTSGTLPPNPNELLASKKMGQILEELASCYDQIIIDTPPI
LASSDALVLTSYVNGVILVLRSDKTLKDRAKIAVEQLRNTHVHIIGTVLNCVKNDSDNYYYYYQ
>gnl|bykdb|A0A0J8GCL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=224 residues).
MKKTSRKQLIAYKNPTSPVSEQFKTIRTSIDFSAIDSAFQTILVTSPEVGSGKSTIAANLAIVYAQQGKKTLLIDGDLRK
PTVHKTFSKNMFCGLSSVLTDQIDLHEACQNTEVPNLSILTSGAIPPNPNEMLSSNKMTLILEELKQEYDLIIIDTPPVT
IVSDALVIAQEVDGVILAVRYGVTLKDRIKQAVEQIGMTRTPIIGTVLNGVSEKKSNYYYYAYK
>gnl|bykdb|A0A0J8GDV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=224 residues).
MSEQITRGRNLITIVNPNGPISEQFKTLRTGIHFSSVDTKYQSIMITSPEPNNGKSTISANLAVCYAKQGNRTLLIDADM
RKPTVHRTFDIRVNVGLSNLLTGDMERSEVFRQTEIDNLVVLTSGTVPPNPNELLISKKMEKLMQQFSQEFDQIIIDTPP
ILASSDALVLTPYVDGTVVVLRSEKSLKDRTKIAVDQLRKTNVPIIGTVLNCVKNRLDNYYDYS
>gnl|bykdb|A0A0J8GH97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=232 residues).
MKKTDKKDIKNRLVALHEPSNPQAEYFRTIKTNIEMANIDSQIKSLLITSPTQDSGKTMISVNLASTYANDGVKTLIVDL
DLRRPSLGFAFPFLKSCPGLTGILDSSQKLTLDDAIVKIGDTNLYALPVGVRPVSPYSILNSEKLVQLIKQLQEEFDMII
IDTPPVLMVTDALLISKWVEACILIARGSYSNKKDVRKSLKSLRDSNANVLGAIFNNPQMKQTNYYYAESDA
>gnl|bykdb|A0A0J9BVJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-19142] (length=262 residues).
MDQILNLKNTGEKNYHFEESIKTLRTNMQFCGSSLKTIMFTSSLPNEGKSEITFSVAASLGSIGKKVLMIDADIRKSVLI
KRYEIKGNPNGLSQYLSGQKSLDEICYATDVENFDIILAGPYSPNPAELLEDSLFRELLEKAKERYDYIIIDTPPMANLI
DGAIIANQCDGAVIVIESGTISYHLVQKVKGQLEKSGCRILGAVLNRVDKEYENGYYKKYYGKYYGKYYRNTGGGGYRGI
SLWTEMGNNIYEANRKQEESKP
>gnl|bykdb|A0A0J9EWH6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-19142] (length=249 residues).
MKQIITLNRDMKDDYHYNEAIKTLRTNIQFCGNGIRTIMLTSSLPDEGKSDITFAMAASLAQIGKKVVMIDADIRKSVLV
SRYQLETEVYGLSQYLSGQKMLADVLYDTNVENLSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYSRYGKYGKYSKYGKYGKYGK
YEKYEKAEA
>gnl|bykdb|A0A0J9F007 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-19142] (length=247 residues).
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
QILDEAR
>gnl|bykdb|A0A0K0GCF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacilli bacterium VT-13-104] (length=232 residues).
MARKKPSKMNTKMRQLITKINPKSPISEQYRTIRTNIQFASVDNKIQSLLVTSSGPGEGKSTTTANLAVVYAEAGKKVLL
VDADLRKPTVHYTFRLDNLTGLSNVLVGENTLDEAANRTDIENLDVISCGPIPPNPSELLASKKMEQFISEATQSYDLVV
FDTPPVLAVTDAQILANMVDGSILVVRSKHTELESATKAKDVLEPARAKLLGTVLNGREKQGSNYYYYYGTN
>gnl|bykdb|A0A0K0QK30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0K0SG49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. indiana] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0K1KB17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. LC300] (length=232 residues).
MAANSRKKFQKAERNLITFDDPKSPISEQYRTIRTNIQFSFIDEPLQSLMVTSSAPSEGKSTTAANLAVVFAQQGKKTVL
IDADLRKPTVHYTFRLNNYTGLTSVLTNAVPLLSALQGTAIENLTVLTAGPIPPNPAELLSSKMMDRLFHELKEIYDLVI
FDTPPVLAVTDAQILANKCDGTVLVVASGKTETDAAVKAKELLEAANAKIVGVVLNQRKQREGSGYYYYQYK
>gnl|bykdb|A0A0K2LE28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus heilongjiangensis] (length=261 residues).
MEINQILRRGGSKVAFKLFKKTAKKLDNYSLSHGVSLVTYDNPISTISEQFNTIRTNIQFSSVDRNLQSILFTSSAPSEG
KSTVSNNVAVSWAKQDKRVILIDADLRRPTIHRTFGVSNHLGLSNYLSGTVDLETVIQPTMVENLFVITSGPTAPNPSEL
LGGNRINEMLATLTEQFDCLIFDAPPINSVTDAQVLATRVDGVILVVPCGIANKVGVTQAKKSLETVHAHILGFIMNRMT
KENMEGYYGGEYSGYYGAIQK
>gnl|bykdb|A0A0K2MHY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii NRRL B-598] (length=238 residues).
MFSAKRLNKAVANQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKR
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIKKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A0K2MKT3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii NRRL B-598] (length=240 residues).
MKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAVSFAQNEKK
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A0K6GM54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus suryakundensis] (length=233 residues).
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
LIDADLRKPTVHYTFRRDNYVGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSAAMEELLAEAYDQFNVV
LFDTPPVLAVTDAQILANQCDGTILVVQSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A0K6J109 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNVFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0K6JDF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=228 residues).
MRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|A0A0K6K993 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=238 residues).
MALRKSRGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHLENMIGLTTVLLKKSSLEQAVQAANATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|A0A0K6KHW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQMTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0K6MFE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0K8JA08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Propionispora sp. 2/2-37] (length=223 residues).
MEQKLVVHEDAKSPIAEAYRTLRTNMQFAKLDGELKVIMFTSAGPDEGKSTTAANTAVALAQSGKSVLIVDCDLRKPVQY
RIFAKKNRGVTDILIEENITAAQLIVDTTIPNLRVLPSGPIPPNPSELLGSQSMTKLLEELKQTADVIIIDAPPAIAVTD
ACVLASKVDGVILVLGAGLVRPDMARKAKELLIKAQGEILGVIMNRVEVEAEHAYYYYYYGNE
>gnl|bykdb|A0A0K9F5I0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus xylanilyticus] (length=214 residues).
MARKLVTDSKSIISEQFRTIRTNIRFSLPDQEIKSLLVTSSIPGEGKSTNAANLGVVFAQEGKRVIIIDADMRKPTLHHT
FSTINTDGLSDVLTRQKIYLNVIQKTSVEELSIIPSGPLPPNPVDLLSSKTMEILMQDLRKDYDIIIIDAPPLLSVSDSQ
ILSNKCDGTILVVNMDLVKKVDVLKAKATLVSSKAQILGVVLNNVKTPKNHYYY
>gnl|bykdb|A0A0K9GHX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27916] (length=250 residues).
MRRQRQEVYQGQEEVNQLVRKKSKKEIGMGNQRKLVTYSDPKSPVSEQFRTLRTNIQFTAVDEELQTILITSSGPSEGKS
TTASNTAVVFAQQGKRTLFIDADLRRPTAHYTFACLNTAGLTNVLTKQTTLEKAVQVVEPLGLHVLTSGPLPPNPAELLS
SRSMKELINQVKQDYDVIIIDSPPVTAVTDAQVLARECQGVILVVSSGRTQIEEAVKTKELLEHTGAKILGAVLNNKKIK
GSSYYYYGKK
>gnl|bykdb|A0A0K9GWN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus loiseleuriae] (length=234 residues).
MALKNKKKPVSDSKRKLIAKFNPKSAISEQYRTIRTNIQFSSVDKDIRSIVVTSSSPSEGKSTTVANLAVVFAQQGKNVL
LIDGDMRKPTVHYTFNDANTIGLTNVLTKQKELVDAIITTDEKNLFVLTSGPVPPNPAELLASNAMKDLMETAKEQFDIV
LFDSPPVLAVTDAQILANFCDGTILVVSSGKTESEAALKSKELLLAANANLLGAVLNNKKSNAGDYYYYYGSKD
>gnl|bykdb|A0A0K9H3A7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27231] (length=235 residues).
MRLRRKERKKAARGSALRKLIVQTNPKSPISEQYRSIRTSISFSSADQSVRSLMITSAGPGEGKSTVAGNLAVAFAQQEK
RVLLIDADMRKPTVHYTFNLANYNGLTNVLTKQMELSQTVNETDIPFLLVLTSGPIPPNPAELLGSKAMDDCLEEACENF
DIVIFDTPPLLAVTDAQILANRCDGTVMVINSEKTEINDALKAKELLQSVQAKIIGTILNNKKMSKSNYYYDSDE
>gnl|bykdb|A0A0K9M7P8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27238] (length=231 residues).
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKLMQTILVTSPGASEGKTITAANLSLMMAKDHKKTVLL
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIV
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAIKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
>gnl|bykdb|A0A0K9NAJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea sp. D27] (length=224 residues).
MQEIYLKNMGKDYRSNEAYKTLRTNIEFSGADNKVIVFTSCTPNEGKSTVSLSLAQSLAEGGKRVLFIDADLRKSVLIGR
HKVNGDLKGLSHFLSGQSEVDDIIYKTQEPGMMVIFSGVTPPNPAELLGYKRFSSLIASARKVYDYIIIDAPPLGSVIDS
AIVATVCDAAVLVIAANAISYKFARVVKEQLEKSNCSILGVVLNKVNMKQNKYYGKYYGEYGKK
>gnl|bykdb|A0A0L0QQG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus pantothenticus] (length=231 residues).
MSRKNPSRPGTKMRHLIAKLNPKSPISEQYRTIRTNIDFASVDKEIRTLLVTSSGPGEGKSMTAANLAVVYAQQGKKVLL
IDADLRKPTVHYTFRIDNLRGLSNLLVGENSLEQVVQQSDVDYLDVMSCGPIPPNPSELLASKKMEQLLETLKATYDIVI
FDTPPVLAVTDAQILANIVDGSILVVRSKHTEIEGAQKAVESLKPARAKLLGTVLNGREKKQSNYYYYYGA
>gnl|bykdb|A0A0L0RGN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. indicus] (length=261 residues).
MAFGRKKHLDKDTMKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASDGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHSTFNVSNSNGLTTLLTSRSVEMDASSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A0L1LKQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
NVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGQN
>gnl|bykdb|A0A0L1LVJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=237 residues).
MKQEVIQLARKDKEKLFQLRNRSLISLTNPKSSIAEQFRTVRTSIQFSGIEADLQSLLVTSPSPAEGKSTIAANLAVVFA
QQGKRTLFIDSDLRKPTVHYTFHIENHIGLTNILTGQVTLEEAVKTTRQENLWVLTSGPIPPNPSELLGSKGMDALLEKA
KDEFDLVIFDSPPVLAVTDAQVLSNLTNGVVLVINSGKTKIDDAKKTKELLENAKAKILGVVLNNKKEQANQYYYYE
>gnl|bykdb|A0A0L6JIJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933] (length=245 residues).
MTTINYEHEFKINESLEEAFKVLRANIHFCDPENKLKTIAITSYSSGDGKSCVSANLSYTIAKSGMKVLFVDADLRKPIL
YKKLVSKDFKGLSNYLLGNSTLEQIINKTQIEGFDFVSCGIKTLSPGELIASPRLGEFLIKTREIYDFVIIDTPPLGSVI
DGALISSQSDAAIIVVSQYKTKCNNAIMMKEQLQKANANILGVVFNKVNKLDFRNYYGGYDYDNKKTKYSRKLLKEIKNV
KRDNL
>gnl|bykdb|A0A0L6U303 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetobacterium bakii] (length=242 residues).
MQDTIITFRLPKSPISEAFRNMRTNITFSDIDNELQVLAITSTNKSSGKTTILSNYAVALAQSGKRTLLLDCDLRRPKIH
KKFELSNNKGLTNILLKEIEVINGIQETEVPNLFVISSGPIPPNPSEILASRRMGELVAELKNNFDYILLDAPPVGMVTD
AAVLSSVAEGYILVVAIGNCDRDGVRYSLESLAKVNANVIGIVANKVPINKRSGYYAYYSAYEEDRVLNEKTKKKQLKKE
PI
>gnl|bykdb|A0A0L6ZCA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium homopropionicum DSM 5847] (length=238 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDNNIKTILVTSSGPSEGKSTTAGNLALSMAQADKKILIIDCDLRKPTVHKKF
NISNEKGLSNYLIGEVKLEEVMTKYSDNLYLLTSGTIPPNPAEILSSKKMKEFLESVKNQFDSIVIDSPPVLAVTDAQIL
STIVEGVLLVVATGETEKEATIKSKELLKKVNANILGVVMTKMPVKTGKGYGYGYGYGYYYYYGEDHKKHTKRGKKKK
>gnl|bykdb|A0A0L7NHF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=234 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDRKVLLVDCDLRKPTVHKKF
HISNEKGLSNYLVGEALFEEVIVKYNENLSLLPAGTIPPNPAEMVASKKMKSFLDSLKGKFDCVLIDTPPVIAVTDAQIL
STVVDGVLLVAASGQAEKEAATRAKELLLKVNANILGVVLTKVPLNEGKGYGYSYYYYYGNEDEESKKGRRHKK
>gnl|bykdb|A0A0L9ZXL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=236 residues).
MDRNLSLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDGKKKKRSKK
>gnl|bykdb|A0A0M0EYF4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus butanolivorans] (length=227 residues).
MGFLRSKDEKQVNLIAQTNPKSPITEQYRIIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVD
ADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKNILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFD
TPPVLLVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
>gnl|bykdb|A0A0M0G0K3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus marisflavi] (length=222 residues).
MSTRRKLVTHDNPQSPISEQYKTIRTSINFSSIDQQIRSIMVTSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPT
SHYTFNVNNTFGLTSALSRQKTLREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAV
TDAQVLANKCDGTVLVLSSGTTEIDSAKKAKELLDTTNGRLLGVILNNREIKDTSYYYYGKK
>gnl|bykdb|A0A0M0KFV4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus okuhidensis] (length=235 residues).
MLGKGSKQKNGSEQRELITHIKKNSPISEQYRTIRTNIEFAAVDRELKTIVVTSSGPGEGKSTTSANLAVVMAQNGHNVL
FVDADLRKPTAHYTFRAVNTRGLTRVLMRQETLEEAIQETKVENLSLLTSGPIPPNPAELLNSKMMELIIKEVRDRFDIV
IIDSPPLNAVTDAQILSSKCDGTVLVISSGKTQKEEALKAKDLLDKSNANLLGVVLNNKELRNSNMYYYYGESDR
>gnl|bykdb|A0A0M0KRJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus marinus] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0M0KSK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus marinus] (length=238 residues).
MALRKSSGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHFENMIGLTTVLLKKSSLEQAVQASNATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|A0A0M0LHP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus koreensis] (length=237 residues).
MAKRFGKNKKVSNMRNLIAHLKPKSTISEQYRTIRTNIQFSNVDQKLRSIVVTSSVPGEGKSTTIANLATVFAQQDKRVL
LIDGDLRKPTAHYTFRLENRMGLTNVLTKQTRLASAIQRSEVKNLDILTSGPIPPNPAELLASQAMANLFTELYEHYELI
VFDSPPILPVTDAQILANQCDGAVLVVQSGRSDKEATQKAKELLDAAKGKLLGVVLNRKEQKASSGYYHYYGTDNNN
>gnl|bykdb|A0A0M0LLP3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Viridibacillus arvi] (length=231 residues).
MFKKKRKEHRRKLITSTDPRSIVSEQFRMVRANIKFSMKDKQFCTLLFTSASKGEGKSTVAANTAIAFAQEGKKVLLVDA
DLRKPTMHHTFNKLLSPGFTNLLMIQWKIADVVKESGIKGLDLITCGPIPSNPAELLGSTSMDLFIKEAKALYDIVVFDA
PPVLSVADAQILSEKCDGTILVINAGSTEKRFAVKTKEVLQSSKANIIGTILNNFKLEKGHYYYEYYGQDV
>gnl|bykdb|A0A0M0WU87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-21351] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGINVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSAKTEKDAALKAKDLLTQAKSKLLGAVLNNRKMNEGNYYYYYGSN
>gnl|bykdb|A0A0M0WZM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. FJAT-14745] (length=223 residues).
MPRKLVTVLDENSISSEQFRAIRTNIKFALPDKDLKTILVTSSTAGEGKSTSAANLAVVFAQEGKRVLIVDADMRKPTIH
HTFEMYNTSGLSTVLTRQEKLHEVVQQSFIVGLDVIVSGPTPPNPTDLLDSTTMDILMKEIYRDYDIIIFDAPPLLHIAD
AQILAHKCDGTLLVVDTDVALKDDMLKAKTLLTTARAKVLGVIMNNMALTRDHYYYQYSSNKK
>gnl|bykdb|A0A0M1NC91 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-21352] (length=225 residues).
MRSKDKKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIQTIVVTSAEPNDGKSTTAANLAIVLAQEVKKVVLVDADL
RKPSVHYAFSLSNIEGLTSVLTKKMSIEKALVKTNVPNLDILTSGPIPPNPSELLNSKAIEKAIDELKGMYDYIIIDTPP
VLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A0M1NZ20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-22058] (length=228 residues).
MGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVLLVD
ADLRKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIEIAINELKEMYDYIIFD
TPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A0M1UXR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MSIVAFKEPKSPISEAYRSIRTNIQFSNIDKDIKTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDFKKAIQNTEINNLQILTTGKMPPNPSEMLESKKMKEFAQTLEESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKERLEKVKANIIGVVLNKYVGEDGAYGYYSYCYEQNDGSRSARHKKKNKK
>gnl|bykdb|A0A0M1X983 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium E417] (length=232 residues).
MARTQKQKATQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0M2AJS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium EnGen0153] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTSANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLSNASGLSTTLSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0M2B107 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium OC2A-1] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNTSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0M2NRW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus pasteuri] (length=230 residues).
MSNVRRKYPKLIVNEQPKSPISEKFRGIRSNILFASADDPIKSVVVTSDGPGSGKSTTSANLAISFAQAGYKTILIDGDM
RKPTQHYLFKLPNNEGLSSLLLKWSDYESAIQSTHIEGLDVLTSGPIPPNPSELITSRSFKNMFDHISEKYNFVIIDTPP
VNVVTDAQLFSNYTQHAVYVVNVESNNKEEVKKGKQLLEKSGSKIIGIVLNKAPQEKNSKYYAYYGDDKS
>gnl|bykdb|A0A0M2PKD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA1-12] (length=233 residues).
MARKDRKQLFQLQNRSLISMTNPKSPIAEQFRTIRTNIQFSSVDEELQTMIVTSSGPAEGKSTTTANLAVVFAQQGKRVL
LVDADLRKPTVHYTFRLENHIGLSNVLTRQSSLQEAVQITSQEKLWILSSGPIPPNPSELLGSKGMQAMIEQAKDEYDVI
IFDSPPVLAVTDAQILSNLTDGVVLVVSSGKTEIDAAKKAKELLDNAKAKILGVVLNNKKVQDSQYYYYYGGK
>gnl|bykdb|A0A0M2PPJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA1-12] (length=233 residues).
MARKDKNKVFISQNRSLISLSNPKSPIAEQFRTIRTNIQFTSVDEELKTIIVTSAGPAEGKSTTTANLAVVFAQQGKKVL
MIDADLRKPTVHYTFNKENYIGLSNVLTKQETLVEAIQTTSQENLFVLTSGPIPPNPSELLGSKGMKSMLEEAKQEFDVI
ILDSPPVLAVTDAQVLSNVTDGVVLVTSAGKTEVDSAKKAKELLQSAKAKILGVVLNNKKAQDSQYYYYYGGK
>gnl|bykdb|A0A0M2PRY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA1-12] (length=233 residues).
MARKKFGSQLRNLSRNLITMTNPKSPVSEQYRTIRTNIQYSTVDQKIKTLMVTSSNPMEGKSTTVANLAVVFAQQGKKVL
VIDADMRKPTVHYTFRVENIVGLINVLSKEASIDQAIQSTENENLFVLSCGPIPPNPAELLESEAMNDLLDSVKEHFDFV
IFDTPPILAVTDAQILANKCDGTVLVIHSGKTEIDLAQKAKDMLVDANGKYLGVVLNAKKQQLGQHYYYYGGK
>gnl|bykdb|A0A0M2SM41 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus sediminis] (length=238 residues).
MMRHRKMNNEVASAKKIIVATKPHSPVSEQFRTIRTNIMYSSIDRPIRSVLFTSAVAGAGKSTIAANVAIAYAQAGKKTL
LLDGDLRRPTCHYTFKVSNQKGLSTAIVNDIASEDLVNQTEFDNLYLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMI
IVDSPPLLSVTDAQLLSKSADGVIMITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRDAKYRLKDDYYYHQASHDG
>gnl|bykdb|A0A0M2SQ00 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus campisalis] (length=229 residues).
MSRKTKRRQKNPVSLIAHTNPIAPITEQYRLIRNNIHYSSVDKIIKTVFVTSADPAEGKSTTAANLAIVMAQKGKKTILV
DADLRKPTVHYSFTVSNMEGLTSVLAKEISLEDTVLRTNVPNLDIITSGPIPPNPAELLDSKAMELLMGELKEMYEYIVI
DSPPILAVTDPQIMATKCDGVVLVVASGKTQKDRAVKAKELLERSGAKIIGVVVNGVEEKLEGYYGHYR
>gnl|bykdb|A0A0M2SXK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus campisalis] (length=232 residues).
MALRKKQKPSIERRKLVTSFDPKSPVSEQYRTIRTNIEFSAVDEEIKTIMVTSAGPGEGKSTTSANLAVVFAQQEKRVLL
VDADLRKPTTHYTFNQTNTFGLTTVLAGQMALKDAVNTTNVDNLEVLTSGPIAPNPAELMGSKSMERFLNEAKESYDVVI
FDTPPILAVTDAQVLANKCDGTVLVLYSGRTEMEEASRAKELLQSAKGKLLGAVLNHKKLENSDYYYYYGKK
>gnl|bykdb|A0A0M2T0F1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus campisalis] (length=232 residues).
MVFSFRKKAAPSNKRKLIAVEDAKSPISEQYRTIRTNIQFTAVDESIKTIMISSAGPGEGKSTTAANLAVTFAQQEKRVL
LVDADLRKPTVHYTFNLANHYGLTSILTNGKALDEAISPTGIENLSVLTSGPIPPNPAELLGSKKMKQLLQQVKEEFDVV
IFDTPPALAVTDGQILANSCDGIVLVLYSGKTEVDQVTKAKNLLAAANGRILGVVLNHKKIQGSNYYYYYGS
>gnl|bykdb|A0A0M2U580 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium PH28_bin88] (length=231 residues).
MPRSLQQTIAYHEPKSPATEAYRTLRTNIQYASVDHPVNSLLITSAGPGEGKSLTAANLAVVMAQSGKETLLVDCDLRKP
MQHRLFGLRNNRGLTSLLVQGGDPGTVTQQTEVAHLNIITSGLIPPNPAELLGSQAMKPLVQELKSRYATVIIDGPPLIA
VTDAALLAPRVDGVLLVIRAGEARIDMVQEAKSIIENAGARVIGCVLNGVRRKSKDYHYYYYYAEKSGTDD
>gnl|bykdb|A0A0M2VKA5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. DMB20] (length=229 residues).
MLRSANKPKLIMQTNRRSRISEGYRNIRTNIQFSEWNGRRHVLAVTSTQAGEGKTTTISNLAVAYAHEGKRVLLIDADLR
NPSLQDIFQSSNKTGLSNLLANQCSHAEVVRKTEIDHLSLITAGPIPPNPTELLSSGKLREYLEIWKGSYDIILIDTSPV
MAVADGLIVSSMSDGVILVIQSGKVKREHILKSKERLGHVQAQIIGVVLNNKKINKAEARHYNYYGLRS
>gnl|bykdb|A0A0M2ZR22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYKTKKESLAKTKKILEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A0M3DGN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paraclostridium benzoelyticum] (length=248 residues).
MKIKVRKVVNKMINITTFNDPKSPIAESYRSIRTNIQFSKLDNEMKTIVITSSKQDEGKTTVSSNLAVSFASLEGKKVLL
IDADLRNPSVHKMFTKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIF
IDTPPIGIIMDAGVLANYADGTILVVGAKDVETERAKISKERLEKVKANVIGAVLNKYIEKNGSYGYYSYYYEQSDSSRV
SKKKKKKH
>gnl|bykdb|A0A0M3RB28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus gobiensis] (length=221 residues).
MTKDNPRSIIAMFQPKSPIVEQFRTIRTNIEFSSMEDHIRSILVTSAHSSEGKSFIAANLAVVFAQQEKKVLLIDGDLRK
PTNHGLFQLDNSIGLTNVLMRQRTLENAVQASTVENLDLLTSGPTPPNPAELLSSRAMEDLLVQAYDRYSLVIFDSPPIL
AVADAQILANQTDGSILVIASSKTKNEDAKKAKDALEASKGKLLGALLNNKKMRKNELYVY
>gnl|bykdb|A0A0M3RB32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus gobiensis] (length=213 residues).
MEPKSPSSEQYRTIRTNIEFSSVDKNVRSILITSSGPGEGKSTTAANLAVVFAQQGKRVLLIDSDLRKPTVQYTFQLDNT
DGLTTVLLKQMSLKTIVQKCMVDNLDILTSGPIPPNPAELLSSKSMGKLLEDAYKIYDIIIFDSPPVLAVTDAQILANHT
DGSLLVVSSGKTEKELAVKAKEVLSSTKSKLLGAVLNGKKLEQSSYYYYYGGK
>gnl|bykdb|A0A0M4CSE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=226 residues).
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVIVDAPPILPV
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A0M4FWC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-22090] (length=230 residues).
MFKKKNNRNQNKRKLVISTNPKSIVAEQFRTVRANIKFAMKGKEFKTLLFTSASVGEGKSTVAANVAISFAQEGLKVLLI
DADLRKPTLHYTFSILISPGFTNFLMSNWKLEDVIRESEIKGLHLITSGPIPSNPSELLGSDLIYDLWKKIKSRYDIVIF
DAPPILSVADAQILSEKCDATILVVDSGKTEKKNILKAKEVLEASKANTIGVILNNFILEKDHYYYEYYG
>gnl|bykdb|A0A0M4G5Y2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-22090] (length=236 residues).
MFKKRSRNKKIQTAARKLITIENPKAVVSEQFRTVRTNINFSMPDKELKTLLITSSTPGEGKSTSAANMAIVFAQEGKKV
LLIDSDMRKPTMHHTFHITNTVGLSNLLTRKLTMQDVVVDTNIECLDLITSGPIPPNPAELIGSKTMDILMNELMEKYDL
IIFDAPPLLSVTDAQILSNKCDGTILVINSGTTEKSNVIKAKEALIASKAKILGTLLNNFVLDKDHYYYQYYGSVE
>gnl|bykdb|A0A0M4GAZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-18017] (length=229 residues).
MAKKKLLQGKRKLITKLDPKSPISEQYRTLRTNIQFSSVDEEIKKIMVTSSGPGEGKSTTTANLAVVFAQQGKSVLLIDA
DLRKPTVHYSFNLTNTIGLTNVLSHQVNLEEAINETDVKGLYVVSSGPIPPNPSELLGSRMMDSFIKEAEGKFDIIMFDT
PPVLAVTDAQILSNKCDGTILVVSSENTEIEQAVKAKELLTTAQAKVLGVVLNNRKFEKNQQYYYYGVK
>gnl|bykdb|A0A0M4K1Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=231 residues).
MPVLELSNNKKQSIQKTEEYYNALRTNIQLSGEDIKIVAVTSVQPNEGKSTTSTNLAIAFARAGYTTLLIDADIRNSIMS
GVFKSKERITGLTDYLVGKNDLSQGLCETDVSNLFVIESGQSSPNPTALLQSKNFDEMMNILRRHYDYIIVDTPPIGLVI
DAAIISQKCDASLLVAEAGSVKRKALQKSKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
>gnl|bykdb|A0A0M6W8C0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei] (length=249 residues).
MNWSLKSILPNRKIDQETQKNGVLLVTFAEPKHVVSEQFRTVRTNIEFAGAALNKCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTIQATFRKLNLDGVTTVLTGKMKPDEVVSDTFVEGLSVVTSGPVPPNPSELLNSKKMIQLLD
WARDNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLQRTVEVLKLAKAKILGSVERVKTKRGDRGYGYGY
GYGYGNEKN
>gnl|bykdb|A0A0M6WRN5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
RIRAKLESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
N
>gnl|bykdb|A0A0M6WZD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Roseburia faecis] (length=242 residues).
MKSVTFENLKKQNYTMKESLRALKTNIQFCGDDICTIVVTSAMPNEGKSTVTMDLARSFSESGKRVLLIDTDMRKSVYVG
RLRAVASDGREIYGLSHFLSGQRKLEDVLYGTTIPGLFMIFAGPSVPNPTEILEKKYFTELLNFAKEHFDYVLLDCAPIG
AAIDAAVIAKHCDGAILVIAQGMASGRLIQTVKKQMEASGVRVLGAVLNKVRMKKNGYEGGYYGGYYGSYYGNYGEHHEK
NA
>gnl|bykdb|A0A0M9BJV0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. A59] (length=227 residues).
MPRLTNDKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPTVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEEYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKSRNAYYGENA
>gnl|bykdb|A0A0M9DC63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGELKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0M9GTQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. CHD6a] (length=236 residues).
MALKKNKLINKAKATTSRHLISDKLPKSPISEQYRTIRTNIQFSSVDQQLRSIMVTSSGPSEGKSTTASNLAVVNAQQGK
KVLFVDADLRKPTAHYTFQQENFRGLTTILTRQTSLSETIQPTRIANLDILTSGPIPPNPAELLSSKAMEDLLAAVYHSY
DLVIFDTPPVLAVTDAQILANQCDGTVLVIASGATDKDSAIKAKELLNSAKAKLLGVVLNMKKLKESSYYYYYGVK
>gnl|bykdb|A0A0M9WUY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. FJAT-14222] (length=235 residues).
MFRTKKKRKLLTLARKLVTVYDSKSILSEQFRTIRTNITFSLCEQDEKTMLITSSIPGEGKSTNAANIGIVFAQEGKKVL
LVDADMRKPTIHHTFHLTNTVGLSSLLIRQKILETIIQTTSVEGLSVITSGPIPPNPAELLASKAMNEFFETVKKEFDIV
IFDAPPLLSVTDAQILANKCDGTLLIVNTGVVEKLNVIKAKSILINAQAKILGVVLNNYVFPRNHHSNQYYNSIE
>gnl|bykdb|A0A0M9X1L6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus contaminans] (length=221 residues).
MARKLVTVTDSKSLISEQFRTMRTNIRFSMPDQDIKSLLVTSSIAGEGKSTNAANLGVVFAQEGKRVLIIDADMRKPTLH
HTFRTLNSSGLSDVLTRQQIYFNVIQKTSVEGLSVIPSGPLPPNPVELLSSKTMDILMQDLRKDYDIVILDAPPLLSVSD
AQILSNKCDGTLLIVNMDVAQKVDVLKAKATLSSSKAKILGVVLNNIKIPKNHYYYQTYGS
>gnl|bykdb|A0A0N0UVK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGNLKSLMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0N1CLC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. RIT-PI-f] (length=234 residues).
MAKKQERKATQTHAVSLITLVDPSSPIAEQYRTIRTNIQFASSADRRIQTIVITSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFNLSNASGLSTVLSTSTSVLEVAQKTVIDNLSVLTSGPKPPNPSELLGSTRMNQVMEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTIVVVRENVSRKESLSKAKELLNMVQARVLGVVYNGAENSKDSSYYYYYGN
>gnl|bykdb|A0A0N1CRX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. RIT-PI-f] (length=228 residues).
MAKKNTNLSPVSLMTVANTNSVIAEQLRTIRSNINFSSVDKELQSMVITSSGAGEGKSTTSANLAVVFANSGKRVLLVDA
DLRKPTVALTFRLPNHRGLSTLIADREGQLEQHIQESGVENLSILTSGPIPPNPSELLQSQRMTDLIPELTRQFDLIIFD
MPPIGVVTDAQILASKTDGTLLVVRERKTTKQGLIKAKKLLTLANAHLIGVVYNGVKKGNADNYYYYA
>gnl|bykdb|A0A0N1IZI9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGNLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDAIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRVKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0N7CIR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum 3872] (length=249 residues).
MGLFKHRYTESTDTMNNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGV
REVYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
YGYGYEDER
>gnl|bykdb|A0A0P0EME6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum] (length=266 residues).
MSLFKKKRGTDETIKNGVKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
GYGYGYGYGYGEEDKKKKGFFSRLKK
>gnl|bykdb|A0A0P0NBB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus anginosus] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A0P1GKW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei subsp. paracasei] (length=253 residues).
MRGKSMNFSLKEILPHHKVDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDVCKVIMFTSSAMSEGKSTVSA
NVAVTWAQSGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRM
GKLLDWARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKLANAKILGSVERVKAKHGDRG
YGYGYGYGYGNEK
>gnl|bykdb|A0A0P6WE77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus vietnamensis] (length=224 residues).
MNTKRKLITKTDPMSPISEQYKTIRTNINFSFIDQELRSLMVTSSGPGEGKSTTSANLGVVFAQEGKRVLLVDADMRKPT
AHYTFGLNNTFGLTSVLTRQKSLTEVTHSSDVKNLDLLTCGPIPPNPAELLNSKRMEHFFKEVHEEYDMVIFDTPPVLAV
TDGQILANQCQGTILVISSGTTEVDRAVKSKELLEAAKAKLVGVVLNNREMKDSNYYYYYGGNK
>gnl|bykdb|A0A0P7GBK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus australimaris] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLV
DADLRKPAVHEYFDLSYHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSSPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLDGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A0P7IYH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGELKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNISNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0P7JZF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVAEQFRTVMTNISFANIKGELKSLMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVDQLKKVNANILGGVMNMSKDNVTNDYYYYYSK
>gnl|bykdb|A0A0P7K1M7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGELKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0P7KDU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. ZYM-1] (length=232 residues).
MLFKRKTKKSPMARKLITVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQSTIEDVIQETFVEGVDIISSGPIPPNPTELLASETLTALLVEVKVRYDMII
IDAPPLLFLSDAQILSNKCDGTLLIVNTGTVGKAAVVKSKSILTISKANILGVILNNFKINGSTYEQYYGKE
>gnl|bykdb|A0A0P8UZR7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloranaerobacter sp. TR13] (length=248 residues).
MDQIRLVTQENPKSPVAEAFRTLRTNIQFSNVDKELKSILITSPGPGEGKSTTIVNLAVTMAQNDKRVLLIDCDLRKPRI
HKNFGISNSKGLTTILSENIDYKEILHSIGIGLQLDVLTSGPIPPNPSELLGTKKMKAFLEKVEADYDIVLIDSPPVGMV
TDAAVLSTITDGVILVCAAGQSIIEGAKNAKALLQKVKANILGVVLTKVPIGDGKYYKYHYYSYYYDYFNDENNEEKGRR
RKKAEANA
>gnl|bykdb|A0A0P8X4L7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0P9C2V3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alicyclobacillus ferrooxydans] (length=225 residues).
MPVKTSRAWPISQTHPESSYAESYRSILTNIELLSINVKSIMVTSAHPGEGKTSTAANLAIVATQASKRVLLVDTDLRHP
QLAQRFGVANEEGLTKVLRQGCDAQDVIVPTEIPGLHVLPSGAVGLNSPSLLSSLAFTSLVNRLKSKYDLVVFDAPPVLP
VSDPLVLSRNVDGIVFVVDGRTTNRLVAQRALKELHKVNGTIIGGILNRGSFENDHSYYYGSSDI
>gnl|bykdb|A0A0P9DM48 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. A3] (length=226 residues).
MSRSDKRRPVIAHSHPKSPISESYRTLRTNIQFSSVDRLYRTLMVTSSSPMEGKSTTINNLAVVYAQSNKKVLLIDADLR
KPTAHHTFHLSNRYGLTDMLTSQCTLDMAVKETDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELKRQYDIVLLDTPPV
LAVTDSQIIAAKCDGVILVIDSGKIKRDMAQKAKNSLELVQANLLGVVLNRISRPSGNAYYYYGNE
>gnl|bykdb|A0A0Q0TXL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium butyricum] (length=241 residues).
MFFKSKLEKAVDNQKHMGFVMERKPKSVVSEAYRTLRTNIQYSSFDKKIQTIVVTSAEAAEGKSTVSGNLALAFAQNEKR
VIIVDCDLRKPSVHKNFKVSNLCGLSEVLIGKSELNNVIQNRNEHLDILTSGKIPPNPSEMLSSSAMTKLIETLKEEYDV
IILDSAPLGAVTDAQILSTKVDGTILVTRAERTKREIVLEAKNSLEKVGANILGCVLHAVENTKGKYYYYYGTDGEHKKK
N
>gnl|bykdb|A0A0Q0UQV5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. PA-3] (length=232 residues).
MAAKKRKKFQKAERNLITFDDPKSPISEQYRTIRTNIQFSFIDEPLRSLMVTSSAPSEGKSTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYAGLTSVLTNASPLSSALQDTSVENLTVLTAGPIPPNPAELLSSKMMDRLLRELNEMYDLVI
FDTPPVLAVTDAQILANKCDCTVLVVSSGNTETDAAVKAKELLEAANAKLVGVVLNQRKQREGSGYYQYQYK
>gnl|bykdb|A0A0Q0YJS7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc lactis] (length=254 residues).
MVFFKKKYKTGRDGLSVETMMEGARLIAAAEPKNPVSEQFRTIRTNIDFAAVAKGNVKTLLVSSALPSEGKSNVTANLAV
VYAQQGKRVLLVDTDLRRPTVARTFGVTDNHGLTNYLADVNSDMGSIVRHTRMSTLDVVASGPVPPNPAELLASSRMTNL
ITELRQQYDLIIFDVPPFLMVTDAQVLMSKVDGVAIVVSGRHTTKGALQRTTDMLKLADAPMLGFIYNDRSRKKTSGSGY
GYGYGYGYGYGETK
>gnl|bykdb|A0A0Q0YMB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium butyricum] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0Q1DTL1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. Sah69] (length=232 residues).
MARKPAASIRKAERKLITFDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTRSGEGKTTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A0Q3VZ53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus sp. FJAT-21963] (length=232 residues).
MFKKKKRIPTVRKLVTITDPKSIVSEQFRTLRANIKFAMKGEEMGTLLFTSASVGEGKSTVAANVAISFAQEGKKVLLVD
ADLRKPTVHYTFNTLISPGLTNRLMSHWKFENIVKNSGIVGLNIVTCGPIPSNPAELLGSTSMDIFIEEMKSKYDIVIFD
APPVLSVADAQILSNKCDGTILVISSGATDKRNVVKAKEALQASNANIIGTILNNFKLDKSHYYYEYYGEVE
>gnl|bykdb|A0A0Q3W8A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-25509] (length=231 residues).
MVRKMAKESLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A0Q3WCR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-21955] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A0Q3WXV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus shackletonii] (length=233 residues).
MRQLLRKHKNIVKDEIKLITYYQPQSYITEQYRLLKNNIQFSSVDKEIKTIVVTSPEPADGKTTTSANLSIVLAQQGKRV
ILVDSDLRKPSVHYSFNISNLHGLTNVLTREISLENAILKTHIHNLEVLTSGPIPPNPSELLESKAMELLIYQLHSGFDY
VVFDTPPILAVSDSQILANKCDGVIMVVSSGKTRKDAALKSKNILLQANARLIGVVMNGIEQKRREDYYQYGP
>gnl|bykdb|A0A0Q4QG39 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Leaf72] (length=230 residues).
MRRLTSETNLVALTNPNSPISEVYRTLRTNIQYAEIDTPKQILMIASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
KPSLHQVFDKPNRIGLSSAISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPV
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETAKS
>gnl|bykdb|A0A0Q4RJY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Leaf72] (length=225 residues).
MSRTKPNWPLITETNPKSPISEAYRILRTNIDFSNLEEEIRTLMVTSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMR
KPTQHQLFRVSNQIGLTSVLSNQKEWETAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPI
MVVTDAQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
>gnl|bykdb|A0A0Q6HRT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Leaf13] (length=227 residues).
MGFLRSKDEKQVNLIAQTNPKSPITERYRIIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVD
ADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFD
TPPVLLVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
>gnl|bykdb|A0A0Q6I7X8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Leaf75] (length=224 residues).
MLTLKRRLLSHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLATVYAQQGLNVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTRQSSLGQAVQQTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A0Q7T431 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Root52] (length=226 residues).
MSRLTNENNNLVTYFNSKSHISEGYRKLRTNIQFSSIDSHIKTIMVASAQAGEGKTTTISNLAVTYAQEGKKVLLIDADL
RNPSLHQVFSVPNHIGLSSVLSNQYDVDEVLRESYIENLQLFTSGPIPPNPSEMIGSNRMKNLMNDLQSKYDVIMFDTPP
VLAVTDALIVSSFCDGVLLVVNSGKVKKELVKKTKAHLEHVNARILGAILNNIKTTSNSVSYYGEK
>gnl|bykdb|A0A0Q9FWB0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Root147] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGLNVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSAKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A0Q9G4W6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Root131] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0Q9I016 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Root239] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGSN
>gnl|bykdb|A0A0Q9LEW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil522] (length=230 residues).
MSQSKNKRQMITVTNPRSPISESYRALRTNIEFSSIDETLQVLMVSSAGPGEGKSTTITNLAITFAQSEKKVILIDADLR
KPTAHHTFSLSNRWGLSSVISQQSKLEEVIQASDIPNLDVMTSGAIPPNPAEMMGSKKMTSLLEQLRQMYDIILIDTPPL
LAVTDAQIVATKSDGVILVVDQGKVKRDIASKAVKSLESVKARILGVVLNNVKRKANEEVYYYYYGVQEK
>gnl|bykdb|A0A0Q9LUB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil750] (length=229 residues).
MSNSTNKRPIITHQNPKSPISEAYRALRTNIQFSSIDEELRVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLR
KPTMHHTLRVSNRWGLTNLLTNQLTIREVLQDTFIPNLQIITSGPIPPNPSEILASKKMISTIDELKQSFDVILIDAPPA
IAVTDSQIIASRTDGVILVVNSDRTKREAVLKAKQNLDNVRARILGVVLNNVDRKNKDAYYYYYYGESQ
>gnl|bykdb|A0A0Q9NB04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil750] (length=229 residues).
MRTLINRHQLITELHPKSHVSESYRTLRTNIQFSSIDRIMKTILVTSAQPGEGKSTTAANLSVAYAQEGKKVLIVDADLR
KPTIHHYFGVSNRYGLTSAIVNRTQFDEFISETSIENLSLITSGPIPPNPSELLMSQKMTAFLEEMTARFDVIIIDSPPT
LAVADAQILATKCDGVVMVISDGKVKRDMARKAIHNLERVQAKILGVVLNNKRHRKSDAAYYYYYGDKE
>gnl|bykdb|A0A0Q9NZ66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil766] (length=229 residues).
MLNSVNKRPIITHQNPKSPISEAYRTLRTNIQFSSIDEELRVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLVIDGDLR
KPTMHHALQVSNRLGLTNLLTNQLTITDVLQVSSVPNLQIITSGPIPPNPSEILSSKKMLSVLDELKQQFDIILIDAPPA
IAVTDAQIIATRSDGVILVVNSDKTKRDVVLKAKQNLENVRARILGVVLNNVDRKNKDAYYYYYYGESQ
>gnl|bykdb|A0A0Q9Q2L5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil766] (length=229 residues).
MRTLINKHQLITETHPKSQVSEAYRTLRTNIQFSSIDRIMKTILITSAQPGEGKSTTAANLSVAYAQEGKKVLIVDADLR
KPTIHHYFGKSNRYGLTSALVNRTQFDEFISETSIENLSLITSGPIPPNPSELLMSQKMTAFLEEMAARFDVIIIDSPPT
LAVADAQILATKCDGVVMVISDGKVKRDMARKAIHNLERVQAKILGVVLNNKRQKKSDAAYYYYYGHTE
>gnl|bykdb|A0A0Q9S9G4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil787] (length=229 residues).
MFRSDKRRPVITMINPKSPISEGYRTLRTNIQFSSVDKHYQTLMITSSEPMEGKSTTINNLAVVYAQMNKKVLLIDADLR
KPTAHHTFQVSNRHGLTDLITNQCSLEMAIKETDIPNLYILTAGSIPPNPSEILASQKMSGQLDELKELFDFILIDTPPV
LAVSDAQIIATKCDGVILVVDAGKVKRELVQKAKSSLEFVKAHILGVVLNKISQKEIANSYSYYGGEVE
>gnl|bykdb|A0A0Q9T8B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil787] (length=229 residues).
MPVPTNKHQLITEINPRSHISEAYRTLRTNIQFSSIDQVIKTILVTSAQPAEGKSTTVANLAVAYAQEGKKVLVIDADLR
KPTMHHYFGKSNRKGLTNTLASQNDVDDVMFDTTVDNLFLIPSGPIPPNPSELLTSQKMTAFLEDMAARFDVIVVDSPPT
LAVTDSQILAAKCDGVVLVINEGKVKRDVAKKAIDNLKRVQAKILGVVLNNKRHSKGDSTYYYYYGHKE
>gnl|bykdb|A0A0Q9UMF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Soil531] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMREQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNHKVEEDNYYYYYGTN
>gnl|bykdb|A0A0Q9VKT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Soil768D1] (length=225 residues).
MRRKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSIHYAFNLSNIHGITSVLTKKMDLRKTISNSNVPNLDILTSGPIPPNPSELLNSKAIETAINELKGIYDYIIFDTPP
VLIVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKQLLEKANTALLGVVLNGMESNTSNYYYYQS
>gnl|bykdb|A0A0Q9Y407 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus soli] (length=231 residues).
MAKQNLKPQSGKRKLVAKANPKSPISEQYRTIRTNIEFSAVDEEIRTLMVTSSGPAEGKSTTTANLAVVFAQQGKKVLIV
DADMRKPTVHYTFGVTNTIGLTNVLTRQATLEDAARSTDVENLNVLSSGPIPPNPAELLGSKGMQLFFEKAKELYDMVIF
DTPPVLAVTDAQILANKCDGTVLVVASGKTELESAQKTKELLSAAQAKLLGVVLNNKKMEKTDYYYYYGTN
>gnl|bykdb|A0A0R1EM05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus zeae DSM 20178 = KCTC 3804] (length=249 residues).
MMNWLFKFGFKRKQEDQESQKNGVMLVTYAEPKHVVSEQYRTVRTNIEFAGAALDKCQVVMFTSSTMFEGKSTVSANVAV
TWAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTVLTGKSKPSEVVEETFVDNLSIIPSGPIPPNPSELLNSKRMSDLL
DWTRENFDIVVLDAPPVLAVSDVQVLVPKTDGVVIVTKIGQTQKSDLRRTVEVLKLAKAKILGSVERVKSRHGDKGYGYG
YGYGYQSNA
>gnl|bykdb|A0A0R1FC80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001] (length=247 residues).
MALFKKKKQLDSSSMKNGVGLITVTKPTSSIAEQFRTIRTNVQFSSADRQLKTLLFTSADPSEGKSTISANVAVTWADQG
NKVLLIDSDLRRPAVARSFRVSNSQGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPVNKVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYGGYYGGY
YGTDDKK
>gnl|bykdb|A0A0R1FCH0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. delbrueckii DSM 20074 = JCM 1012] (length=246 residues).
MKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSDMASTGKSTVSANVAVTMAQAGKKTILIDADLRRPT
LHPTFNVSNSNGLTTLLTSRGKEMDASSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEVLKQEYDMVVIDLAPI
LDAGETQQLTSSLDGTILVVRQAHSQKLAVKRAVELLKLTNSTILGYVMNDVDADGDGGYGYGYGYGYGYGYGEEKEKKG
LFGRKK
>gnl|bykdb|A0A0R1FKW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei DSM 12361 = ATCC 700308] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGDLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNISNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVTEKKRAKMAVEQLKKVNANILGAVMNMSKDNMTNDYYYYYSK
>gnl|bykdb|A0A0R1GF52 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus bifermentans DSM 20003] (length=233 residues).
MQHGVSLITVNDPTSVVSEQFRTIRTNIQFSAVASKLKTLLVTSAGPSEGKSTVSANLAATWTAQNTNVLIVDADLRRPT
VHRTFGLSNNQGLTTLLTNPEVKLDQVIMQTAVNHLYALPSGPIPPNPAELLGSERMDKLMQILKNSFDLVLFDVPPVIS
VTDAQIMANKVDGVILVTPQGLAEKGAVMKSKELLEAVHANILGVIMNRVHAEGTGGYYGGYYGGYYGTDDKK
>gnl|bykdb|A0A0R1GM06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus parabrevis ATCC 53295] (length=223 residues).
MIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTWADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTN
YLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSELTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVL
VVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNYYGGSYYGGYYGTDDKK
>gnl|bykdb|A0A0R1GPK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus DSM 20584 = JCM 1185] (length=261 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIENLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIVDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A0R1GXK7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylotrophicus DSM 20534] (length=242 residues).
MAIFKKKSNGLQPVAAANLFTLNNPSAVATEQIKTIRTNISFSQEAQNLQTIMITSTVASEGKSTIAANLAVEFAHAGKN
TLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRFEELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKES
FDLVIVDAPPLLPVTDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGEGHYDNN
EQ
>gnl|bykdb|A0A0R1H6K0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus DSM 20531] (length=260 residues).
MPLFKKKRGTDETIKNGAKLITVAKPKSPVAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVAQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A0R1HGX3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus algidus DSM 15638] (length=246 residues).
MGVIKMSLFKKDKKLSTDSIDNGVGLITVTQPTSTIAEQFRTVRTNIQFSSIDKEMKVIMATSSGPSAGKSTVITNLAVT
YANQGLKVLLIDADMRRPTAHQTFGLSNETGLTNCLTEKDIDIAKAVEETPIENLYVMPAGPTPPNPSELLNTKRMDAIL
MAVAEQMDMVIIDTPPLISVTDAQIVATKVDGTILVVREGVAKKGAVLKAKELLDTVHARIIGTILNDVSGSDESGYYGG
YYGYYK
>gnl|bykdb|A0A0R1IBH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paralimentarius DSM 13961 = JCM 10707] (length=247 residues).
MALFKKKTTKLDNYSLKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSASSEGKSTVSNNVAVTWAKQ
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRNKDLINRLED
KFGLLIMDAPPANSVTDAQVLATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYSGY
YGAEKEK
>gnl|bykdb|A0A0R1J163 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus tucceti DSM 20183] (length=247 residues).
MPLFKSKTKKLDKYSLKHGVGLITYDDPTSATSEQFNTIRINIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWANQ
GEKVILMDADLRRPTVHKIFNVSNRVGLSSYLLGNASFEEIIQPTMVNNLFVITSGPIPPNPSELLGSMRTKDLLTRLED
KSDLLILDAPPANSVTDAQVLAAQVDGVIMVVPQGIAEKAGVAHAKQALETVHANILGVIMNRVTKEKYSGYYGGYYGGY
YGAEKKK
>gnl|bykdb|A0A0R1J1W2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus farciminis KCTC 3681 = DSM 20184] (length=251 residues).
MKMKLFKGKRKKLDNYSLKHGVGLISYDDPTSTVSEQFKTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWA
KQGDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRL
ADKFDLLILDAPPANSVTDAQVLATKVDGVILVIPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGG
HYGGYYGADKK
>gnl|bykdb|A0A0R1JGZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sakei subsp. sakei DSM 20017 = JCM 1157] (length=247 residues).
MGLFKKEKSLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPLQGKSTVSANVAVTWADQG
VNVLLVDADMRRPTVHQTFQVPNKKGLTSLLTGDKFDFNTTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVPPVVSVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVHARILGTIMNRVKAENTGGYYGGYYGGY
YGAEEIK
>gnl|bykdb|A0A0R1JNI6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus namurensis DSM 19117] (length=251 residues).
MAWFKRKPKKLDNNGLKYGVGLVTYDDPSGMVSEQFKTIRTNIQFSSVGEELHSIMFTSSEPSEGKSTVSNNVAVTYADQ
GTKVILMDADLRRPTVHKTFGVSNRFGLSGYLAGNASLDEIIQPTMVDGLSVISSGPVPPNPSELLTSSKMATLLNDLKA
KADLLIVDAPPVNTVTDAQLLGARVDGTILVVPQGIAVKAGVRRAKQSLETVHANILGAIMNRVTAQKSGGYYGGYYGGN
YGGYYGTEDKK
>gnl|bykdb|A0A0R1K5Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nodensis DSM 19682 = JCM 14932 = NBRC 107160] (length=254 residues).
MAFNIFSHKKHKIDNTSLKYGIGLVTYTDPKGMISEQFKTVRTNIQFSSVDKKLKSLLFTSSDPSEGKSTISNNMAVTWA
DQGSKVILVDADLRRPTVHKTFSVSNRKGLSNYLLGNATLEEIVQETVVDGLYVITSGPVPPNPAELLGSMRTQDLLVRL
MDKFDLLILDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVLHAKEALKTVNANILGAIMNRVTEQKSGGYYGGSYY
GGYYGGYYGADKHK
>gnl|bykdb|A0A0R1K612 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nodensis DSM 19682 = JCM 14932 = NBRC 107160] (length=241 residues).
MMFGMKKNKLDSTSQKHGVNLITYNHPQDVVAEQFRTIRTNIQFTAVDKKIKSIVFTSSEPSEGKSTVSNNFAVTCANQG
SKVVLIDADLRRPTIHKTFGLDNKVGLSNYLLGNAKLDEILQPALVRNLYIIPSGPIPPNPSELLGSVRVKDLIKELESK
FDMLVLDAPPVNTVTDTQVLATVVDGVVMVVPQGIAMKAGVRHARESLELVHAHIIGAILNRVTVQKSVYYGGEYYGAEK
K
>gnl|bykdb|A0A0R1KG57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paralimentarius DSM 19674] (length=246 residues).
MLNFKNKHKKLDNYSLHHGVGLVASDDPNGIISEQFKTIRTNIQFSSVDKPLKSILFTSSEPSEGKSTVSSNIAVTWAQQ
NEKVLLIDADLRRPTVHQTFNVDNKKGLSNYLLGNATFEEIIQPTDFHNLYVITSGPIPPNPSELLGSNKIKQLFTRLSE
SFGLLILDAPPINTVTDAQVLANLVDGVILVVPQGIANKAAVAHAKQALLMVHAHILGAVMNRVIRDQHYGYYGSYYGLE
KYQRKS
>gnl|bykdb|A0A0R1KN07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paralimentarius DSM 19674] (length=251 residues).
MALFKKKTTKLDNYSLKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSAPSEGKSTVSNNVAVTWAKQ
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVIQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLINRLED
KFGLLIMDTPPVNTVTDAQVLAAQIDGVIMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYGGY
YGGYYGAEKEK
>gnl|bykdb|A0A0R1KQV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus koreensis JCM 16448] (length=250 residues).
MSLFNRKKKLEDTSLKYGVGLVTYTDPSGMIAEQFKTIRTNIQFSSVDSDLKSILFTSSEPSEGKSTVSNNMAVTWADQG
NRVILVDSDLRRPTIHRTFDVSNRKGLTNYLSGNASLDEIIQPTMVQNLYVITSGPVPPNPAELLGSSRINTLIKELTDK
YDLLILDAPPVNTVTDSQLLAARVDGTILVVPQGIADKNGVRRAKKMLETVHANILGAVMNRVTAQKSEGYYGGSYYGGG
YYGAEKTSKD
>gnl|bykdb|A0A0R1L5J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sunkii DSM 19904] (length=253 residues).
MNIFRRKQKKISTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYGYGYGYDNKSK
>gnl|bykdb|A0A0R1LVZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus futsaii JCM 17355] (length=247 residues).
MALFKKKTTKLENYSWKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSAPSEGKSTVSNNVAVTWAKQ
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASLEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLITRLED
KFGLLIMDTPPANSVTDAQILATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYGGY
YGAEKEK
>gnl|bykdb|A0A0R1MYE1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus zymae DSM 19395] (length=251 residues).
MALFKRKQKKLDDSSLKYGVGLVTYSDPTGMISEQFKTLRTNIQFSSVNNKLHSIMFTSSAPSEGKSTVSNNVAVTWADQ
GSQVILVDADLRRPTIHRTFNVSNRVGLSNYLSGNAELAEVIQPTMIANLSVITSGPIPPNPSELLNSSRTAVLLKELVN
QSDLLILDAPPVNTVTDAQLLGARVDGTILVVPQGIAEKVGVRHAKQALETVHANILGAVMNRVTAEKSGGYYGGYYGGN
YGGYYGTDDKK
>gnl|bykdb|A0A0R1NZI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum DSM 10532 = JCM 2011] (length=262 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVNNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A0R1P4G8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus frumenti DSM 13145] (length=256 residues).
MVNLFRKHSRVDNNSIHNGVKLITVAQPKSVIAEQFRTIRTNISFMGIDRPIKSLAFTSANVSEGKSTVAANIAVVWANT
GKRVLLIDADLRRPTLHKTFNLSNQVGLTSILTADEETVDITSMVRGTDVNNLSVITSGPIPPNPAELLNSKRMRSLLNA
VRNAFDVVILDVPPLLEVSDTQALISQLDGVVLVVKVGQTQKIAAKRAVELTKLSKARLLGYVMNDVGRGGDSAYGYGYG
YGYGYGYGYGYSTDNK
>gnl|bykdb|A0A0R1P7V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae DSM 13345] (length=253 residues).
MMGIFKRKSRVDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQE
GKSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEA
VQAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYG
YGYGYGYEKESEN
>gnl|bykdb|A0A0R1PAD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kefiranofaciens subsp. kefirgranum DSM 10550 = JCM 8572] (length=274 residues).
MSLFKKKRGTDETIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASISEGKSTVAANVAVTYAQAGH
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
GYGYGYGYGYGYGYGYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A0R1PYT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus uvarum DSM 19971] (length=246 residues).
MMWFFNKKNKELSNDTMENGVHMITAALPNSVISEQFKTLRTNIQFSNVDKKYRTLMLTSALASEGKSTIAANLAVTFAN
EGLKTLLVDADMRRPTINTTFSIADPKGLTNYLTDHEFDINNAIYETSVTNLLVMPSGPVPPNPSELINSHRMDELIKSL
YKKLALIIFDVPPLLSVTDAQILSTKVDGTILVVKKNFAEKEAVHRAVELLNHVGGHILGTVLNDVASENKNGYYGYYGY
YEKNKN
>gnl|bykdb|A0A0R1QIC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paraplantarum DSM 10667] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHQLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAILNDVRDGSHHGYYGYNNGYGYYSNE
DK
>gnl|bykdb|A0A0R1QJT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus manihotivorans DSM 13343 = JCM 12514] (length=239 residues).
MHKGVGLITDYAPKSHISEQFRTLRTNIQYSDADHQIKTLVFTSSGPSEGKSTISGNIAVTFANQGLRTLLVDADTRRPT
VHATFSLLNERGLVTLLTSKEDLDLSEYIVPTSVDHLSVLPTGPVPPNPSELLSSKRMERLIATLAKNFDMVIFDVPPLG
SVTDAQILASKVDATVLVVPYGIAQKGAVLAAKSMLEQVDANIIGVVQNRVPEEANGYYGYYGYYGYYGKKDKDNTAAK
>gnl|bykdb|A0A0R1RM96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus oligofermentans DSM 15707 = LMG 22743] (length=249 residues).
MAIFKKQKSKNDLSTDTMENGVMLITEVTPKDVVSEQFRTIRTNVEFSAVDKEYKTLIFTSSNVSEGKSTVAANTAVTWA
QQGKKVLFIDADLRRPTLHATFGLPNNQGLTNVLTNKELDYHDVIKTTRVENLSVLTSGPVPPNPSELLNSDRMKNYIEL
LKGEYDLIIFDVPPMLQVTDTQIMAAYVDGVILVVRQGVAQQKAVTRSIELLEMVHANLLGYVMNDVASRNGYGYGYGYG
YGYGYGETK
>gnl|bykdb|A0A0R1RSB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fuchuensis DSM 14340 = JCM 11249] (length=247 residues).
MGFFRKEKKLEQDSMKEGVGLITLTEPTSVIAEQFRTIRTNIQFSSIDQKLRSVVFTSSGPFQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTIHQTFQVPNKRGLTALLTEDEFDLNSTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMNKLIAELTK
HFDLVIFDAPPVISVTDAQILASKVDGAILVTPQGIVEKGSIAKAKELLEVVNARILGTIMNRVKSENTGGYYGGYYGGY
YGADESK
>gnl|bykdb|A0A0R1SNN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus versmoldensis DSM 14857 = KCTC 3814] (length=245 residues).
MMLKLFSKKNKKKQKESYSMNYGVSLLAHDDPTNVISEQFNTIRTNIQFSSVDTKLHSILFTSAAPSEGKSTVSANLAVS
WAKQDEKVILIDADLRKPTIHKTFNQSNQSGLSNYLLGSANLDEIVKETKVPNLYVITSGPIPPNPSEILASKRIGNLME
ELQNRFDLLMFDAPPVNSVTDAQVLATKIDGTILVTPQGVAEKHSVAHAKKLLDTVHANILGAIVNQAEIDKSSNYYGGY
YGIEQ
>gnl|bykdb|A0A0R1U203 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus equi DSM 15833 = JCM 10991] (length=240 residues).
MMAFFKKNKDKIDNTSMEKGVKLITVAEPNSVITEQFNTIRTNIQFSSVDKSFKTLMITSSLMSEGKSTVSANVAASFAK
QGLRVLLVDADLRRPTIASTFGISSPQGLTNYLTEQNFNINNIIYETSVDNLFVMPSGPIPPNPSELIGSNKMQHLVAVL
ADQLDLVIFDAPPVLSVTDAQILSTCVDGTILVTRAERSEKDAVRKAVESIKHVQGHIIGAILNDVHGSDGAYGYGYYAK
>gnl|bykdb|A0A0R1UES6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pantheris DSM 15945 = JCM 12539 = NBRC 106106] (length=250 residues).
MRIPFFHKRYKEDMTSQTQGVRLVTYADPKHVVSEQFRTVRTNIEFAGAALDQLQVVMFTSAAISEGKSTVSNNVAVAWA
QSGKRVLLIDADLRRPTVHATFDMLNTDGLTNVLAGNIKVGDAAKETFVPNLSVMNAGPVPPNPSELLNSQRMADLLAWA
REHYDMVVLDVPPVLAVSDVQVLVPQTDGVVLVVRMEHTLKGDLERTVEVLKMAHAKVLGVVERVHSKHGDRGYGYGYGY
GYGYGSEGAK
>gnl|bykdb|A0A0R1UFJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus ingluviei DSM 15946] (length=247 residues).
MGLFKRKNKKYSTDTMDNGAMLITVADPKNPVAEQFRTIRTNIHFMSVDKPLRRVAFTSSNVSEGKSTVTANVAITWAQE
GKRVLLIDADLRRSTLHTTFGVPNHHGLTTVLTSAVSEIDLSQVIMDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDA
VEPIYDIIVLDVPPLLEVTDTQALSGKLDGVILVVRAGVTQKAAISRAVEMLKISKAHLLGYVMNDVDGEDAAYGYGYGY
GYGEEEK
>gnl|bykdb|A0A0R1UFP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. argentoratensis DSM 16365] (length=219 residues).
MSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGL
SSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRNLDLVIVDAPPILPVTDSQLLANKVDGT
VLVVRQGIAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNNGYGYYSNEDK
>gnl|bykdb|A0A0R1UI73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kalixensis DSM 16043] (length=258 residues).
MALFRKKRGSSETMKKGARLITAADPKSPVSEQFRTVRTNINFMAVDYDIKTMAFTSANISEGKSTVTANVAITYAQAGL
KTLLIDADLRRPTLHSTFDVQNNRGLTTVLTSEADVFNLDEVVEDSGIENLSILTSGPIPPNPAELIGSKRMSTFIDLVK
SHYDLVILDLAPVLEVSDTQALASNLDGVVLVVRQGKTQKPAIKRAVEMLRFAKVRILGYVMNDVSSENNGYGYGYGYGY
GYGNENKQKTGFLSRFRK
>gnl|bykdb|A0A0R1US13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hammesii DSM 16381] (length=251 residues).
MAWFKSRKKKLDDTSLKYGVGLVTYTDPAGQISEQFKTVRTNIQFSSLGKDLKSVLFTSSEPSEGKSTVSNNMAVTWADQ
GTKVILVDADLRRPTVHKSFSVSNRAGLTNYLSQAMDLAAVIQPTIIDNLDVISSGPIPPNPAELLGSDRVQQLIDKLSE
KYDLIIFDAPPVNTVTDSQLLAARTDGTILVVPQGIADKNGVRRAKQLLETVHANILGAVMNRVTAQKSEGYYGGSYYGG
NYGGYYGTDGK
>gnl|bykdb|A0A0R1UUC5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. argentoratensis DSM 16365] (length=213 residues).
MSVVTEQIKTIRTNLNYSMVGKPLKTLMITSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLRRPTIHQTFGVSNQRGL
SSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTDARILAGQVDGT
VLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
>gnl|bykdb|A0A0R1VHW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gastricus DSM 16045] (length=251 residues).
MGLFSRKKIQSVDTMVNGANLVTLTKPQSLVAEQFRTIKTNITFMGVDHPIKALAFTSSNISEGKSTVTANVGVTWAQDN
KRVLMVDADLRRPTMHSTFDLDNRQGLTTLLMDQEHVINSQDVIQATEVPNLDVLTVGPVPPNATGLLNSQRMRDLVATF
EQMYDVVIIDVPPILEVNDTQVLSSMLDGVVLVVRSGVTQKVAVKRAVEMLNISKANLLGYVMNDVASGDDDGYGYGYGY
GYGYGSVEPED
>gnl|bykdb|A0A0R1VQ95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus concavus DSM 17758] (length=245 residues).
MFNRKNKGPEPVAPANLFTVNEPSSVIAEQVKTIRTNVSFAQQAQSLRTIMVTSAMASEGKSIVTANLAVEFAQAGKRVV
LIDADLRRSTVNRTFRIREVNRGLTNYLVRQIDDITEVCHPTMVENLAVIPSGPTPPNPAELIGSPLMATVFDQLKQYFD
LIIVDAPPILPVTDGQILSNMVDGVILVVRQNYTDKRAVVDTKERLEQAQANILGVVLNDVRSEGHSGYYNNGDGYYGYE
YSEKK
>gnl|bykdb|A0A0R1WGS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nantensis DSM 16982] (length=242 residues).
MAFKLLKKKTKKLDDYSLTHGVGLVTYDDPSSVISEQFNTIRTNIQFSSVDKELNSILFTSSAPSEGKSTVSNNVAVSWA
KQDKKVVLIDADLRRPTIHKTFNVSNKAGLSNYLLGTASLESVIQSTMVDNLFVITSGPTAPNPSELLGSKKITELFQDL
TAQFDFMILDAPPVNSVTDAQVLATKVDGVILVVPQGYADKTGVIHAKKALQTVHSNILGAIMNRTAKDKMKGYYGSQYG
GY
>gnl|bykdb|A0A0R1WHZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nantensis DSM 16982] (length=255 residues).
MAFNLFSRRKHKIDNTSLKYGIGLVTYTDPKGMISEQFKTVRTNIQFSSVDKKLKSLLFTSSDPSEGKSTISNNVAVTWA
DQGSKVILIDADLRRPTVHKTFGVSNRRGLSNYLLGNATLEEIVQPTVVNGLYVITSGPVPPNPAELLGSLRAKDLLVRL
TDKFDLLVLDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVMHAKEALETVNANILGAIMNRVTEQKSGGYYGGSYY
GGYYGGYYGTDDKKK
>gnl|bykdb|A0A0R1WQI7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hayakitensis DSM 18933 = JCM 14209] (length=241 residues).
MFGKKKKKLDSNSMKNGVYLVTVAAPKSVDTEQFNTIRTNITFSSVDESFKSIMITSSGASEGKSTVAANVAASFAKQGK
KTLLVDSDLRRPTIASTFNIASTQGLTNFLTDKNFDINEVLYPTTVENLYVMPAGPVPPNPSELIGSKRMKMLKEALTEK
LDLVIFDAPPVLSVTDAQLLSVSVDGTILVVRQGEAEKEAVKQSVDLLNHVNAKIIGTIMNDVDVTSTDGYYGYYGYYGK
E
>gnl|bykdb|A0A0R1WTI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus graminis DSM 20719] (length=247 residues).
MGLFRKEKKLDQASMKEGVGLITLTDPTSIIAEQFRTIRTNIQFSSIDQKLRSVVFTSSGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNNAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIIELTK
HFDLVVFDAPPVISVTDAQILASKVDGTILVTPQGIAEKGAVAKSKELLEVVHARILGTIMNRVKSENTGGYYGGYYGGY
YGAEENK
>gnl|bykdb|A0A0R1XAP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus panis DSM 6035] (length=209 residues).
MAIDHPIKTLALTSANVSEGKSTVTDNLAIVWAQTGQRVLLVDADLRRSTLHWTFSLDNREGLTTILTSHAHSIDLNKII
QPSGIDNLSLLPSGPTPPNPAELLSSQRMKDFLKAARERYDMVIVDVPPMLEVTDTQVISHNLDAVVLVVNQGQTQKLGA
KRAVELLKMAHANLLGYVMNDVVSDGGAGYGYGYGYGYGYGYGNDGDDK
>gnl|bykdb|A0A0R1XVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus intestinalis DSM 6629] (length=264 residues).
MSLFKKKRGTNETMKKGAKLITAADPQSPISEQFRTVRTNINFMSVDKEIKTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNRGLTTVLTSDADEIDLEDVVKESGVKNLSILTSGPIPPNPSELIGSHRMQTFIDLVK
AHYDLVIIDLAPVLEVSDTQELASHLDGIILVVRQGKTQKVAIRRAVEMLEFAKVRILGYVMNDISAENSGYGYGYGYGY
GYGYGQENKKSRFFGGSSTNKESK
>gnl|bykdb|A0A0R1Y5I1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pontis DSM 8475] (length=252 residues).
MSLFHRGNKNQANAKINNGAQLITAVHLKSPISEQFRTLRTNINFMAIDNPIKTLALTSANVSEGKSTVTDNLAVVWAQN
GQKVLLVDADLRRSTLHRTFDLDNREGLTTILTSHARTIDLNKIIQPSGIENLSVLPSGPTPPNPAELLSSQRMKDFLKA
AKERYDMVIVDVPPMLEVTDTQVISHYLDAVVLVVKQGQTQKLGAKRAVELLKLAHANLLGYVMNDVPSDGSADYGYGYG
YGYGYGDDGDDK
>gnl|bykdb|A0A0R1YC58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hamsteri DSM 5661 = JCM 6256] (length=259 residues).
MALFRRKRGTTETMKKGAKLITVANPQSPVSEQFRTVRTNINFMAVDHDIKTMAFTSANISEGKSTVTANVAITYAQSGL
KTLLIDGDLRRPTLHSTFNVRNNRGLTTVLTSEAKEINLEDVVEESGVENLSILTSGPIPPNPAELIGSHRMRTFIDLVK
AHYDLVIIDLAPVLEVSDTQELASHLDGIVLVVRQGKTQKPAIKRAVDMLTFAKVRILGYVMNDVSSENAGYGYGYGYGY
GYGYGETNKKKGFLSRFKK
>gnl|bykdb|A0A0R1YL91 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylophilus DSM 20533 = JCM 1125] (length=242 residues).
MAIFKKKSNGLQPVAAANLFTLNNPSAVATEQIKTIRTNISFSQEAQNLQTIMITSTVASEGKSTIAANLAVEFAHAGKN
TLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRFEELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKES
FDLVIVDAPPLLPVTDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGEGHYDNN
EQ
>gnl|bykdb|A0A0R1YMT3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus parafarraginis DSM 18390 = JCM 14109] (length=247 residues).
MNIFHRKEKKLSTDTLKNGVKLITDVNPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKTLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYDNKGK
>gnl|bykdb|A0A0R1Z021 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus parabuchneri DSM 5707 = NBRC 107865] (length=232 residues).
MKLITDVDPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTT
FGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQ
IIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGYGYGYGYDNEGK
>gnl|bykdb|A0A0R1ZIE9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sharpeae JCM 1186 = DSM 20505] (length=252 residues).
MFKIFKNKHKQESDESITNGVRLITAYQPKHTISEQLRTVRTNIEFAGAALDELKVVMFTSPEMSDGKSTVAANVAVTWA
QAGKKVLLVDADMRRPTVHLTFNSANTQGLSTILAGNKLPEEVITDSFVDNLAVLTAGPVPPNPSELLGSKHMHQFVEWA
RANYDIVILDATPVLAVSDVQVSLPEVDGTVLVVRMEKTLRGNIQRTVEVLKMADAKILGVVERVKNGRGDKGYGYGYGY
GYGYGYGYGSDK
>gnl|bykdb|A0A0R2A1J5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus vaccinostercus DSM 20634] (length=240 residues).
MGIFKHHKKLSTDTMSNGAKLITASNPKDPISEQFRTIRTNIDFSSVDRDLKTVLFTSADVSEGKSTVSANMAVIWAQQG
KRVLFVDADLRRPTLHMTFGLVNTKGLTTYLARGADYHELLGNSGIENLTILTSGPVPPNPAELLNSKRMKDFLANSQNE
FDIVMLDVPPLLSVTDTQVLSAEVDGVVLIVRQGITQKAAVQRSVELLKMVNAKVLGYVLNDVSARSGYGYGYGYGYGYK
>gnl|bykdb|A0A0R2A997 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus agilis DSM 20509] (length=245 residues).
MGLFRKNKNQDANTMETGVKMITVTDPTSVDTEQFNTIRTNIKFSNVDKDYKTLMITSSNMSEGKSTVSANIATAFAKQG
LHTLLVDSDLRRPTINATFGIDNPQGLSNYLSERSFDVNKIIYKTSVKNLYVMPSGPIPPNPSELIGSKRMAELIKKLSE
QLDLVIFDAPPVLSVTDAQIVSTNVDGTILVVRANKTEKAAVKEAVRLIKQVGGHIIGTVLNDVEVKGSGYYGYYGYSKD
SKKKK
>gnl|bykdb|A0A0R2BAC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus collinoides DSM 20515 = JCM 1123] (length=256 residues).
MKNGQDVGYGYKRVKTMALFRRKKKQSDDSIINGVKLVTAVEPKNVVSEQFRTVRTNIDFSSVDKQIKTLLFTSSGMSEG
KSTVSANTAVTWAQQGKKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAEL
LNSNRMKRLLDSVEAEYDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMV
PRDGYGYGYGYGYGHE
>gnl|bykdb|A0A0R2CCB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus thailandensis DSM 22698 = JCM 13996] (length=249 residues).
MRIPFFHKHYKEDMTFQTHGVRLVTYADPKHVVSEQFRTVRTNIEFAGAALDKLQVVMFTSAAISEGKSTVSNNVAVAWA
QSGKRVLLIDADLRRPTVHATFDLLNTDGLTNVLAGNVKVEDAVKDTFVPNLAVMNAGPVPPNPSELLNSQKMADLLAWA
REHYDIVVLDVPPVLAVSDVQVLVPETDGVVLVVRMEHTLKGDLERTVEVLRMAHAKVLGVVERVHSKHGDRGYGYGYGY
GYGYGNDSK
>gnl|bykdb|A0A0R2CUI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus aquaticus DSM 21051] (length=251 residues).
MMMRIFNKKNKELSNDTMENGVHMITAAAPSSVISEQFKTLRTNIQFSNADKKYRTLMLTSALASEGKSTVAANLAVTFA
DQGLKTLLVDADMRRPTINATFSIANPMGLTNYLTDHKFDINNAIYETSVTNLFVMPSGPVPPNPSELINSRRMDGLIKS
MSEQLELVIFDAPPVLSVTDAQILSTKVDGTILVVKENFAEKEAVRRAVDLLKHVNGHILGSVLNDVTSEGGKGYYGYYD
YYGKDTEKDKK
>gnl|bykdb|A0A0R2D7Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rennini DSM 20253] (length=251 residues).
MSLFRKKKKLDSHSMKHGVGLITVTKPNSTIAEQFRTIRTNIQFSSADRQLKTIIFTSANPSEGKSTVSSNVAVTWADQG
SKVLFIDADLRRSTAHRTFRVSNTHGLTTILTAKQADLNESIKKTEVNNLYVLPSGPVPPNPSELLNSSKMDQLLKALVD
QFDMIILDAPPVNTATDAQVLASRVDGVILVVPQGVALKGAVLRARDLLEKVHANVLGTILNRAVDTDSGGYYGGYYGGY
YGGYYGTDDKK
>gnl|bykdb|A0A0R2DXC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei subsp. tolerans DSM 20258] (length=252 residues).
MSLNGIFKKFTHRDEEDNETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDRCEVVMFTSPSMSEGKSTVSANVA
VTWAQAGEKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVVEKTFVDNLDIITSGPVPPNPSELLNSKRMANL
LEWGRANYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRATKGDRSYGY
GYGYGYQSNDGR
>gnl|bykdb|A0A0R2E0G9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=247 residues).
MGLFKHRYTESTDTMDNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLINGV
RDAYDLVVLDVPPMLQVTDTQALSSSLDGVVVVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
YGYEDER
>gnl|bykdb|A0A0R2F5X1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus similis DSM 23365 = JCM 2765] (length=239 residues).
MALFRKKKKLSTDTIDNGVKLITAVEPKNVVAEQFRTVRTNIDFSSIDKTLKTILFTSSDVSEGKSTVSANTAVTWAQQG
KKVLFVDADMRRPTLHTTFGVTNTQGLSTILANNEDYHGIAVDSVVDNLTVITSGPVPPNPAELLNSNRMKNFLQTVQNE
YDMVILDVPPLLSVTDTQILSAGVDGVVLVVRQGVAQRTSVQRAVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYEK
>gnl|bykdb|A0A0R2FT82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Weissella halotolerans DSM 20190] (length=241 residues).
MTFFSKKIKQDDETQRNGARLITFTEPKNIISEQFRTVKTNIEFAGAALDKLQVVMFTSAEISDGKSTVAANIAITWAQA
GKSVLLVDADLRRPTAHSTFDIPNTRGLTSILASDMQPKDLVRETFVPNLSVLQAGPVPPNPAELLGSKRMTALVNWMRN
NYDMVVLDVPPVMAVTDAQVMFKLVDGIVLVTTIGKTLKANLKRTVETISLTDAKVLGCVERVKDKSNDAGYGYGYGYGY
E
>gnl|bykdb|A0A0R2FW20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus selangorensis] (length=261 residues).
MANKLTTWWQNRKDKSKLDDQSMQKGVSLITVSDPKSTIAEQFRTIRTNIQFSQVDDQLRTLSFTSSGPSEGKSTVSANI
AVTFADQGMKTLLIDADMRRPTIHQTFQIPNRKGLTTILTSSKNDYDSVIVKTKVANLSVMPSGPVPPNPSELLNTHKMD
QIIEELSEQYDLIIFDAPPVGSVTDAQIIGTKVDGSILVVPQGIALKGAVLQAKDALDSVHARIIGTIMNRVSRKNGTGY
YGGYYGGYYGGYYGKNEDKKN
>gnl|bykdb|A0A0R2G7V3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acetotolerans DSM 20749 = JCM 3825] (length=263 residues).
MSLFKKKRGTDETIKNGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASIGEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQNFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEILNFSKAKVLGFIMNDISPDNASYGYGYGYGY
GYGYGYGYGEEKKKKSWFSRQCH
>gnl|bykdb|A0A0R2GAB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A0R2GZ22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Weissella viridescens] (length=245 residues).
MSLFKRHYKEDVETQTNGARLITFTEPKNVISEQLRTVRTNIEYAGAALDKLQVVMFTSSQMSDGKSTVSSNVAVTWAQA
GKKALIVDADLRRPTVHTTFRLDNRQGLTTILASDLQPKDLVHETMVPGLSALTSGPVPPNPAELLGSPRMAALVEWMRN
NYDIVVLDVPPLNLVTDAQVMLPLADGVVLLITLNQTQKVNLERAVELLNLTSTKVLGVVSRAKRNDGDSGYGYGYGYGY
GSTQD
>gnl|bykdb|A0A0R2H680 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus ingluviei] (length=247 residues).
MGLFKRKNKKYSTDTMDNGAMLITVADPKNPVAEQFRTIRTNIHFMSVDKPLRRVAFTSSNVSEGKSTVTANVAITWAQE
GKRVLLIDADLRRSTLNTTFGVPNHHGLTTVLTSAVSEIDLSQVIIDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDA
VEPIYDIIVLDVPPLLEVTDTQALSGKLDGVILVVRAGVTQKAAVSRAVEMLKISKARLLGYVMNDVDGEDAAYGYGYGY
GYGEEEK
>gnl|bykdb|A0A0R2HET3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus pentosaceus] (length=243 residues).
MFKKKQKSDNESLKNGVGLVTFTDPTSTIAEQFRTVRTNIQFSSVDKALKSIVFTSSAPSEGKSTVSNNVAVTWADQGKR
VLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGSLENAIHETIINNLSVMPSGPIPPNPSELLGSTKMAALLDQLTGAYD
LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYYGGYYGT
DDK
>gnl|bykdb|A0A0R2HXK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium divergens DSM 20623] (length=239 residues).
MFKSKNNSNQGSSNGASLITTTKPNSVVAEQFRTIRTNIQFSMVDKDLKSLIFTSSGPGEGKSTISANTAIVFASQGKRV
LLVDADMRKPTVHKTFNIPNHEGLTTLLTEKDVKLSSVIRQGTNENLFILTSGPIPPNPSELLDSNKMNKIIEILEGAFD
LVIFDMPPVITVTDSQIMATKTDGTIFVIRSGVANKEALIKSKQLLDIVNANVIGTVFNGVERTKDSAYKYYGLDSDTV
>gnl|bykdb|A0A0R2HZW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus secaliphilus] (length=260 residues).
MSILSTLLFDRKKKNSTDTIDNGVKLITAVHPKSIISEQFRTIRTNIDFMAIDKQIRTLAFTSANVSEGKSTVTDNIVVV
FAQNGQHVLLVDADLRRPTLSKSFGVDNRQGLTSILTSRVQSIDLSQIIKPSGIQNLDVLPSGPIPPNPAELLASQRMQA
FLDAVKQNYDMVILDVPPMLEVTDTQVLSHSLDAVVMVIRQGRTQKMAARRSVELLHMAHANLLGYVMNAADSKADAGYG
YGYGYGYGYGYGYGYGEGEK
>gnl|bykdb|A0A0R2I6Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium divergens DSM 20623] (length=226 residues).
MNRLGDEKRRLITKMHATSSISEQFKNIRTAIEFSGVDKTFQTILITSPEPMSGKSTISANLAIVYAQKGKKTLLVDGDM
RKPTVHKTFNQSIFKGLSTSLTGDSKVSDNFQKTEIENLFILTSGPIPPNPNELLGSKRMGAVLKELKTQFDVIIIDSPP
VTVVSDALVLASYTDGVLFVFRNQVTMKNKAKQAIEQIKMTRVPIIGAILNGEQEKQHNNYYYAYK
>gnl|bykdb|A0A0R2IQW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum DSM 20342] (length=235 residues).
MLNFRSKKQTRVVKAPKLITSLYPNSIISEQFRTIRSNLQFSENGMNLKTIGVTSSGPGEGKSTVSANLATVFADQKHRV
LLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNLSVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFD
LIIFDLPPTVAVTDAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYGKD
>gnl|bykdb|A0A0R2IS62 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum DSM 20342] (length=238 residues).
MNYSGEQLIESQKNGASLVTVTKPNSVVAEQFRTIRTNIQFSMIDRDLKSLIFTSSGPGEGKSTTSANLAVVFATQGKRV
LLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEVVLGDVVHETNTENLFILTCGPIPPNPSELLDSKKMNRVIEILEETFD
LVIFDMPPIVSVTDAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNALEKRKVKAYKYYGIEGEN
>gnl|bykdb|A0A0R2IT86 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus cellicola] (length=251 residues).
MPLFRKKRKLNNASLKNGVGLVTVTDPSSVVSEQFRTIRTNIQFSSVDKTLRSIAVTSPEPFEGKSTVGANLAVVWAKQN
QKTVIIDADMRRPTVHRTFNLLNASGLSSYLAGNAVYEEIVQSTDVPNLSVITSGPVPPNPAELLNSQRLDTLIQRLQSE
FEMIIVDAPPVNTVTDAQVLAAKVDGVVLIVPQAIAEKGSVIHAVEQLKKVQAKILGTVMNRFKASKTPGYYGGYYGGNY
GGYYGVDDKHD
>gnl|bykdb|A0A0R2J2V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum] (length=241 residues).
MFKFKTNKEQLIESQKNGASLVTVTKPNSVVAEQFRTIRTNIQFSMIDRDLKSLIFTSSGPGEGKSTTSANLAVVFATQG
KRVLLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEVVLGDVVHETNTENLFILTSGPIPPNPSELLDSKKMNRVIEILEE
TFDLVIFDMPPIVSVTDAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNGLEKRKDKAYKYYGIEGE
N
>gnl|bykdb|A0A0R2J5A5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum] (length=235 residues).
MLNFRSKKQTRVVKAPKLITSLYPNSIISEQFRTIRSNLQFSENGMNLKTIGVTSSGPGEGKSTVSANLATVFADQKHRV
LLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNLSVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFD
LIIFDLPPTVAVTDAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYGKD
>gnl|bykdb|A0A0R2JUW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acidipiscis] (length=247 residues).
MALFKKKKQLDSNSMKHGVGLITVTKPTSSIAEQFRTIRTNIQFSSADRQLKTLVFTSADPSEGKSTISFNVAVTWADQG
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTEKQANLSESIHETEIPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDTASGGYYGGYYGGY
YGTDDKK
>gnl|bykdb|A0A0R2JWJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus ethanolidurans] (length=251 residues).
MPLFRKKRKLDNESLKRGVGLITVTDPSSVVAEQFRTIRTNIQFSSVDKRLQSIVITSSEPSEGKSTVSSNLAVVWAKQK
QKVVIIDADLRRPTAHRTFHVLNAAGLSSYLTNNAVYEEIIQTTDVPNLSVISSGPVPPNPAEILNSHRINNLLERLQTE
FDMIIIDAPPINTVTDAQLLANKADGVVLVVPQGIAEKGSVTHAVDQLKTVHAKLLGTIMNRFKADKSPGYYGGYYGGDY
GGYYGVDDKDD
>gnl|bykdb|A0A0R2KTQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus DSM 16698] (length=260 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPVAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A0R2KZR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus stilesii] (length=247 residues).
MFGKKKRQKKLDNESLKNGVGLITFTEPTSSIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTISNNVAVTWADQ
GKRVLIVDADMRRPTVYRTFRVSNAIGLSNLLAGTGNLEGAIHETVVNNLSVMPSGPIPPNPSELLGSTKMVSLLETLTN
AYDLVIIDAPPVNTVTDAQVLAAHADGTVLVVPQGIADKAGVRHAKQLLEAVQANILGAILNRASAEKSTGYYGGYYGGY
YGTDDKK
>gnl|bykdb|A0A0R2L487 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus siliginis] (length=256 residues).
MALFHRNKKKLSEDTMLNGAKMITALHPKAVVSEQFRTIRTNIEFASVDRAIKTVTFTSADASEGKSTVSANVAVTWAQQ
GKKVLFVDADLRRPTVHSTFGLSNTQGLSTLLTMEKTENFSEFVQESPIDNLSVITSGPVPPNPSELLNSHRMDTFISKA
REFFDMVVFDVPPMLTVTDAQLLTAKVDGVILVVRFGVTNKAAITRTKELLDLAHANLLGYVMNDATGDAAGSGYGYGYG
YGYGYGYGKTEDKKEG
>gnl|bykdb|A0A0R2LMV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kimchiensis] (length=246 residues).
MSLFKRKNKKLDNYSLKHGVGLITYDDPSSTISEQFNTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTISNNVAVTWAKQ
GEKVILVDADLRRPTIHKTFDVSNRIGLSSYLLGNATLEEIIQPTMVKDLYVIASGPIPPNPSELLGSMRIKGLFKALED
KFGLLILDAPPTNAVTDAQILAAQVDGVILVVPQGLAEKAGVAHAKQALDTVHANILGAIMNRVTKAESQGYYGGYYGGY
YGVEKK
>gnl|bykdb|A0A0R2M7H6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus xiangfangensis] (length=241 residues).
MFKRQVNNTTTAAINLTTINEPMAVVTEQIKTIRTNINFAASDRPLRTMMVTSAMLGEGKSTVSANLAVEYAKEGVRVLL
VDADMRRPTVHKTFNLSNHQGLSSWLGRQLDDVNKAIHPVLDNLFVMTSGPKPPNPAELLDGQLMADFLKTTTRKLDLVI
VDAPPILPVTDAQLLAHKVDGTVLVVRQNVAQKVAVRDAVVTLKKSHAHLLGAVFNDVRDGSHHGYYGYESGYGYYSDED
K
>gnl|bykdb|A0A0R2MUS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. jakobsenii ZN7a-9 = DSM 26046] (length=246 residues).
MKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQVGKKTILIDADLRRPT
LHSTFNVSNSNGLTTLLTSRAKEMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLNLIEDLKQEYDMVVIDLAPV
LDAAETQLLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYGYGYGYGEEKEKKG
LFGRKK
>gnl|bykdb|A0A0R2NCL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus argentinicus] (length=246 residues).
MALFKRKQKKLDNNSLKYGVGLITYSDPTSSISEQFRTIRTNIQFSSIDKSLSSVLFTSSEPSEGKSTVSNNVAVTWADQ
GKKVILIDADLRRPTVHKTFGVGNSKGLSTILSGNDQLEDVIQSTVIPNLFVITSGPVPPNPSELLNSSRMDNLLKELTS
QSDLLIVDAPPVNTVTDAQVLAARVDGTILVVPQGIADKGGVRHAKQLLQAVHANILGAIMNRVTAEKSSGYYGGYYGGY
YGADDK
>gnl|bykdb|A0A0R2NQ84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fabifermentans DSM 21115] (length=191 residues).
MITSAMLGEGKSTVSSNLAVEYANEGMKVLLVDADLRRPTVHKTFGLSNRQGLSSWLAHQTSDINDAIHQTVDNLFVMTS
GPKPPNPAELLGSKMMDEFLNSATRKLDLVIVDAPPILPVTDSQLLANKVDGTVLVVRQNVAQKAAVRDAVSALKRSHAH
ILGAVLNDVSDGKHSGYYGYNNGYYSEQDDQ
>gnl|bykdb|A0A0R2NUN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fabifermentans DSM 21115] (length=237 residues).
MFKKHKKLINDTQAIDLTTVNEPNSIISEQFKTIRTNIVFSASDIKTLMVTSSLTGEGKSTIAANLAVEFANNNKNVLLI
DADMRRPTVHKTFGINNIEGLSTLLTKQRIGINSCILKSKIERLNILPSGPIPPNPAELLSSKDMVEIIRNARKVFDVVL
LDCPPILPVTDARILAPLVDGTILVVRRGGISKKIVRESKSVLEQVRANLLGAVLNGFYNKETVGYYGETYGSYSTK
>gnl|bykdb|A0A0S2W8N7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Intestinimonas butyriciproducens] (length=480 residues).
MEEHKLDQEEGRIDLYRLLPELGRALRRLFWVPLLLALLGAAAMGVRAWRSYVPRYHSEATFTIETSASALSDMAGSGSY
YDKATAEQLAKTFPYLLQSDLLQSLLRQELGVSWLNGSISARAVDNTSLFSLRVTSTSAQDAYDILETVIRIYPRVADYV
VGSTEMHILTQPAVAAQPDAPFDPVRSICKGALLGLALGLAVVLLFAATRRTVRTPEEVKRRLNQTCLASLPAVRFKRRS
GQFDRTISIQNPRISGAFLENVRSLRIKFLREAEGRKVIMVSSTLPGEGKTTVAVNLALTLSQNGARVILVDLDLRKPSV
KRCLGVSVPSRGAPELLNLRGADPREHLLTLEGTQVRLLAGDEPSSNPRRQMESRRLEALLTTLREEADYVILDTPPCGL
LGDGAALAGLADASLYVVRSGTAQVSHILDSLQFLAGSGTPLMGCVLNGASGGGGRYGYGYGYGYGGDHYGKYHAYRQEK
>gnl|bykdb|A0A0S3KC41 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus silesiacus] (length=233 residues).
MANKGRVQKKQKTKAVSLITLADKTSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNIRGLSTLLGSRETMLHQVVQSSGVDNLFLMTSGPKPPNPSELLDSRRMKELILELKHQYD
LVIFDMPPVVAVTDAQIVASKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNITDQGYYYGT
>gnl|bykdb|A0A0S3TG69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis] (length=239 residues).
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTLSANIAISFAKAGLKTLLIDADIRNSVMS
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGAYGNYGKPAKKKSRKRR
>gnl|bykdb|A0A0S6U5S1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum B str. Osaka05] (length=236 residues).
MNRNLELITIKDPKSPISESYRILRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNIRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSRKMNKFIETSKKHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLEKVNAKIIGVVLNKVDTEFGNGYRYYNYYYEEDGEKKKRNKK
>gnl|bykdb|A0A0T7J365 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGNYGNYGKNKK
>gnl|bykdb|A0A0T8AXE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSETADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYGLYGSYGNYRKE
>gnl|bykdb|A0A0T8BFI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|A0A0T8I9C6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0T8PZY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0T8QNK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQGKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|A0A0T8QT90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKCGVYGFYGNYGKK
>gnl|bykdb|A0A0T8Y3R6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=204 residues).
MCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSGTADLS
YGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVIITQKCDASILVTATGEANK
RDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A0A0T9AGT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLLDGDTRNSVIS
GFFKSREKITGLTEFLSGTADLSHGLCDTTIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGSYGKK
>gnl|bykdb|A0A0U0BLL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFAKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDTRQSVMS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A0A0U0CXW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A0U0CYW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQLPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAATVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A0U0EUP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0U0I8N0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTNSERLEKCIQATSVDNLGFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0U0IPK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=252 residues).
MSFFRNRTDKKNRLLTDTMTNGARLIAAAELKNPVVEQFRTIRTNIDFASVAKGDIKTLLISSALPSEGKSTVNANLAVV
YAQQGKKVLLVDADLRRPTVAATFGDDRTTVGLTNYLSDNKKEISDVIKTSGIPNLDIITSGPIPPNPAELLGSGIMTEL
IDKLKSVYDLVIFDVPPFLMVTDAQVLLSKVDGVAIVVNGGKSNKSDLKRTYEILQLSEVPLLGFIYNDKNNKKNSGYGY
GYGYGYGTTADK
>gnl|bykdb|A0A0U0MPC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYRGYGSYGNYRKE
>gnl|bykdb|A0A0U1KJQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paraliobacillus sp. PM-2] (length=233 residues).
MARRKKQAKNTAIRHLIAKLNPKSPISEQYRTIRTNLQFSSVDGEMKKILVTSSGPSEGKSSTVANLAIVFAQQGKKVLL
IDGDMRKPTVHYTFRIDNRRGLSSVLVSEATLEESIEKSDVADLDILTCGPIPPNPSELLGSKAMGKLMEQACEYYDIVL
FDTPPVLAVTDAQILANSCDGSILVLRSKQTDYEAAQKARDLLQPANAKLIGAVLNDRDMKKGNSYYYYYGNH
>gnl|bykdb|A0A0U1KTG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa sp. An4] (length=246 residues).
MTQQRKLIVHEDAKSPIAEAYRTLRTNIQFARVDSDLRTIMFTSAGPGEGKSTTTANTAVAIAQTGKRVIIVDCDLRKPV
QHKIFGKRNRGVTNILVEELTVKDLVQDTDIDNLKILTSGPIPPNPSELLGSYKMQEVIAALQEVADIVIIDAPPTVAVT
DACVLASKVDGIVLVLDSKAIRPEMAQKAKENLLKANGCILGVILNRVEIEEEHAYYYYYYGDQKKIEKIRFGYILMRRK
FGSTCS
>gnl|bykdb|A0A0U1L4W2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa sp. An4] (length=231 residues).
MMNDRTLIVNHSPKSIWAEAFRAFRTKILHSKKGSIVKSILVTSAGAGEGKSVTVANTAVVLAQTGKKVILMDCDLRKPV
QHEIFKKRKTNRGLTNVLNGECSISDIVQDTGIPNLQLITSGSIRFNPSELLDSDKFKETISSLKSQADYIIIDSPPVLP
VTDACILGSKVDGIILVVGVGKVQPEMALKAKEHMEIVNGNILGIIINHYENFVEQSAYYHYCENVEKAAN
>gnl|bykdb|A0A0U1MTL6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSSYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVINSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0U1MV54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITSTEIDNLDLLTAGPVPPNPSELIASERFKELVDLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0U1MV87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDIFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0U1NQ42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. LF1] (length=232 residues).
MTLKKKTTKTSSRRKLVTILDPKSPIAEQYRTVRTNIQFSSVDQELKTIMVTSSGPGEGKSTTAANLAVVFAQLGKKVLI
VDADLRKPTVHHTFGINTHIGFSTVLTKQADLTSAIVKTEEKDLYVLPSGPIPPNPSELLSSKSMEQFIADVKTVFDYII
FDTPPLLAVADPQILANQCDGAILVVYSEKTVREHAVKGKEMLENVKSKLLGVVLNHKELQKNDYYYYYGNK
>gnl|bykdb|A0A0U2ILF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus naphthalenovorans] (length=231 residues).
MPTSTRNYNIITDVNPKSYISEAYRTLRTNIQFSTIDNHIRSIIVTSPEPSEGKSTTITNLAVAFAQEGKKVVLVDADLR
KPTLHHFFMKSNRIGLSNLLAGQFTLQQAISDTHIDNLSLICSGPVPPNPAEMLNSKRLEQQLEELKKMFDIILFDAPPT
LAVTDAQVLSTKCDGVVFVLNSGKVKRDTARKAIDRLNHVNAKILGVVLNNKDRNKNESPYYYYYGPNDKK
>gnl|bykdb|A0A0U2N769 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus rifietoensis] (length=232 residues).
MRMLNQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAVVFAESGKKVL
LVDADMRKPTLHHTFNLNNHIGLSNLLVGKGELEQSVRDSGIRGLELLTSGQVPHNPAELLDSPVLDQLVAEMKERYDLI
IFDSPPILSVTDSKILANKCDGTVLVVNTGKTEKQSAIKARDSLATSRAYIVGVVMNNYKLSKDHYYSHEYN
>gnl|bykdb|A0A0U2N9S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus kocurii] (length=234 residues).
MVGQQKKPEVKNRKLITFTNPKSRVSEQFRTLRTNIHFTSPDGDIRSLVVTSASHSEGKSTTASNLAIVFAQEGKRVLFI
DADMRKPTMHHTFNIANTRGLSTVLSRQIALKMAIQPAEIKNLDLLPSGPIPPNPAELLSSNHMDFLLEHALDTYDLLIF
DTPPVLSVTDSVILANKCEGTILVVNSGKTEKAYALKAKEAITTATKARLLGAVLNNVKVQQESDYGQYYGVER
>gnl|bykdb|A0A0U2N9T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus kocurii] (length=231 residues).
MRTANKTKRLMPRKLVARTNPHSIAAEQYRTIRTNINFSTPDLHSRVILFTSAAKEEGKSTTAANMAIVFAETGKKVLLI
DADMRRPTLYRTFQLGNNTGLSNLLLRKGSLKQSVKVSGIANLDLLMSGQIPPNPAELLEADALDELIAEMRETYDYILF
DSPPILSVTDSKILANRCDGTVLVVNTGKSEKISVEKARDSLATAKALILGVVLNNYPMNKENYYYHNYNE
>gnl|bykdb|A0A0U2NMR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus rotai] (length=233 residues).
MTNIVRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNARGLSTLLGSRETVLHQVVQNSGVDNLFLMTSGPKPPNPSELLDSRRMKELIQELKQQYD
LVIFDMPPVVAVTDAQIVASKSDGTILVVRENVSKKDSLLKAKSLMELVNANILGVVYNGSKNIEDQGYYYGS
>gnl|bykdb|A0A0U2PDM8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus rifietoensis] (length=234 residues).
MAKKKQSLQATARKVVTHTTPRSFVSEQFRTLRTNVNFASPDLELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLV
DGDMRKPTTHYTFHMPNTIGLSNVLTRQATVEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIF
DAPPVLSVTDGQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGNAEE
>gnl|bykdb|A0A0U2RJL2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=257 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILVDADLRRPTMHSTFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKLAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A0U2UUZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 32O-W] (length=227 residues).
MSRQNSEANLVTFVNPNSPISEAYRTLRTNIQFSSIDHPVQVIMCASAQSGEGKTTTISNLAVTYAHEGKNVLLIDADLR
KPTLHNVFVTSNRVGLSNLIAGQCALPEVTVETRINHLSVIPSGPVPPNPSELLGSQRMRAIMKDIRSRYDIILLDTPPV
LAVPDSLIVSSLSDGVIMVVQAGKVKSDMVRKAKAGLEHAKARILGVVLNRIKRNENAQFIRYYGSK
>gnl|bykdb|A0A0U2WGK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 32O-W] (length=229 residues).
MSRSHEARPLITDVNPLSPISEAYRTLRTNLQYAEVDRPLRLLMVTSASPREGKTTTVNNLAVAYAQTGKSVLLVDADLR
RPTAHHTFQTSNRCGLTHILTGQAKVADAVQNTSINGLKLLSSGSIPPNPSELLGSDKMDRLLAELRESYDIVLIDTPPV
LAVSDAQVVATRCDGVLLVVNAKSVKRRYVIKAKEALEFVHARVLGVALNQVPSSEANPYYEYSQEVRS
>gnl|bykdb|A0A0U2XZ07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus kocurii] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSFVAEQFRTLRTNINFSSPDAEVHTLVITSAAPSEGKSTTAANLAVVFAQEGKKVLIV
DGDMRKPTTHYTFRMGNTIGLSSVLTRQNTIDEVIRPTAVEHLDLMTCGPIPPNPAELLASRSMTTLIDQLKNRYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDMAVKAKEAIESSNSRLIGAVLNNFALPKDNYYYQYYGTKE
>gnl|bykdb|A0A0U3NLF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp. CP1] (length=247 residues).
MLAFLKGKHTRTVKQGNPSELEMVTHPASRISEQYRTLRANIQFSSVDNVLKTFVVTSAESGAGKSTIASNLALSFVSQG
MKVLLIDADMRKPVIHNLFKLTNRDGLTTLLSTKGLDEDRVIHKIGSSNLSVLTCGPVPPNPSELMASKRMQQLMNDLKK
RFDLIIVDVPPIIAVADAQIMANMADGTIFVIRKGISTKDSVMKAKELLEMSKATIIGSVFNGTVENEDMNSSYYGVEKK
GHHDSFY
>gnl|bykdb|A0A0U3PB70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp. CP1] (length=234 residues).
MFKKKTKETNGERPSLITLTRPSSVIAEQFRTIRTNIQFSMIDQDLKTVVVTSAGPGAGKSTISANLAVTFASQGKKVLL
VDADMRKPTVHKTFRLPNHDGLTTLLTEKDVNISDIAHRAPTEGLFIITSGVIPPNPSELLASKRMDKLMNELDQIFDLI
IFDMPPVVAVTDAQVMASKVDGTIFVIPKGLTNKDMVLKSKDLLDKVHANVIGAIFNRVEMSGDNYYYYYGEKE
>gnl|bykdb|A0A0U3U526 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=186 residues).
KIGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMLGVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVS
PNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGV
VLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|A0A0U4P935 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinaeequi] (length=245 residues).
MFNFKSKKKQQKIENEQKLGSPIVTYFEPMSAIAEQYKTIRTNIEFAQIGSSINSIAVTSSISMEGKSTTTVNLANTYAQ
TGKKVLIVDADLRKPTLHKTFKLNNNVGLTTALVNDEYSLESVIQYSEDFDLYLLPSGPIPPNPAELVGSQEFSALLDQI
TELFDLVIFDTPPLHSVTDGQIIASKVDGTILVVRQNYVRRDQVVEAKVSLDNVKANLIGYILNDVPVNKNKGYGYYEYY
TEKDS
>gnl|bykdb|A0A0U4VW34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinaeequi] (length=249 residues).
MFKNKRKHFDKMNAEQRRGASLITVTQPNDVISESFRQIRTNIQFSMVDHDFKSIMFTSSGVWEGKSTVTANTAAVMAQQ
GLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDRDANIMDTVNYVADANIYILAAGPIPPNPSELLGSNRMAELIGELE
EMFDLVIFDTPPILAVTDAQVVATRVDGVIVVVRSGIANKNEVRKTKDLLDVVNANVIGAVYNGEDANKLGYGYGYGYGY
GYGQSETSK
>gnl|bykdb|A0A0U5JLQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFHRTQKQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQEQTQKLAIKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGENTK
>gnl|bykdb|A0A0U5JMM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
GYGYEEETNK
>gnl|bykdb|A0A0U5JSZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C105KSO15] (length=233 residues).
MRKVTFRRKDKLDFKANEAFKTLRSNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
RYKVDGNTYGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVID
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYYGKYYGKYYGNYGES
>gnl|bykdb|A0A0U5K170 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=248 residues).
MSLLHRTQQQSTDIMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVGEGKSTVTHNVAVVWAQTG
QRVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGEDTNK
>gnl|bykdb|A0A0U5KEL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=261 residues).
MAFGRKKHLDKDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLSPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGYGEEDEKKGLFGRKK
>gnl|bykdb|A0A0U5KTX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=240 residues).
MDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPT
LHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPM
LEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGYGYGEDTNNAVCKIK
>gnl|bykdb|A0A0U5NZQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C105KSO13] (length=228 residues).
MQEIVLRGLKKDYRSNEAYKTLRTNIEFSGEDNKAIVLTSCTPNEGKSTVSLALADSLAEAGKKVLFVDADLRKSVLTGR
HKVTGPIKGLSHFLAGQAKVSDIMYQTQEPGLVVMFAGVVPPNPAELLGQYKFKSLIESAKKVYDYIIIDAPPLGSVIDS
AIIAKQCDASVLVIAANTISYKFARAVKEQLEKSDCPILGVVLNKVDMKQNKYYGKYYGKYYGEYGKK
>gnl|bykdb|A0A0U5PAU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C105KSO14] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGNGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMVDADIRKSVLV
SRYHLEREVSGLSQYLSGQRSLENVLYDTNIENLSIIFAGPYSPNPADLLEESLFGDMISKLKEKYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMKRNGYYSKYYGKYGKYSKYGHYGKYDRYGK
AEA
>gnl|bykdb|A0A0U9HL79 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tepidanaerobacter syntrophicus] (length=244 residues).
MKQIQQQLNSNGLMVMDDPKSLVSEAFRLLRTNLQFMGVDKPLKRIVVTSSNPGEGKSFTIANLAMSIAATGSRVLLIDA
DLRKPRIHKIFLLENYRGLSSILAGDISADFVPQEAGIENLHIITSGPVPPNPAELLGSSKMKQFLNKVSSMYDIVLLDS
PPVNSVADTSILSTSVDGVILVVEAGSTPREAAILAKQQLEKVKAHILGVVLNKVKQTGSGYYYYYYYYGESGGHEKKRK
KRRS
>gnl|bykdb|A0A0V8BJS7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A0V8EXX2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MSKKNEKLDSNRYLITSVNPKSPISEQYRTIRTTIEFKLADQGLKSFLVTSAEAGAGKSTTISNLAVTFAQQGKKVLLID
ADLRKPSVHMTFRLQNRSGLTNVLTRQISVNDAMQGTNFSENLAIISSGPVPPNPSELIGSAAMKNLIDSVTEAFDIVLI
DTPPLSAVTDAQILSRYIGGAVIVVRANQTKKESVTKAKKLLDQVNANILGVVLHGVEASDSAYYYYYGAE
>gnl|bykdb|A0A0V8J4Y3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus enclensis] (length=229 residues).
MRKTIKDLTQRSLITHNNPKSPISEQYRTIRTNIQFSSIDTHYQSIMVTSSSPGEGKSTTVANLAVVLAQQGKSVLLIDG
DLRKPTVHYTFKVSNIQGITNVLTRQISLEDAAVQTSVEDLSVLPSGPIPPNPSELLNSKSMEMLVEEAKSKYDYVLFDT
PPVLAVTDAQILANRCDGVVLVTSSGKTEKEAAIKAKELLDNANAKILGVVLNQKEMNENSYYYYYGAN
>gnl|bykdb|A0A0V8JJ77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SGD-V-76] (length=235 residues).
MVRKKQGNDKALTAKRRLVAHTNPKLPIAEQYRTVRSNIQFSNLDEDIRSLVMTSSGPGEGKSTTAANLAIVYAQQGKRV
LLIDADLRKPTAHFSFRLENYVGFTNVLTRKAKLLDAVHETNIPNLSVLTSGPIPPNPSELLASKNMDALLDEMYETFDF
ILFDTPPTLAVTDAQVLANKVEATILVISSGKTEREAAQKAKELLLNAKARLLGVILNNRKIEDGGHYYYYYGTN
>gnl|bykdb|A0A0W1B4F5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus etheri] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDADL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVSNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A0W1JR47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfitobacterium hafniense] (length=230 residues).
MRRYSIETLANPKSTVSEAYRTLRTNIQFANVDNVIKKILFTSAGPGEGKSSTVANLAVSIAQSGKSVLIIDGDLRNPTQ
HKIFNVPNTHGLSTTLVEEIHSLTHSVKTFTEGLELLPAGPIPPNPAELLGSKKMKQLLFDAAKAYDIILIDSPPTIAVT
DSSVLAQSVDGVVLILAAGEVKQEYALRAKEQLEKVGAKIIGTVINKVELKTKEHYYYYYYHGENRSQSI
>gnl|bykdb|A0A0W7TNU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruthenibacterium lactatiformans] (length=241 residues).
MMAKKSKPIRREFVLMNKNTSFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVID
CDLRKPIIHRYLKIDNSAYKGIISALADGSLAESIINMKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIF
DTPPVSVVTDAAVLSQYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENAD
R
>gnl|bykdb|A0A0W7YJR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. F5] (length=232 residues).
MFFKRKTKKIPMARKLITVSDMSSIPSEQYRTIRANIKFSQPNRDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKSVLI
VDADMRKPTLHHTFYLDNILGLSSVLSRQSALQEVIQETFVEGVDIISSGPIPPNPTELLASETMTSLLAEVKNIYDIII
LDAPPLLFLSDAQILSNKCDGTLLIVNTGAVGQADVIKSKSILTVSKANILGVILNNYKIKGNTYEHYYGKE
>gnl|bykdb|A0A0X1TJ17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sp. H121] (length=238 residues).
MSSELITITNPKSPIAEAYRTLRTNIQFSNVDEDLKVICVTSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVH
KVFKISGTKGLTNLLAGQLSLEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELVANLRQQYDMVIIDAPPVGVVTDS
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYSYEEEVQTTRRKRSFFSKK
>gnl|bykdb|A0A0X8FEU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=235 residues).
MFGRKKKTEIKKPADRPGLVVVDNPTSAMAEQFRTIRTNIQFSMLDKELKTFNITSPGPSSGKSFLAANIAAAFASDDKR
VLLLDADMRKPTVHKTFGVLNDRGLTNLLTDNRLEIHQVIKKSYVPNLFYLTCGAIPPNPSELLASKRMQELMEQLRNVF
DIIVLDCPPVLAATDAQVVSARADGTVVVVPYGQCSKDEVKESQALLDKVNTNVLGVIMNRTERTEDYYYYYEEE
>gnl|bykdb|A0A0X8GYC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=244 residues).
MISFKKRNKQVKKNKTYILSNKSPFAYLEGYKSLRTNLSFLTFSGEVKTILVTSSVPNEGKSTVSINVARTLSMAGHKVL
LIDADLRAPVIQKYLNVNYKITSGLSSVLASKAQIKDAIYKSPSLEMDVIFSGPIPPNAVELLSRDRAKTSIETLRKRYD
YIIIDSPPAGVVTDSVVLSQHVDGVLYVVRQNHAEKELVKNAMKDLVSMEANILGIIFNDYIDERSKRKGSRDKYSYYYQ
SGNK
>gnl|bykdb|A0A0X8H0Y4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=244 residues).
MFRKKAMLSASNHNKIDILDDNSSFSFVEGYRSLRTNLSFMTYSGDVKTILVSSSLPGEGKSSVSVNLARSLSMAGKKVL
LIDADLRSPSVHKYLRIRKKVQDGFSTVLAGRTKLEDAIYMFPPLEIDVMLSGSIPPNASELLSREHTGEIMSELKEKYD
VVIIDTPPAGVVTDAVVLSRYVDGLLFIVKQNYAEIDLIKHALKSFEQTGTKVLGVVMSDYKSTKDTRGSGSYAYDYTYG
VDSK
>gnl|bykdb|A0A0X8H118 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=257 residues).
MSKKKRKSSRVHPTQTDIIDPKSPFQFIEGYRSLRTNLGFTTFNGEVKTILVTSALMGDGKSSVSINLARIMSMSGKKVL
LIDGDMRSPSIHKYLKIRSKVKEGFSSVIAGRTTVNEAIYSFPALEIDVMLSGPIPPNASELLSHEHTKKVLDELRGKYD
MVIVDTPPAGIVTDAVVLSNYVDGVLFVVKQNYAEKEVVKGTLKAFSGTESKILGVVMNDYSISKNLSRYRSYEYRYGYG
YGYGYGYGHGAGDDSEQ
>gnl|bykdb|A0A0X8JZA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 431] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTATNVAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSNGLCETNVENLFMIQSGAVSPNPTALLQSDKFGSMIETLHKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVAEAGVAKRREIQKAKSQLEHTGTPFLGVILNKFDVQRERYGSYGSYGSYGKK
>gnl|bykdb|A0A0X8KHR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SDLI1] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLDETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A0X8KK58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SDLI1] (length=213 residues).
MSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDN
GTGLTSLLLKQIPFQKAVLRAEEANLDILTSGPIPPNPAELLSTGAMRDLLSEAALVYDKVILDTPPVLAVADTKILGSY
TDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A0X8KKT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemella sp. oral taxon 928] (length=231 residues).
MAEISVLNNEKIVDSSIKEYYNALRTNVQFLGKDIKVIAITSTSENEGKSTVSINLAISLAELGLKTVLIDADTRKSVMA
GRFKFKNKINGLTNYLSGVSPIEDIIYETDVNNLNIIPAGQVPPNPTGLLQNRNFNVMIDVFKEYYDYIIIDTPPIGAVV
DAAIISQKCDGFAIVVESNKIKKKVLEKSKEQLEKAGSKFLGVILNKVDVKEVTYGGYGAYGGYGEYGKEN
>gnl|bykdb|A0A0X8PS69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus gallinarum] (length=234 residues).
MAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A0Y0NR49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEITQKKLEIVKKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
GVFRFSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGGYGNYGNK
>gnl|bykdb|A0A0Y1WAI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|A0A0Y3JII9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MAKLELSQQKLNTVKKAEEYYNALRTNVQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVASPNPTALLQSDNFEIMIETLRKYFDYIIVDTAPIGVVI
DAAIVVQKCDASILVVEAGVAKRREVQKAKSQLEQTGKPFLGVVLNKFDIQREKYGSYGGYGNYGKR
>gnl|bykdb|A0A0Y9AUF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0Z0KIU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMHKDKSASYYAYYGTDES
>gnl|bykdb|A0A0Z8DFU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MAKLEIARTKKELVNKTEEYFNAILTNIQLSGADIKVVGITSVQTNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQRCDAMVLIAEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIITEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8E9B6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLVQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0Z8EWW1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0Z8LFC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MAKLEIARTKKELVNKTEEYFNAILTNIQLSGADIKVVGITSVQTNEGKSTMAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQRCDAMVLIAEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIITEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8MR63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGSDIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0Z8NNQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGYVKRSTLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8RBW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MAALEIARKKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVVS
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTAIESGKVSPNPTALLQSKNFENLLATLRRYYDCVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8U8Q6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8XL71 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARKKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAATLALAYARSGYKTVLVDADIRNSVVS
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDCVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYANYGNYGKKA
>gnl|bykdb|A0A101D6X9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter thermocopriae] (length=235 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVIV
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|A0A101H909 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 38_11] (length=225 residues).
MKDIIVHKQPKSPVSEAYRGIRTNISFDNVDKSFKSILVTSPKEGEGKTTTLCNLAMTFALSSNSVIIVDTDLRRPKLHK
LMEISNINGLTDILLKGDDYRKYINSSVHPNLDLITSGTIPDNPSEILGSDAVKRLIEELKKDYDYVFLDTPPVVPVNDA
IIMSTYVDRVILVLASGEVEQEVAIKAVRDLQKVGAKILGTVLNKVPINKQKYNYYYYYSNELGE
>gnl|bykdb|A0A101XY67 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. DMB5] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQSELRDVLQDSGVPNLSIMTSGPIPPNPAEMMASNRMSTVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A109MUB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDKKQVNLIAQNNPKSPITEQYRLIRTNIQFASVDEDIQTIVVTSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADL
RKPSVHYAFSLSNIQGLTSVLTKKMSIEKAVMKTAVPNLEILTSGPIPPNPSELLNSRAIEATIHHLKEMYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTTVLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A109MW30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=224 residues).
MTEAKKRSSISMLKSKSPVVEQYRTIRTNLQFSAVEKDIRSMIFTSANPGEGKSTTSINVAAVFAQQGKRILIIDADLRK
PSVHTNFNMENFLGLTNIITKQNQLQEAIQSSIYPNLDVLTSGPIPPNPSELLGSNGMENLLEEAKMNYDLVILDTPPVN
AVTDAQILANMTDGVVLVVSSGSTEIQQAKKAKELLQKADAKLLGAILNKKKQKYSDEYYYYGK
>gnl|bykdb|A0A109RC47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus christensenii] (length=257 residues).
MFNWKKRQMDKKNKVQRLGVGLMTVNDPNHVVSEQFRTIRTNIQFAVEEFQLKTLMFTSSGPFEGKSTVAANVATTMADL
DGVRVLMIDGDLRKPTVHKTFDLHSRRGLTTYLTDRTVSYMDVCEYIPEVNLYVMPAGPLPPNPAELLSSKRMNDLLSDV
SEVFDIVIIDAPPLLPVTDAQIIASRTDATIFVLREGVATYSNVQKSKGLLDSVNARVIGAIYNGADVSAMDAYYGYGYS
DEEIELEEFKSEEDHAL
>gnl|bykdb|A0A109RE50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=251 residues).
MFNFKQRKIDKKNKEQRRGVSLITASDPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDCDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
DEDIDSEDLQS
>gnl|bykdb|A0A109UGJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=241 residues).
MFRKKVKKNKLNIFEGTHIIHDESPFAYLEGYKSLRTNLSFLTYGGEVKTILVTSSVAHEGKSTIAINLARSLAMAGNYV
LLIDGDLRAPVIQKYLKITNNINNGLSSVLANKIPAEEAIYKYPAMEIEIMFSGPIPPNAVELLSKGRAKRLIGELRERY
DYIIIDSPPSGIVTDAKVLSQSVDGLLYVVRQNFAEKDLIKRTTKDYIASGTNILGVVFNNFTQDNFARKRKFNNYYSSE
D
>gnl|bykdb|A0A110A1P4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MAKLELSQQKLNTVKKAEEYYNALRTNVQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVASPNPTALLQSDNFGIMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVVEAGVAKRREVQKAKSQLEQTGKPFLGVVLNKFDVQREKYGSYGGYGSYGKR
>gnl|bykdb|A0A110G364 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A116JV85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=231 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKEQLEQTGTPFLGVILNKYDIATEKYGDYGNYGNYGNYGKKA
>gnl|bykdb|A0A116KHG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSEYGNYGNYGKKA
>gnl|bykdb|A0A117J2D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera sp. DJF_B143] (length=232 residues).
MAEIDFITQYDSRSPISEAYRSIRTNLQFSGAGQDLKAVAFTSVLPNEGKSTTVANLAIVMGQDNKKVLLIDCDLRKPVV
HRRFELPNKGLTNCFAENIPLYQVIRKNVFPNLDIVTSGPIPPNPAELLGSSRMMDLLEEVDEDYDYIFLDMPPVLVVTD
AAIMGSKVDGVVLVLASGEVSPEEARQAKSLLEKGKANILGVVLNKMPYTHRHSHYYYYYYDEDHIKHKHHK
>gnl|bykdb|A0A117LAK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldanaerobacter subterraneus] (length=234 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVT
DAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|A0A120DJ23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A120IAT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinaehominis] (length=243 residues).
MFNRKAKKIEALNAEQKKGASLITVTKPNNPVSEMYRTLRTNIQFSVVDSELKSMMVTSSGPFEGKSMTTANLAAVMADQ
DMRVLLVDADMRKPTVQKTFDIHTTEGLTSLLTERDKQPMDVIKYVPETNVYVLTAGPKPPNPAELLSSQRMKDIFEELK
TIFDLIIFDTPPVLAVTDAQIIANMVDGVVMVVRQNVAQVDNLHKAKQLLEKAQANVLGVVYNGIENSKDAAYGYGYGYG
VDE
>gnl|bykdb|A0A120LLF8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus gallinarum] (length=213 residues).
MRSMKENYSIISEQVKLIRENVDYLCQQQDAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFS
QEMHVGLSNYIRRDISIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
ILAKKVDGVLLVIHADKTNKQSAKNAVKKLRLVNANILGVVANGTDTGENYYY
>gnl|bykdb|A0A122HCY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=229 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A122MPK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKSLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A125YRQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis ATCC 35037] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A126UPY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGVDIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKSFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYGEYGNYGKKA
>gnl|bykdb|A0A127DA97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVITSSEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAIEELKQMYDYIIFDTPP
VLIVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSHYYYYQT
>gnl|bykdb|A0A127EFH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVVEAVKGLRAVKANIIGTVFNGEEIQRGKYYHYYKKD
>gnl|bykdb|A0A127TU31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. A12] (length=231 residues).
MATLEIVKSKLAAMTQAEEYFNALSTNIQLSGTNIKVVAISSVQPNEGKSTISTNLATAFARAGYRTLLIDADIRNSVMT
GVFKSQGRVAGLTEVLSGKSEISQAIATTDYPKLDVLLSGQVSPNPTGLLQSKNFEVIIEALRNHYDYIVVDTPPIGMVI
DAAIIAQRCDGSLIVTAAGAVSRKAVQKAKEQLEQTGTSFLGVVLNKFDIQLEKYGSYGNYGNYGNYGKKR
>gnl|bykdb|A0A127W2Q4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina psychrophila] (length=234 residues).
MFNKKKKPIQTVARKLVTYDSPKSVVSEQFRTVRTNINFSMPDKDLKTLLFTSSTPGEGKSTSASNVAIVFAEEGKKVLL
VDADMRKPTMHYTFHKTNSTGLSNLLTRKWELKDVVIETEIEGLHIVTSGPIPPNPAELLGSKTMDSLIEEFIAGYDIVV
FDAPPLLSVADAQILSNKCDGTILVISSGTAEKDSVIKAKEALVSSKANILGTLLNNFVLEKEHHYYQYYGTGE
>gnl|bykdb|A0A132P8E8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNARGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILDEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLNKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A132TVW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus riograndensis] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQADLEDVVQDSGVANLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A133CEM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVDNLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A133KEQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus tetradius] (length=217 residues).
MSKKNTYYSASMYDEAIRSIRTNIQFSSLDKKNNIIAVTSTKPSEGKSTVIYKLAKSFADNGERVILIDCDLRSPSLYEI
AGINDNVGVTNYLTGKVSIQRAINKDRDQANLDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFTDA
SIVSTLCDGVIFVIKSSDTKKEDITLALDNLKKVDAHILGAVLTYVPMKDKRYGNYY
>gnl|bykdb|A0A133KZW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans] (length=231 residues).
MAPKKTKLLNTRRKLIAKLNPTSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTIVGNLAVVFAQQGKRVLLV
DADLRHPTVHYTFGMTNTFGLTTVLTKQGTLEDTAVKTDVDHLHVLTSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILL
DTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVDAVKKSKDLLESANANLLGVVLNNKKTQNTHYYYYYGKD
>gnl|bykdb|A0A133LDL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus hydrogenalis] (length=223 residues).
MKENKMAKKRGYYNTKSIFDEAIRSVRTNIQFSDIDDKKRVIAMTSSKPSEGKTTVLYSIAKSFAENGNSVVLLDFDLRI
PKVGKVAGIETNMGLTNVITGKVELNRALIKDQNEDNLFVMLSGPVPPNPAEILASNHVKELIKELSQRFDYVFLDTPPV
GLFTDASIVSTYCDGVIFAIKSNDTKKEEVSHALENLKKVNGKVLGAILTFADLKESTYKGYY
>gnl|bykdb|A0A133MSB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGTIPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVMEAVKGLRAVKANIIGTVFNGEESQRGKYYHYYKKD
>gnl|bykdb|A0A133MZD0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=237 residues).
MKKESRENMKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGK
QVLLVDADLRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWILPSGPKPPNPSEVLGTKRMEEIIEELILD
FDLVIFDMPPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSFE
>gnl|bykdb|A0A133N3N4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTSANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLSNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A133Q0D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus lugdunensis] (length=231 residues).
MTKKNEKRKNLNTPLFTEDNSKSIVSEKVRGIRSNIMFSGVEEVKSIIVTSEKPAAGKSIISANIAITYAQAGYKTLIID
GDMRKPTQHYHFETTNYDGLSNLIIGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSAAFENILRDLNEIYDFILID
TPPVISVTDAQVYLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSSSYYYYGDDE
>gnl|bykdb|A0A133QRZ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus simulans] (length=237 residues).
MIKENSQMKKKSKAINNPLMTHYDPKSVISEKFRGIRTNIMFSTANDDVKTLVITSEKPGVGKSLVSANIAVTYAQAGYK
TLLIDGDMRKPTQHYMFNTSNIDGLSNLIISKSYFEKAITKTEIDNLDLLTSGPIPPNPSELIGSIQFQNHLEELKEIYD
FIIIDTPPVNTVTDAQLFSEISGYAALVINVKNNDRKSILKSKELIENTGAKVLGVVLNKTEHEKNSSYYAYYGEES
>gnl|bykdb|A0A133S3A9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLEFIKKTEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKSTTSINIAWSFARAGYKTLLIDGDIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTAMGEANKHDVQKAKQQLEQTGKPFLGVVLNKFDVQREKYGSYGGYGNYGKK
>gnl|bykdb|A0A133ZSJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemella haemolysans] (length=237 residues).
MAQINLLTNKNIVDPKNEEYYNALRTNIQFLGKDKKVIVITSTSENEGKSTVSINLAISLAKLGLKTILVDADTRKSVMA
GRFKFKNKISGLTNYLSGVSPIEDVIYETDIQHLNVIPAGQVPPNPTGLLQNKNFNIMVEVFREYYDYVIIDTPPVGQVI
DAAIVAPKADGVVMVVEANRVKKKVVEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYGHYGGYGNYGANKKTDKK
>gnl|bykdb|A0A135WN68 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. JH7] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLENCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLHYYYGVN
>gnl|bykdb|A0A135WPN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. HYO08] (length=236 residues).
MFVFKKKPKIIQAAARKIVTFTNPRSVVSEQFKTIRTNINFSMPDQKLEALMFTSASPNEGKSTVASNVAIVFAQEGKKV
LLVDADMRKPTTHYTFKTANAHGLTNVLTNQSTWQEVITETPISGLDILPCGPIPPNPAELIGSQKMVLLIEQLKQAYDL
IIFDTPPILSVTDAQILSNKCDGAILVINSGTSEKESVQKAAEALQNSKANVIGTVLNNYKLAKDHYYYQYYGNAE
>gnl|bykdb|A0A135YX31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pasteurianus] (length=243 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNVQFSGRDLKVITLTSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTTIDNLMIIPAGQVPPNPTSLIQNDNFKTMIETVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGSYDGYGTYGAKEERSKKGKGR
RRK
>gnl|bykdb|A0A136BDP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A136G1M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus intestinalis] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKADTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A136GD61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus intestinalis] (length=238 residues).
MALRKSRGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHFENMIGLTTVLLKKSSLEQAVQASNATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|A0A136Q761 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Christensenella minuta] (length=296 residues).
MDIDYKKQALEAFNTIQTNIGFLGIDHDIRTIMVTSSIKGEGKSTVTSNIANSYAFSQKRVLLVDCDMRNPTVHRVLELP
NRKGLADLIMAGREGQDAGDYITHYGPYFDVLTAGHRPPNPTELLGSKRMEALIGLFSGQYDYVILDTPPVLLVPDAIAL
HPYVDGILLVVRHGYTTKEVLEDCKKAWEVAGTKPSACILNAIPDMQKRYSYYGYYDYEETQPAKGRGKNRRQPVIKREE
RQEKDMYTSIAKEAKEPHSRKDIHGAEPAEPEFIRKANTSGQGFQRQADRTKRKLH
>gnl|bykdb|A0A139CI15 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Candidatus Frackibacter sp. T328-2] (length=241 residues).
MEEVEVMSDETKRRVQSRDRELVVRHNPKSPLAESYRTLRTNIRFLSPDDPLQTIAMTSSTPSEGKSITIANLAISMTQN
GQEVIIIDTDLRKPMQHRFFKMTNFAGLSNILTNEIELKEGIRETGVERLKLVSSGSVPPNPSELLSSKKMTEVIEEVEE
LADIVLLDCPPIIAVSDPMVIANKVDGVILVVASHETEDKALVKAKEMLDKVQANIIGTILTKYRVGESKGYYSGYYHYY
G
>gnl|bykdb|A0A139M8X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEISQEKLDLVKKAEEYYNALCTNLQLSGDDLKVLSITSVNPGEGKSTTSTNIAYAFARAGYKTLLIDGDIRNSVMS
GVFKTRDKITGLTDFLSGTTDLSQGLCDTTIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEVGETNRRDIQKAKEQLEHTGQPFLGVVLNRFDTSVDKYGSYGSYGDYGKK
>gnl|bykdb|A0A139MJ02 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. DD04] (length=236 residues).
MPRLELSRSRKASIEKTEEYYNALRTNIQLSGDNLKIIALTSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSIMS
GVFKSKEKITGLTDYLAGKTDLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYVIVDTPPIGLVI
DAAIIAQKCDASILVTEAGVVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGIYGAYGNYGNYGKENTK
>gnl|bykdb|A0A139MZ47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=231 residues).
MATLEIIKNKLAEMHQAEEYFNALSTNIQLSGSDIKVVAVSSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
>gnl|bykdb|A0A139N523 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus cristatus] (length=232 residues).
MPILELAKKKKISISRVEEYYNALRTNIQLSGENIRVIAVSSTFPGEGKTTTSTNLALTFAKAGHKTLLVDADIRNSKML
GGVFKSDGKVTGLTEYLSGTTDLSQGLCETDEPNLFVVTSGQISPNPTALLQSDRFATMMNVLRRHYDYIIVDTPPIGMV
VDATLISRVCDASLLVVAPKEVKRKMVQRSKMQLEQSSTPFLGVVLNKYNVEADKYGFYGSYGHYGDNLSKE
>gnl|bykdb|A0A139N761 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=245 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDTDTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTTLIQNDNFKAMIETVRGLYDYVVIDTPPLGLVV
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLDQSGSIFLGVILNKYDIHLDKYGSYGSYGGYGSYGSYGKNTGKKLKS
KGMKE
>gnl|bykdb|A0A139N9M2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. DD10] (length=230 residues).
MPTLEIAQKRLDLFQKAEEYYNALRTNIQLSGNNLEVVTISSVKPGEGKSTTSINIAIAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDFLSGNADLSNGLCDTNVENLFVIQSGQVSPNPTALLQSENFVTMLTTLRRYYDYIIVDTAPIGVVI
DAAIISQKCDATMLVTDSGETRRREVQKAREQLEHTGTPFLGVVLNKYDTKLEQYGSYGNYGSYGNYGKK
>gnl|bykdb|A0A139NX96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISVTSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGIVI
DAAIITQQCDASVLVTAAGETNRKDVQKAKIQLEQTSKPFLGIVLNKLNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A139P2I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAHKKLEQARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A139PA78 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. DD11] (length=231 residues).
MATLELVRKRRNLIKLTEEYYNALSTNVQLSGASIKLVEVTSVTANEGKSTTATNLAAAFARTGHRTLLVDADIRNSVMS
GVFKSQSKVSGLTDFLTGQAELQTILNDTDIDNLDVILAGPVSPNPTGLLQSRQFETLLANLRPRYDSIIVDTSPIGLVI
DAAIIAQKCDASLLVTEAGSVKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGSYGAYGSYGNYGKSN
>gnl|bykdb|A0A139PFC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=224 residues).
MPTLEISQAKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDGDIRNSVMS
GVFKTRDKITGLTEFLSGTTDLSQGLCDTNIENLFVVQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTKKPFLGIVLNKFDTSVDKHGSYGDYGKK
>gnl|bykdb|A0A139PL27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEITQKKLELVKKAEEYYNALRTNIQLSGDNLKVISITSVNPGEGKSTTSTNTAWAFARAGYKTLLIDADIRNSVMS
GVFRSNEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMLDTLRKYFDYIIVDTAPVGIVI
DAVIVTQKCDASVLITAVGETHRRDVQKAKEQLEQTGKPFLGVVLNKLNISAEKYSSYGGYGNYGKK
>gnl|bykdb|A0A139PRD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISVTSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A139Q1J5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLRVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A139Q5Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=233 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTATGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGNYGKK
>gnl|bykdb|A0A139QEL2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus constellatus] (length=230 residues).
MPRLELAKNKEKALKKSEEYYNALRTNIQLSGENIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GVFKTRDKITGLTDYLAGAADLSNGLCDTNVENLFVIEAGQISPNPTALLQSKNFGMMIDILRNHYDYIIIDTPPIGIVI
DAAIIAQKCDASALVVESGNVKRKALQKAKGQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A139QRC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAVGEANRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGNYGRK
>gnl|bykdb|A0A139QYP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIVHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSGNFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A139R9K2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=230 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKDQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGNYGRK
>gnl|bykdb|A0A139RC40 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTATNVAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSNGLCETNVENLFMIQSGAVSPNPTALLQSDKFGSMIETLHKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVAEAGVAKRREVQKAKSQLEHTGTPFLGVILNKFDIQRERYGSYGAYGSYGKK
>gnl|bykdb|A0A139RPG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAHKKLEQARKAEEYYNALRTNIQLSGNNLKVVSITSVKPEEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGIVI
DAAIITQQCDASVLVTAAGETNRKDVQKAKSQLEQTSKPFLGIVLNKLNTSAEKYGSYGKYGSYGKK
>gnl|bykdb|A0A140DXM2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibaculum rodentium] (length=243 residues).
MAKKKKNVSNNSSRRTNRNDQLNLEEVYRQLRTNIEFSQMDSELRVLNVLSTHPNEGKSSVASNLAKIFADKYEKVLLID
CDLRTPSLHKMLRTSNGEGLTNLLTHYRQDDPLLEQDEIQELELDDQSSLFFLSAGSRVPNPTEIISSRRFASLINSARS
QFDQVIIDCPPAFAVSDAVPISNLSDGTLFVLSAKETDKNDAREAVDDLKRNGANLIGTVMTKVPGFMSRHYYGYGYGDR
NER
>gnl|bykdb|A0A140F3G6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=243 residues).
MPLLKLVKSKVDFTKKTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRR
>gnl|bykdb|A0A140F3G8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=249 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSLNLAISFASVGLRTLLIDADTRNSVFS
GTFKTNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGSYGEYRKKTDQT
EGHSRAHRR
>gnl|bykdb|A0A140LCR7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fervidicola ferrireducens] (length=235 residues).
MEERELELFIMNDPKSVISEAFRVLRTNLQFSSIDKPVKKVVVTSSMPQEGKSTVAANLAVSIASTRSKVLLVDADLRRP
KLYKLFRLENYKGLSNFLAEDLPLESVITKMANLHIITSGPIPPNPAEILGSSKMKKFLDEMATKYDMILLDAPPVNSVA
DAAILSTLVDGVILVVETGVTAREAAIAAKQQLEKVNAKILGVVLNKIKQDKNGGYYYYYYYYGEEGTKKRKKKR
>gnl|bykdb|A0A142D4A0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. JS12] (length=232 residues).
MARKPAASIRKAERKLITVENPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAAVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQETEIDHLSILTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A142KRY7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus oris] (length=247 residues).
MGLFKHRYTESTDTMDNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGV
REVYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDADAGYGYGYGYG
YGYEDER
>gnl|bykdb|A0A143MMM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus subterraneus] (length=230 residues).
MARKKQIRKAERRLITVDNSKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTVANLAVVFAQQGKKTLLID
ADLRKPTVHYTFRLNNYMGFTNVLTGSAPLLPTCQETDIDNLFVLSSGPIPPNPAELLSSKAMAQCLEQLYETFDLVIFD
TPPVLAVTDAQILANQCDGTVLVIESGRTDIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A143PCJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus condimenti] (length=230 residues).
MKQKDNQKHQLITLHEPKSVISEKFRGIRSNLLFSSADETIKGIVVTAEKPSAGKSTIASNLAITYAQAGYKTLIIDGDM
RKPTLHYIFNKMNNHGLSSTIINNIKLEDSIEETEIENLDILTSGPIPPNPSELIGSSNFNEIISTLKDRYNFIVLDTPP
VNTVTDAQIYSKYITHSILVIDAEKNNRTEITKAKSLLDRVDSKILGVVLNRTPKDKSSSYYAYYGSEDK
>gnl|bykdb|A0A143PZ28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRKKSNANNDTMNNGAKLITVAQPKSPISEQFRTIRTNINFMAIDKPIKTLALTSANVSEGKSTVTDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNREGLTTILTSSDNSVDLRKIVQPSGVESLDILTSGPIPPNPAELLNSQRMKTLIES
VKSIYDMVIVDVPPLLEVTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYGTDSAQ
>gnl|bykdb|A0A143Q1W1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFKRKQQHSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANMSEGKSTVTYNVAVVWAQTG
QRVLLIDSDLRQPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GTDGDDK
>gnl|bykdb|A0A143WVN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI006] (length=493 residues).
MDEKELQQEEEVEIDLWVLFRDFFMGCVKFWWLVVLLAVIGAASMLFKDTGFYTPMYRSQATFTVTTNTSEDSNASYNFY
YDSATAQQLSLTFPYILSSDLLTDAIMEDMGTTSINGSISASVISDSNMITMSVISSDPQAAHDILESAIKVYPDVARFV
IGPTRFNMIDAPTLPTEPYNQPHYTVNFAKGALIGAGIGFAFIIVYAFLRKTVHKEEELRQSINLKCIASIPNLKQKRRK
KQRKQPLPSILDRRIDPYFIENMDSLYLRIMREMNERKGKTLLITSTVSGEGKSLISLNLAYELAKNKRHVLLIDADLRK
QDLREQLHLPTDGEGLESLQDGVEAAVKSINYLEDSGIYFLGGSHISKDPSGLLSSKEMDTFMKYMKEYMDFVIIDAPPC
EGFEDALILENYADGVLYIVKQDYVQKRRIIDSISMLAETQADLIGYVFNGVSHMMRGYGYGHYGSYGYYQRYGRYGKSY
GYGHDQEKANAAE
>gnl|bykdb|A0A143X881 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI006] (length=222 residues).
MEQQIIEIRNISSSTNTDEAFRTLRTNLMYIDDLKVITISSSSPNEGKTVTAFNLAYQFAKLGKRVVLVDADMRRSSLRS
YLMLKDKVSGLSEALSRQSRNYLFPTNVDNLFVILSGKNPPNPSELLSSPIFDQLISALKENFDYVIIDTAPMAVSMDAT
IVGRKSDGLVMVIRNEMTRKKNLRRIRADLERNGVRLVGAVLNRVKKNQIDYGDYRYEKYYE
>gnl|bykdb|A0A143XEF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacteriaceae bacterium CHKCI004] (length=240 residues).
MKQIDMNIRALPYAVEEAMNRLRVNIKFCGKNTKKILVISSVPNEGKSTVSVHLWKMLAEAGFPTVLVDLDLRKSVLKDR
LEFKSEGEIQGLDYYLSGLSEYQNVVYETNISNGYIVPVSNLLENPSALLEDPRMGELLDRLAEDYRYVIIDSPPLDSVA
DGALIASLCDGAILVVRSGMTSRRLVKQSVQQLERVRCRLLGMVLNRVETKSRAYQKYYGKYGNYYSDYYGGHTSEKGDS
>gnl|bykdb|A0A143XF22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=511 residues).
MLFIKSGSRLVIVMKDMKEDRDMKEDRKGIKNREDEIEIDLVLLFKDFWKSFTRLWWVVLMLIFLGSGGFFAYNYFGYEP
IYECGATFTVATGDGENGSYNFYYNSSTADQLSKTFPYILDSNFFRSTLLERLGKDRLNGSITSETIDNSNMVTMKVHSP
NPQDAREILDVALEIYPETARFVLGSIQFNLLDEPETPTKPYNQIGTRQSLVLGGGVGGLLGMFLLGLSAFFRKTVRTPE
EMNKITSLRCLASVPQVRFKARKKKKKQKIFVLDKRLSHSYRESLKALQLRLENSMKKNQGKVLLISSTDSGEGKSTLAV
NLGELFAAQGKKVLLIDGDLRKQEDAEIIGIRDGAGLQDVVIEDKEATEMVQKIKENGIWFLGSRRPVKQPASILSSFRV
REFILAMKEEMDYVIIDTPPCEIFQDAGILADYADNILYVVKYDYVSQRRVWEGISFLGGHSAKFLGYVFNSYPEFASEY
GYGRYGYGKYGYGRQSYGKRKIYGEGGDEND
>gnl|bykdb|A0A143XF26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=457 residues).
MNQELFRFDEISIRGLCLELFRNLWMILLIGAALWLGVTGLHNLTYKPQYTSYSTLVVILKGQDSAYSSLSVAKQMADVF
GIVFQSEVLREKIIEDTGENIQGTINCEPVSETNLLVLSSTCQNPRQAYLFIHSALKHYEEVAKDVFANATLQIVQEPEV
PSTPSNTSLFMDRRSLITGAGVVAMTAIMCLFYILRFTVKNLISARRLLDGKIRGVIPYERKRISGNRRWVKKALLLNSP
SVSMDFAEASRRAETQIEYHMRRNQQKILLVTSISENEGKSTVAANIALALAEKHKKVLLVDSDLRKPAQYKVFEEDQKG
RDSLNQLLKEKGDWREKIYYNKISQLWELFQFHSVEEPAAVLSGAFLEKLAGEWKKEMDYIIMDCSPVSISTDAEHLMKM
ADTVLLVVRQDWSDVRVINDTVDMIWQSGCDFSGFVLNAFYKEWIQTGYSYEGYERG
>gnl|bykdb|A0A143XH99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=234 residues).
MQKVDVTSKYSDNYQVNEAFKALRTNILFCGSDIKVIIVTSCQPSEGKSSVSVETAISMAQMGKKVLLIDADLRKSVMAA
KYHIGSEVKGLSELLSGLATLEQVLCATTTENLHMIFSGPVPPNPAELLGGKQIQVLLENLRDVYDYIIIDSPPLGSVID
SAVVAGFCDGAILVVAADRIKYSFAQGVKEQFEKSGCKILGAVLNRVEMKKSAYGKYYSGHYGRYYGKSASPYK
>gnl|bykdb|A0A143XPH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=497 residues).
MSQRRIEKRQVGQTMQIYDNETKTNDTQEYIDIVKVLDEIWTEFLRHLGSITILFFLVVILVCSYSWFGYEPMYEAYSTF
VVSSNQTTEADIALAARLANSFEHAFTDSGLRDKIVDELRMDWEDDFKVDVSATTLEDTNFITITVNSDDGIIAQTILEL
IEENYPDIAKQIVGNITLTSIDATGILTEPTNPFSWITIILQGSLAGLVVIVVILYIYVSNKKTIHSAGDIKRHLNASCI
GTVPITSFKKRKKNADPLLVITNDRVQQSYKEAIHTLRIRIERVMEKEEKKVILVTSSLPNEGKSTIAVNLALSIASRGK
KVLLIDGDLRAPSVYKYFTKEQMKKKKGLSDILLNNGSIKDAVFSPSIQNLDVILGGERIEDPSEILAGEQLHLLLEEVK
KSYDYIIFDSSPAAMLSDTTAIAGIMDAVLFVIRQDYTKIQYAQEGLALLNESGILSLGCVMNYAEAGLNHYGYGYYGSR
YSKYRYSKYERYYGKDN
>gnl|bykdb|A0A147K4J4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coahuilensis p1.1.43] (length=243 residues).
MREIDDTEVTKLARKKKTTMMDSRRKLISQISPKSPITEQYRTIRTNIQFSAVDQEVRSLLVTSSFPGEGKSTTSANLGV
VFAQQGKKVLFVDADLRKPTVHYTFNVNNLFGLTTVLTKQKSLIETVQGTKIEGLDVLPCGPIPPNPAELLGSRGMEEFL
REAYETYDLVIFDTPPVLAVTDAQILANQCDGTILVVSAGTTEIEGAQKAKELLTSAKAKLLGVVLNNKSNKSTNYYYYY
GTK
>gnl|bykdb|A0A150B1P3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A150BQL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A150CGM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLFKKKQNHRQRRQLIAHQQPQSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTNVDNLYFLACGPIPPNPAELLGSKSMKELLGQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
>gnl|bykdb|A0A150D9K2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A150F8N9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus nakamurai] (length=226 residues).
MGFRKKKTRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVSGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEIYNQYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A150FSI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] paradoxum JW-YL-7 = DSM 7308] (length=243 residues).
MQNIIVFKDPKSPISEAYRNIRTNILFSNIDENLQTILITSAGQSEGKSTTIANIAASLAELGKKIILLDCDFRRPSVHK
KFNITNNKGITDILLNNYDYKDCIQRIVEGFDIITCGQIPPNPSEIISSNKLKRLVEDLKKDYEYILIDAPPVGIVSDAA
ILSTFIDGVILLASCGETQIEHIKKAKETLENVGAKILGVVLNKLEVEKNRAYGYYAYYYQDEENTKGKGAKNTKGKRAK
KKK
>gnl|bykdb|A0A150KCA4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans] (length=231 residues).
MAPKKTKLLNTRRKLISKLNPTSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTITGNLAVVFAQQGKRVLLV
DADLRRPTVHYTFGMTNTFGLTTVLTKQGTLLETVAKCDVENLHVLTSGPIPPNPAELLSSKAMKEFFKEAKEQYDIILL
DTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVDAVKKAKELLVSANANLLGVVLNNKKTQNTHYYYYYGKD
>gnl|bykdb|A0A150M3A2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus caldoxylosilyticus] (length=231 residues).
MARSNQKQTKKLERSLITIEDPKSPISEQYRTIRTNVQFSFVDAPMRSLMVTSTGAGEGKSTTTANLAVVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETRVENLYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLI
FDTPPVLAVTDAQILAHQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKYRQGQYYYYQYK
>gnl|bykdb|A0A150M5B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldibacillus debilis] (length=231 residues).
MAKKKGKRMQHQRRGLIAKQDPKSPITEQYRTIRTNIQFSAVDQEIRSIVVTSTAPGEGKSTTIANLAIVFAQQGKRVLL
IDADLRKPTVHITFQFTNTIGLTNVLTKQASVLDAVRKTDVENLYVMTSGPIPPNPAEILASQSMHDLLVEVEKHFDYVL
FDAPPILAVTDAQILASLCDGTLFVVSSGKTERDYAVKAKELLLAANGKLLGAILNNKKEAKQSYYYYYGS
>gnl|bykdb|A0A150MNR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARKPAASIRKAERRLIAADNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTTANLAVVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A150MZI7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus toebii] (length=232 residues).
MARRDRKKIQKIERSLITMEDPKSPISEQYRTIRTNVQFSFVDKTMRSLMVTSAGPGEGKSTTTANLAIVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETSVENLYVLTSGPIPPNPAELLSSKTMEQCMQQLYNEFDLLI
FDTPPVLAVTDSQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRYK
>gnl|bykdb|A0A150NAZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARKPAASIRKAERKLIAADNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTRSGEGKTTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A150W8N4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus maritimus] (length=231 residues).
MLKQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAIVFAESGKKVLLV
DADMRKPTLHHTFHLNNHMGLSNLLIGKGELEQSVRDSGIQGLELLTSGQIPHNPAELLDSPMLDRLIEKMKERYDLIIF
DSPPILSVSDSKIMANKCDGTVLVVNTGKTEKQSAIKARDSLTTSKAYIVGVVMNNYKLSKDHYYSYEYNY
>gnl|bykdb|A0A150W912 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus maritimus] (length=232 residues).
MAKKKQLQQTARKVVTYTTPRSFVSEQFRTLRTNVNFASPDVELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLVD
GDMRKPTTHYTFHMPNTIGLSNVLTRQATVENAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLIADLKKRYDVVIFD
APPVLSVTDGQVLANKCDGAILVVNSGTTEKEMAAKAKEAIEASNSKLIGAVLNNFVLAKDSYYYQYYGNAE
>gnl|bykdb|A0A150Y6F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. DSM 100440] (length=230 residues).
MKEIALNLKSMQDYRINESYKQLRTNIEFSGEENKIIAVTSCTPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLTG
RYKISGEMKGLTHFLSGQGDLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVID
SAIVSAVCDAAILVISANTISYKFARSVKDQLAKTGCNILGVVLNKVSMKQNKYYGKYYGKYYGHYGSDK
>gnl|bykdb|A0A150Y6N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. DSM 100440] (length=501 residues).
MAEKNGYQKVDSGSYRKLDGDDVIDLGTLFWNIIQGFLKFWWLVILLMAIGAGAFYLKASRIFYMPMYQSSATFTVLTGG
ASTADSGNGTYNFYYDTTTAGQLARTFPYILSSSLLTDAIKEDLGVEAVNGSISAQAISESNMITMSVISQSPEDAKAIL
ESAIKVYPDIARFVIGDTRFNIIDEPTMPDEPYNKPSYRAQIKKGGLYGAGAGILLICLYAFFKKTVQKPEELKSAMSLT
CIANIPEAPRKLRKQKDQRWIRMKDDRTPQAFKENIQSLQIRISRELEERGGKLLLITSTMPEEGKSTLAYNLAAAAASH
GVKVLFVDADLRKQEDRKHLTGEIGRGLASVVTGKCTLEEAVRNEEETGIDFLGGSRPIKKVQQILNHSRFEAVLQEMKE
RWDLIILDAPPAEMFEDASILAERADGILYIIRYDMVQKRRILDCIQGLEDAKAPLLGYAFNGIPVHRGGYGYYGYGRYG
YGYYGYGSYSYEDRKKRGAHD
>gnl|bykdb|A0A151A3H8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus kloosii] (length=228 residues).
MAKKKRTVSPLYVHDKPKSTISEKFRGIRSNIMFSNPENEISSLLVTSEKPISGKSTITANIAVTYAQAGFKTLIIDGDM
RKPTQHYIFDINNNYGLSNLIINKATYSESIKETKVENLAVLTSGPTPPNPSELIASNNFNNIYNELLNHYDFIVIDTPP
INTVTDAQIYAQIVGNCALVIDAEKNNRNEVKKAKDLIGKSSGKLIGAILNKMPFDKTSSYYYYYGED
>gnl|bykdb|A0A151A429 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus kloosii] (length=228 residues).
MFKKTVKNTSNLFVHHNPKSVISEKFKTIRSNIMFSNATKSILITSEKPLSGKTTISSNIGVTYAQAGYRTLIIDGDMRK
PSQHYVFNLSNSAGLSNLIINKATYKEAIKSTEIENLHVLTSGIVPPNPSELIGSKRFIEIYKTLEEIYDFIIIDTPPIN
AVTDAQLFAQVAKHSILVIDVQRNDRDEVKKAKDLLDAAGAKIIGAILNKASLDNTSDYYYYYGKDKQ
>gnl|bykdb|A0A151AK51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium colicanis DSM 13634] (length=232 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKDIKTILVTSSGPSEGKSTTTGNLALTMAQSDKKVLIVDCDLRKPTVHKKF
SISNEKGLSNYLIGEVELDDVIVKYSENLYLLTSGTIPPNPAEMLSSKKMKEFLDLMKEKFDTVIIDSPPVLAVTDAQIL
STEVEGVLLVAASGQTEKEALIRAKELLLKVKANILGVILTRVPQDSGKGGYTYYYYYGDGDDNHKKRRKKK
>gnl|bykdb|A0A151B3D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium tepidiprofundi DSM 19306] (length=234 residues).
MLIVEKNPKSYISEAYRTLRTNIKYSSYDDEIKSILITSTSPYEGKSVTVSNLAVSMVQDGKKVLIVDCDLRRPTIHKKF
GISNLNGLSNYLVGEISFEDAIVERGENLYIMSSGIVPPNPSEMLSSNKMKEFLNFKRDEFDLIILDSPPVLAVTDAQVL
STMVDGVILVVESGKTEKEALVKSKEHLDKVKANIIGVVINKIPVNKGKGYGYYYYYYYEHEKDYRKRRKRSVK
>gnl|bykdb|A0A151G0P6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTILVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A151G3Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNSGYGYYSDE
DK
>gnl|bykdb|A0A154B0T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. GZT] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKNIHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERFDKCVQKTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAK
>gnl|bykdb|A0A158LLW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae GA49447] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|A0A158RSW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A158SMM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=250 residues).
MGLFKHRYTKSTDTMNNGVMLITLADPKSGPAEQFRTIRTNIHYMSVDRPLKTVAFTSSGKSEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLNNQKGLTTVLTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLIKGL
REAYDIVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYG
YGYGYEGDEE
>gnl|bykdb|A0A160H5Q6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSEHLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A160IQQ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus phosphorivorans] (length=233 residues).
MSRKLKKSIGDLTQRSLITHRNPKSPIAEQYRTIRTNIQFSSIDKELKTLMITSSGPGEGKSTTVANLAVVLAQQEKRVL
LIDTDLRKPTVHYTFKVSNIYGVTSILTRQTTLRETIVSSKIPNVDVLPSGPIPPNPSELINSKSMNDLIEEASRMYDYV
LFDTPPLIAVTDGQLLAHHVDGVILVVSSGKTEIESATKAKELLENANAKIIGAVLNEKAARKEKYYYYYGSN
>gnl|bykdb|A0A160LH46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. israelensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A161QKR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus trypoxylicola] (length=233 residues).
MYKLARRELKSPTKKRALIANERPKSPITEQYRTIRTNIEFSSVDQELKTLLVTSSGPGEGKSTTAANLAIVLAQNGNDV
LLVDTDLRKPTVHHTFGILNTRGLTNLLMKTEVIEDVIQTSKVERLSILPSGPIPPNPAELLNSKTMELTLESFKSKYDI
IVLDTPPVMAVTDAQVLGNKVDGSILVVSNGKTDRNQAVKTKELLSQTSSKLLGVVFNNKEVKKGNYYYYYGE
>gnl|bykdb|A0A161WDE2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium magnum DSM 2767] (length=237 residues).
MEKPDIISVKSPKSPIAEAYRTLRTNIQFSSFDNKIQTIVVTSSGPGEGKSTTASNLAVVMAESGSKTILIDCDQRKPRL
HKVFLTTNERGISDLLVGKVKFEEAVQETKVPNLSILTSGTRPPNPSELLGSSKMRAFIDALKERYEYIIIDTPPIIAVT
DAQLLASHADGSLLVIASSQAEREAAVKAKELLQKVNAKILGVVLNKLEVQEKGYYGYYYHYYYGNDGGKKKKKKGK
>gnl|bykdb|A0A162G753 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPTSVITEQIKTIRTNINFAATDKNLRTLMVTSSMIGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHTTFGLENHKGLSSWLANQMDNVNDAIHPVIGNLFVMTSGPKPPNPAELLESNKMKEFLTSATRKLDLV
IVDAAPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYSSGYGYYSDE
DK
>gnl|bykdb|A0A162G8A0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=239 residues).
MALFKKKKQLDSSSMKNGVGLITVTKPTSSIAEQFRMIRTNVQFSSADRQLKTLLFTSADPSEGKSTISSNVAVTWADQG
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPANKVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYGTDDKK
>gnl|bykdb|A0A162JEX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium coskatii] (length=239 residues).
MEKPDIITVKNPKDPIAEAYRTLRTNIQFSSFDKKIQTIMLTSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRL
HKIFLTSNEIGLSDVLAGKVEFEDAVKETVIENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVT
DAQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYHYYYGSDGTKIKKKEKRKK
>gnl|bykdb|A0A162RDJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium magnum DSM 2767] (length=257 residues).
MENIDIITIKNPRSPIAESYRTLRTNIQFSSFDKKIQTIVITSSGPSEGKSTTSSNLAVVMAQNGNKTILIDCDQRKPKL
HKVFLTSNQKGLSDLLVGNSVFEEAVEKTEIENLDILTSGTRPPNPSELLASTKMKNFIENLREKYDCIIIDTPPVIAVT
DAQIVSRYADGCLLVVASAQAEREAAMKAKELLVKVDAKIIGVVLNKLDIKEKGYYGYYYTDYSDEGEKKTVKRRSRKNK
KQRLSLSFFSRLKKSVN
>gnl|bykdb|A0A162RDU1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=237 residues).
MALRKNRGSRMQRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALATCKSKLLGAIMNGKKLSKHSEYGYYGTKDNFMQK
>gnl|bykdb|A0A163IZH1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus marisflavi] (length=223 residues).
MSTRRKLVTHDNPQSPISEQYKTIRTSINFSSIDQQIRSIMVTSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPT
SHYTFNVTNTFGLTSALSRQKTLREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAV
TDAQVLANKCDGTVLVLSSGTTEVDSAKKAKELLDTTNGKLLGVILNNREIKDTSYYYYYGKK
>gnl|bykdb|A0A163XF05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 15] (length=232 residues).
MARSNRQQFKRLERSLITAEDPKSPIAEQYRTIRTNIQFSFIDRPLRSLIVTSTGPGEGKSTTVANLAVAFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQVTEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQVLANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A164AFP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aeribacillus pallidus] (length=232 residues).
MAPRAKGMKQKQRTLITALNPKSPISEQYRTIRTNIQFSSVDHEIRSIMITSTGPGEGKSTTAANLAVVFAQQRKQVLLI
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDHYDIVII
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLLSAKSKLLGVVLNGKPQKDSHYYYYYGGKN
>gnl|bykdb|A0A164M5B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLQFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A165H699 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bhargavaea cecembensis] (length=238 residues).
MARRKKSSKKQLEQRARKLVVAANPRSVVSEQFRTLRSNITFSAVDKEMKTILVTSALPGDGKSTISANLATLFAQDGKR
VLFIDADMRKPTVQYTFSLTNAAGLSTVLTQQRLAGEVIRESEISPNLHIMTSGPIPPNPAELLGSRSMAVLMNEMAQQY
DLIVFDAPPVLSVTDAQLLANKVDGTLLVVNTGVTEKENIEKAKEQLGNAQARILGAVMNNFEMDKDHYYYQYYGTEE
>gnl|bykdb|A0A165MJW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMRVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A165PSY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNIATTAPINLTTINEPMSVITEQIKTIRTNINFTATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYNIGYGYYSDE
DK
>gnl|bykdb|A0A165QRX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus elgii] (length=226 residues).
MSKSAKRRPVIAHSHPKSPVSESYRTLRTNIQFSSVDRLCKTLMVTSSSPMEGKSTTINNLAVVYAQSNKKVLLIDADLR
KPTAHHTFHLSNRYGLTDMLTSQCTLDMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPV
LAVSDAQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGNE
>gnl|bykdb|A0A165R6Z3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=226 residues).
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVTTRKLDLVIVDAPPILPV
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A165S7H4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEKNIATTAPINLTTINEPMSVITEQIKTIRTNINFTATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYNSGYGYYSDE
DK
>gnl|bykdb|A0A165VAR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=229 residues).
MTNMSTSIQLTALTAPMSVVTEQIKTIRTNLNYSMVGKPLKTLMITSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLR
RPTIHQTFGVSNQRGLSSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPV
LPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
>gnl|bykdb|A0A165VCE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPTSVITEQIKTIRTNINFAATDKNLRTLMVTSSMMGEGKSTVSCNLAVEYAKEGMQVL
LVDADLRRPTIHTTFGLKNHKGLSSWLANQMDNVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAAPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVDSLKKAQANILGAVLNDVRNGSHHGYYGYNSDHGYYSDE
DK
>gnl|bykdb|A0A165WR08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aeribacillus pallidus] (length=232 residues).
MAPRAKGMKQKQRTLITALNPKSPISEQYRTIRTNIQFSSVDHEIRSIMITSTGPGEGKSTTAANLAVVFAQQGKQVLLI
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDQYDIVII
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLIAAQSKLLGVVLNGKPQKDSHYYYYYGGKN
>gnl|bykdb|A0A166AYJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus badius] (length=234 residues).
MVLKKQKHKSLGQTKRKLITDVDPKSPISEQYRTIRTNILFSAVDRDIQSLLITSAGPGEGKSTTAANLAIVFAQQGKDV
LLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKSISTAVKETEIQNLSVLLSGPIPPNPAELLGSRVMAEFLQEACRLYDL
VIFDTPPVLAVTDAQVLANQCDGTVFVVNSGQTEVDSAVKAKELLQAAKAKLLGVVLNNRKIKETNHYYYYGNK
>gnl|bykdb|A0A166FN74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus collinoides] (length=244 residues).
MALFRRKKKQSDDSIINGVKLVTAVEPKNVVSEQFRTVRTNIDFSSVDKQIKTLLFTSSGMSEGKSTVSANTAVTWAQQG
KKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAELLNSNRMKRLLDSVEAE
YDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMVPRDGYGYGYGYGYGYG
YGHE
>gnl|bykdb|A0A166HK45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus collinoides] (length=243 residues).
MNIFHHQRKKLSTDTLRNGVKLITDVDPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKVLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDIDFNSVVQKTEIDDLSVITSGPIPPNPSDLLASNRMKELIFYFKT
TYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYDN
KHE
>gnl|bykdb|A0A166MVD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=226 residues).
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTKFLTVATRKLDLVIVDAPPILPV
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A167GCZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus crassostreae] (length=229 residues).
MRRSINNSGLIASVNPESPISEVYRLLRTNIHYSSIDQALKTIMVTSSQAGEGKTTTISNLAITYAQEGRNVLLIDMDMR
KPSLHRIFSQPNHHGLSTVLTGQTSVQDAIHETMINQLSLLPSGPVPVNPSDLIDSIAMREMLDQLIHQYDIILMDTPPV
LAVTDSVIASTLCDGVIMVVAAGKVKKVHLKKAKEQLDHVNARMLGVVLNRINRDDQPDFYMNYYGMKG
>gnl|bykdb|A0A168B4Z3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis] (length=229 residues).
MRQSATKPKLIMNINSRSPISEGYRNVRTNIQFSSWKQKLQVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLANKMGLSNILAYQCSADELIRITDIDNLSIVTAGPIPPNPTELLSSGRMHEVVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVLNNKKLNKSESNQYNYYSHLD
>gnl|bykdb|A0A168DR31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis] (length=229 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNESDSYSYYYGEKNDA
>gnl|bykdb|A0A168IKM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis subsp. defensor] (length=224 residues).
MRQSINKSHNLVTSIRPKSPISEAYRTLRTNILFSSVDDKIRTIMVASAQAGEGKTTTVSNLAIAYAQEGKKVLLIDTDL
RKPLLHQVFNISNYAGLTNVLTNQYELQDVVRETLIDHLDVITSGPIPPNPSEMLSSRKMKTVLDEVKDLYDVILFDTPP
VLAVTDALIVSSLCDGVILVVSTAKKGLVKKAKANLEHVNTRFLGVVLNNVTMGKEIPYYYGES
>gnl|bykdb|A0A168IZS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis subsp. defensor] (length=229 residues).
MRRSATNPKLIMNINRRSPISEGYRNVRTNIQFSSWKHKLKVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLTNKMGLSNILAYQCSSDEVIRITDIENLSIVTAGPIPPNPTELLSSGRMHEIVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVLNKKKLNKSESNQYNYYSHLD
>gnl|bykdb|A0A168JW46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus antarcticus] (length=230 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVNAKILGVVLNNINRNHSDSYSYYYYGEKNDA
>gnl|bykdb|A0A168K545 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis subsp. defensor] (length=229 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSNQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNDSDSYSYYYGEKNDA
>gnl|bykdb|A0A168NYT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus glacialis] (length=229 residues).
MRRSINDSSLIVSMNPESPISEVYRLLRTNIHFSSIDQALKTIMVTSSQAGEGKTTTISNLAITYAQEGKNVLLIDMDMR
KPSLHRIFSQSNRQGLSTVLTGDTSVQDAIQETMVSHLSLLPSGPIPGNPSDLIDSTAMREMLEQLQQEYDVILMDSPPV
LSVTDSVIASTLCDGVIMVVAAGKVKKVHLKKAKGQLDHVNARLLGIVLNRMNRDNQSNFYMNYYGMKG
>gnl|bykdb|A0A168PU73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus antarcticus] (length=229 residues).
MRRSANNPKLIMNINRRSPISEGYRNVRTNIQFSSWKHKLQVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLTNSTGLSNILAYQCSADEVIRVTDIDHLSIITAGPIPPNPTELLSSGRLHEIVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVINKKKLNKSESNQYNYYSHRE
>gnl|bykdb|A0A172TH66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus swuensis] (length=230 residues).
MRQSTSNQILITESNPHSPISEAYRSLRTNIQFSAIDTSVQVVMVGSAVPGEGKSTTAANLAIVYAQEGKKVLLMDCDLR
KPTVHARFAVHNRNGLTNVLSGNFTAKDIYRDTGVENLTVITSGPIPPNPSEMLASKKMTSLMEQFREEFDMIVLDTPPI
LAVTDALIVSSFSDGVLLVINSTTTKRSLVQKAKSSLDHVHANMLGVVLNNKKRADADTEYYYYYGADAK
>gnl|bykdb|A0A173QTL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNTYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPRAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSIPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A173RAN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFRELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCKFEESKYGHYYGNYYGNYYGNYYGRDEDE
K
>gnl|bykdb|A0A173RVC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia hydrogenotrophica] (length=227 residues).
MQAKIVLPNEELEYGAAEAIKTLRTNIMYSEDVKAIMLTSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRR
LGIQEKIQGVSEYLSKQSMKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAI
ISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKYYSYEYKKEK
>gnl|bykdb|A0A173S539 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSISLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYSYYGESDTEKNHPNT
>gnl|bykdb|A0A173SFJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus eutactus] (length=250 residues).
MKKLNIEFQELPYAVEEAMNRLRINIKFCGKNTRKILITSSMPNEGKSSVAINLWKMLAEAGFPAVLVDVDLRKSVIKDR
HHIKDADKLPDLGYFLSGQSEMEDVIYETQVENAYIVPCMNLLENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAALVVRAGETSRSLIKQSFQQLDQVGCTLLGVILNRAQTTGRAYKKYYGKYGKYYSQYGYGYGTYGKEA
AAASDSTPSK
>gnl|bykdb|A0A173SH42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
RIRAKLESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
N
>gnl|bykdb|A0A173SIU2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLTPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYSYYGESDAEKNHPNT
>gnl|bykdb|A0A173T2J7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sanguinis] (length=238 residues).
MDNALITVHQPKSPITEAYRTLETNLNFSSLDREMKTLTITSPGASEGKSTTSANLGMTFSQTGKKTLLVDCDLRCPRLH
QLFELPNVKGLSQVLCLKESLDEMKQSINEHLDVLTTGPLPPNPVEFLNSKGMQTFIKEVREQYDRIIFDTPPVGILTDA
AIVGAHTDGTLLVVATGKSDIELTLKSKENLNNVKANLLGVVMTMMPIQSKQYYHYYHSYGLDVKKPKRRFGFRKAKA
>gnl|bykdb|A0A173TJV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=484 residues).
MENNRENASAQTETEFEPISLVCDILKNWWVILLGALAGAMLFYVASSLKYVPNYHTQATFVITSRANANAYNNLSSANS
MAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKDSIDIIKTVMDNYTSISYYTVGTTVLDV
LEDPKIPYAPVNPPQNGEMAKKGFFLGMAVCMLLFAIWSYMHNTVKQEREVEKKLDARSLGAISYEWKYKTIKEWIKHRK
KAVLVDNPLASFRFVESFKMLAARVEYHMSKINGKILVVTSVCENEGKSSVAGNLAITLAKKGKRVILIDGDIRCPAQYL
LLGMSPKKENELGEFLNGRTGANNILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIG
DAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYSRYGRYGRYGKYTN
NKEV
>gnl|bykdb|A0A173TLV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
>gnl|bykdb|A0A173U1X9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus comes] (length=237 residues).
MKKVNLSIEKKSYGVRESIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESERFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKVKYRLVQNVKDQLENSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEDYYGHNEETKNA
>gnl|bykdb|A0A173UW43 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPRAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A173V3I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium ramulus] (length=239 residues).
MQELILEEKTTLSPVMKEIYRRLRTNLEFTGIENKVICLTSCMENDGKSSVSFNLAKILAENDKRVLFIDADMRNSVLMN
RTGIPDDLKGLSHYLAGKNAASEVIYATNYKNFYVIPTGRFPKNPTELLNKPAYEVLIEGMKQTFDYVIIDTPPLGSVVD
AALIAKTADASVLVISANAVSRRMANSVKEQLINANPNFLGVILNKADEGTKHYGYGKRYGSKYGYGYGYGRYGQNPKE
>gnl|bykdb|A0A173WD57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=234 residues).
MKEVNIYRQELDYSANESYKSLRTNLLFCGEDKKVIAVTSCTPNEGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTEKK
>gnl|bykdb|A0A173XUJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=240 residues).
MVKSKKKESSFKTYKKILGKDSSFKLKEAYSKIRTKLMFTENEDGGTVYAVVSTDMNEGKTLNSINIATSFAMAGKRTLL
IDCDMRNPAVHCYLRLSEVSGLSEILARIEKKINIVHTEQENLFVLKAGVVPPNPSELLGGRLFGELIAQFRKRFDYIIL
DMPPVGVVADAAIVSSYVDGYVFVVRTMYKDLGEIRKAMEMLQSVQGKIAGFVLNDVEGKNDTDHTYGKYGYDYGSRNNE
>gnl|bykdb|A0A173Y3J1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=472 residues).
MSKDYAEHRENRENLIDIAGLFDDLVKVAFQLKFKFLITIIVCGVIFCGYKRFTYSPYYIASSTFTISSSISSENSNTYI
ENATANQMAKSFPYILQSGAFKQVLAEDLGMQSVPGTIEAEVMENTNLFTLKVTESSPELAQKVLESVVKNYPSVAEFVI
GSSQLTLMDESGVPTAPANPFSYKHELEIGAAIGILLCVFLDVLLALGKNTVKKEEDFKRLFHVDSLGVLPHAKFHKKRT
QVEELIVLDNPRLPRSFLEASRTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMQEQELGTLQVLKGEVKIEDAVQPYKDTSVMVLAGSSPIQDTSTVLSGENMRQFIKELEAKADFVVIDTPPSAM
LSDAAIVAQYVDGAVFVIRQDYTEADRILEGMEILSSSGAQITGCILNDANVKGNSSQHYKNSYRLKGEVKV
>gnl|bykdb|A0A173Y428 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=235 residues).
MKKVTMNLPEVKDYRLTEGLNQLKTNLAFCGKDIKVIIITSSVPNEGKSSVAFDLSKTMAEGGKKILMVDADLRKSVLAA
KYHIQGIDKGLSHYLTGQAEIEDIIYETETEGFYLSVAGPLSPDPTSLLDSDQFQKFIDKVREDYDYVIIDAPPLGVVID
AVIIGKYCDGAVLVIEQGVIKRKVVQDVIKQLKRGEVRILGAVLNKVDERIGAYGAYDYKYSYSYYGDSDAEDRH
>gnl|bykdb|A0A173YTJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sanguinis] (length=238 residues).
MSSELITITNPKSPIAEAYRTLRTNIQFSNVDEDLKVICVTSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVH
KVFKISGTRGLTNLLAGQLSLEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELIANLRQQYDVVIIDAPPVGVVTDS
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYSYEEEAQPTRKKRSFFSKV
>gnl|bykdb|A0A173Z681 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEVIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYRRSDEEAQIK
>gnl|bykdb|A0A173Z6F0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus comes] (length=237 residues).
MKKVNLSIEKKSYGVREAIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLENSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYYGHNEETKNA
>gnl|bykdb|A0A173ZEP4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus eutactus] (length=250 residues).
MKKLNIEFQELPYAVEEAMNRLRINIKFCGKNTRKILITSSMPNEGKSSVAINLWKMLAEAGFPAVLVDVDLRKSVIKDR
HHIKDADKLPDLGYFLSGQSEMEDVIYETQVENAYIVPCMNLLENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAALVVRAGETSRSLIKQSFQQLDQVGCTLLGVILNRVETTGRAYKKYYGKYGKYYSQYGYGYGTYGKEA
AASSDSTPSK
>gnl|bykdb|A0A174A2W9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPHAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFIKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A174AMP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=240 residues).
MAEQKVIMTDPRQEDYFYQEAIKTLRTNIQFAGMDVKTILFTSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSIL
ASRYGVGKQVQGLSNYLSGQASIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSI
IDAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYDYYYHGYQEKKEVTKKNKEK
>gnl|bykdb|A0A174B337 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYRRSDEEAQIK
>gnl|bykdb|A0A174BC88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=236 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGMIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYYGESDTEKNHPNT
>gnl|bykdb|A0A174CVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=266 residues).
MQKVEFKKIPQLDFRTNEAFKTLRTNITFCGDDQRVILFTSTVPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
HYRVDRETRGLSHYLVGQESAENVTYNTNIENMEVIFAGPSTPNPAELLGNVRFEEMLGEQRGNYDYILIDTPPLGSVID
AAIIARNVDGAVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVDQENKGYYSGYYSKYYGKYYGYGASGSSDKAEK
SEQNTEVNTVSVSSEEKQAKRSRRRK
>gnl|bykdb|A0A174E477 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=231 residues).
MFITKKMPKSLSAEAYRSLRTSIKFSSVDRPIKTLVVTSSIMGEGKSTVAGNIANILSQDGARVLMIDCDLRKPSMHYNF
FVTNGEGLTDLLVGNSDLKSVMKKVDDSLFLITAGTVPPNPSEILGSHGMEKLLEELSVNFDYIVLDTPPVLPVTDALLL
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNGCDKSIDNKYYGYYGDFKKHKEKKFKIKRK
>gnl|bykdb|A0A174F3S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=521 residues).
MVTVTDTAPIAGQNDEREQKSMNRETYETYSAAEPEKIDLIAFLAEYFQAFQKFFFGVLALVILAGGGSFLTAKLRYQPV
YEAYTSFVVGSNRAVGYSYYDNVTAEQLGKTFPYLVTSGVLKDVVARDLGIGAVTSEIQASVMENTNLFTIRVRDASPET
AYRVMKSVITNYPEVAEYIIGATTLTVVDESGVPAVPVNSQDALRAGTYGAAAGLAAAFLLLFLYVRTRKTIHWADDIKK
LTNAAFLGNLPQAKIKKRSSVKEQTITICNPKVPDAFKEAVQLIRTRMENRIIGKSDCPVLLVTSAVPGEGKTTVAVNLA
EAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQMDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMK
TMIESLKEEADLLIIDTPPCGVLSDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQVPVCGYVLNGVQEGTTGYG
YSSYGGYGYGKYGYGYGKYGYGKEKERRNSDRTAREQGGKA
>gnl|bykdb|A0A174F9H9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalicatena contorta] (length=233 residues).
MQEIVLKGMDKDFRSNEAYKTLRTNIEFSGADNKVIVFTSCTPNEGKSTVSLSVSSSLAEAGKKVLFIDADLRKSVLAGR
QKLTGAMKGLSHFLAGQAEVGDIMYKTQKAGLVVMFAGVVPPNPAELLGHKRFENLISSARKVYDYIIIDAPPLGSVIDS
AIIAKQCDAAVMVIASQAISYKFAKNVKKQLEKSECPILGVVLNKVDMKLNQYYGRYYGRYYGKYYGNYGNEE
>gnl|bykdb|A0A174GB62 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira pectinoschiza] (length=309 residues).
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
DKSFEKARKASSARKNTNNASKPVKRQAGSVGEVAARKKANAAGNNTGVRKKPSADEFDGDFLMDYDEK
>gnl|bykdb|A0A174GBQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQSRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
>gnl|bykdb|A0A174GPG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia wexlerae] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYHRSDEEAQIK
>gnl|bykdb|A0A174GUR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=228 residues).
MLVVNKLPRSLSAEAYKALRTNIKYASVDKKLQTIVVTSSQPGEGKSTVAGNLAYTLSKDGARVLLMDCDLRKPTLHKKL
DLINEKGVTDFLVHKCDIKLSIHEVEDNLFVMPSGSRVPNPSEILGSRAMEEFLNDLKRAYDYIILDTPPVIPVTDGLIL
AGKADGTILVARSRKTQERILKQSYRDLTNIGANIIGSVLTDLENTRYDKYHEYYGTGRMGFRNRKRK
>gnl|bykdb|A0A174H2B5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira pectinoschiza] (length=232 residues).
MQTINIERLRKLDYRANEAYKNLRTNIQLCGSDIKVIMLTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
>gnl|bykdb|A0A174HZ21 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium symbiosum] (length=257 residues).
MHDEIVIEDLISPDERGMGELVLKGFEVNDYQYEEAMKTLRTNIQFSGSNIHAVMFTSSAPNEGKSETTFQLAASMAQLG
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
YGYGHENAKQGKEAKVL
>gnl|bykdb|A0A174HZA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium symbiosum] (length=233 residues).
MDNEVFLKRTAIEDYQYNEAMKTLRTNIQFSGTGIQVVMLTSSVLGEGKSETTFHLAASLAQLDKKVLLIDADIRKSILV
TRYQLDRRVDGLSQYLSGQKKLEEVVYKTNLPNLTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLI
DGAIISRNCDGAILVIESGNISHRLLQKVKGQLEKSGCRILGAVLNKVDVRQNSYYYYGKYGKYYGKEYSSEH
>gnl|bykdb|A0A174IF23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] clostridioforme] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGNGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMVDADIRKSVLV
SRYHLEREVSGLSQYLSGQRSLENVLYDTNIENLSIIFAGPYSPNPADLLEESLFGDMISKLKEKYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMKRNGYYSKYYGKYGKYSKYGHYGKYDRYGK
AEA
>gnl|bykdb|A0A174ITE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=217 residues).
MFIVEKSPKSVAAEAYRALKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAKGEAKVLLVDCDMRKPSVHKNF
RITNTYGISDILLQKKKVTEVAYSYNKNLSIITAGKVPPNPAEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADAQIL
STKTDGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYGNE
>gnl|bykdb|A0A174IWY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] hallii] (length=245 residues).
MKKLNLKIKDMPYAAEEALNRLRVNIKFCGKNTKKIVITSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKK
YQVEGIKEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYNRYGKKYGDYYGAYYGGNTTEKK
AGIKE
>gnl|bykdb|A0A174J2H4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLIVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVVYATNIKGVFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
K
>gnl|bykdb|A0A174KA18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=234 residues).
MKEVNIYRQELDYSANESYKSLRTNLLFCGEDKKVIAVTSCTPNKGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTEKK
>gnl|bykdb|A0A174KXI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=229 residues).
MFVVEKKPKSVAAESYRTLRTNIQYSSFDKEYRTIVITSSEPGEGKTVTSGNLSLALAQGESKVLLVDCDMRKPTIHKNF
KISNQDGLTDLLLHKKTMEQVMVKYNENLTIIPAGRVSPNPSEMLGSRAMSAFLEEMKNHFDYIVMDTPPLGAVTDAQVL
STKVDATILVVKAGDTKRDVVMNSVNLIKKVNGNLIGTVLNGVEKSNNKYYYYYGSEEVAATAEKKKRK
>gnl|bykdb|A0A174L547 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus comes] (length=237 residues).
MKKVNLSIEKKSYGVREAIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPKAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLENSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYYGHNEETKNA
>gnl|bykdb|A0A174LG87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Catenibacterium mitsuokai] (length=290 residues).
MKGALASGAVLVFILALYYFFRDTVKSDKEAKQKLNARLYARIPFEKKKKRNPFKKNRKAILITSLKTSFFYRESINKLR
SKVEASSQKHGYTSFMITSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLNNAIEGKAHWKS
QVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATLFIVRQDYAEKD
MINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTKGGE
>gnl|bykdb|A0A174LKL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=493 residues).
MSRETYETYSAEPEKIDLIAFLAEYFQAFRKFFLGVLILVILMGGGSFLTAKLRYQPMYEAYTSFVVGSNRAVGYSYYDN
VTAQQLGKTFPYIVTSGVLKDVVARDLQVGAVTSQIEASVMENTNLFTIRVKDSSPDTAYRVLQSVITNYPEVAEYIIGA
TTLTVVDDSGVPVSPINSQDAVHAGMIGAAAGLAVALLLVFIYVRTRKTIRQADDVKKLTNAAFLGNLPEAKIKKRSNVK
EQTITICNPKVPDSFKEAMQLIRTRTEDGIGKADCPVLLVTSSVPGEGKTTVAVNLAEAFAKKKYRVVLLDGDLRNPSVL
KCIGLSERKGRGIIGVLKGQISLDEALTDYRDLSLKILPGVGSTQNPAGLLRSARMKTLIEELKEDADLLIIDTPPCGVL
SDASLLGGIADSAVLVVHQGTTKDREVQRALEFFEDSQIPVCGYVLNGVPEGATGYGYSTYGGYGYGKYGYGYGKYGYGK
EKEGRKSNQSVKE
>gnl|bykdb|A0A174LN64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=233 residues).
MNQVVVKQEKSGYQIVEAYKSLRTNLQFCGEDKKVIAVTSCTPNEGKSSVSMQLGISLAESGKRVILIDADLRKSVLLGR
TKTQKSVRGLAHFLSGQATLEDVICSTNVKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVIDS
AIVAEICDGSIMVIESGVISYRFAQEVKSQLERSNCPLLGVVLNKVDMQKQAYGKYGKYGQYKYGDYGQEEDD
>gnl|bykdb|A0A174M0R1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=216 residues).
MFVVEKQPKSIAAESYRTLRTNIQYSSFDKEYRTIVVTSSELGEGKTVTSGNLALALAQGENKVLLIDCDMRKPSIHKNF
RISNESGLSELLLHKKTMENISWKYNDNLTLIPAGKVPPNPSEMLGSRVMGTFLDEMKKHFDYIVIDTPPLGAVTDAQVL
STKVDGTILVVKAGSTKKDVVMNSVNLIKKVNGNLIGTVLNGVEKSKNKYYYYYGN
>gnl|bykdb|A0A174MT20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGTKGAKAVKGEGNLHSHDNKSIRESGKEKAAEEVVIAEDDMIQLDMDIVELAEDTELIEELK
>gnl|bykdb|A0A174NEJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=236 residues).
MQKVLLRKHDKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAVSFAEADNRVLFIDADIRKSVLVG
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFADLIGMAREEYDYVIIDAPPLGSVID
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGNYGEETKK
>gnl|bykdb|A0A174NGP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=236 residues).
MADVILKNLKEINDYRSNESYKTLRTNIEFSGSDKKVIVFTSCTPNEGKSTVTLQLAASLAEAGKKVLFLDADLRKSVLM
GRHRVAGEVKGLSHFLSGQVEIKDIILKTQEPNLYVAFAGVVPPNPSELLGNRRFEALLNGARQAYDYVIIDAPPLGNVI
DAAVIAKNCDASVLVVASREISYKYARVVKEQLELAGCPILGVVLNKVDLKQNKYYGNKYYSKYYGKYYGEYKKED
>gnl|bykdb|A0A174NV94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVVLVDADLRKSVLKG
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNDEEGGLH
AAVVQKGTKAAKAVKGDTGERSHEGKNGSGSGKEKGLEENGYPEDDMIQLDIDMVQLVEDTETIEELK
>gnl|bykdb|A0A174QKU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYHRSDEEAQIK
>gnl|bykdb|A0A174RA28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia wexlerae] (length=235 residues).
MKKLNLTDKRKPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCFPNEGKSDVVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQDIIYETNFPNMDIIFGGPAAPNPSGLLSENIFKVFLKEVREYYNYILIDTPPIGTVID
AAVIGRCCDGAIFLIQPGSVRYRDAQKAFAQLERSGCRVLGAVMNKIDTSSDKYYSSYYKHYGEYYRRSDDESQK
>gnl|bykdb|A0A174RPZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Roseburia hominis] (length=381 residues).
MNSKNARAYVKKKMDISSTTYTATISTQQANIINFNVTADTKKEAYYAIGYLTEWYAGSTERYNFPYAINILDESSFSTA
PVNYNSHKGNFMKGALASGAVLVFILALYYFFRDTVKSDKEAKQKLNARLYARIPFEKKKKRNPFKKNRKAILITSLKTS
FFYRESINKLRSKVEASSQKHGYTSFMITSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLN
NAIEGKAHWKSQVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATL
FIVRQDYAEKDMINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTKGGE
>gnl|bykdb|A0A174S915 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=521 residues).
MVTVMDTAPIAGQNDEREQKSMNRETYETYSAAEPEKIDLIAFLAEYFQAFQKFFFGVLALVILAGGGSFLTAKLRYQPV
YEAYTSFVVGSNRAVGYSYYDNVTAEQLGKTFPYLVTSGVLKDVVARDLGIGAVTSEIQASVMENTNLFTIRVRDASPET
AYRVMKSVITNYPEVAEYIIGATTLTVVDESGVPAVPVNSQDALWAGTYGAAAGLAAAFLLLFLYVRTRKTIHWADDIKK
LTNAAFLGNLPQAKIKKRSSVKEQTITICNPKVPDAFKEAVQLIRTRTKDRIIGKSDCPVLLVTSAVPGEGKTTVAVNLA
EAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQMDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMK
TMIESLKEEADLLIIDTPPCGVLSDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQIPVCGYVLNGVQEGTTGYG
YSSYGSYGYGKYGYGYGKYGYGKEKERRNSDRTAREQGGKA
>gnl|bykdb|A0A174SE81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=234 residues).
MNQVVVKQEKSGYQIVEAYKSLRTNLQFCGEDKKVIAITSCTPNEGKSSVSMQLGISLAEIGKRVILIDADLRKSVLLGR
TKTEKSVRGLAHFLSGQASLEDVICATNIKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVIDS
AIVAEICDGSIMVIESGVISYRFAQEVKSQLEKSNCPLLGVVLNKVDMQKQAYGKYGKYGQYKYYGEYGQEEDD
>gnl|bykdb|A0A174SQL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii] (length=217 residues).
MFIVSKDPKSIAAENYRILRTNIQYSSFDNEIKKILVTSSEPGEGKSTTAGNLALTFAQDGKKTIIIDCDLRKPTVHKKF
NISNTVGLSDVMLDYKNINKAIHNVDKNLYVLPAGKVPPNPSEMLGSKALDALLDELAKIYDVIVIDSPPLLAVTDAQIL
SKKVDGTVLVVRSNFTKKDAVLAAKEVLTKVKANILGTVLTRADEKKHGYYYYYYGN
>gnl|bykdb|A0A174SRI6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii] (length=215 residues).
MLILEKQPKSIEAESYRILRTNIMYSSFDKEIKRILVTSAEPGEGKSITSGNLALAFAHDEKKVILIDCDLRRPSLHKKF
RISNNKGLSDAIINKDKLSDFIQKRTEYLDILTAGKIPPNPSEMLGSQAMSSLLDELSNIYDVIVLDSPPVLAVTDAQIL
STKTDGTILVVRGEKTKKDTVLAAKEVLTKVNANILGTVLNGGNKNKDNYYYHYE
>gnl|bykdb|A0A174TU68 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sanguinis] (length=242 residues).
MTSMPTIISLSNPKSPEAEAYRTLRTNLQFSTVDHELQTLLVTSSNASEGKTTTICNLAVSFAQIGKKVLIIDGDLRRPR
LHTYLNVSNVKGLSNVLTHQATLEEAMKETVLDIQVLTCGPIPPNPSELLNSNRLKQLLVELKSQFDIILIDTPPVGVVT
DAAILSTLVDGTLIVVASHQTESDQAVRAMKLLNNVGARILGSVLTKVPADRKGYYGYQYYEYTQEHESKKRTRRLKKAK
AR
>gnl|bykdb|A0A174UFK0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=244 residues).
MQKVLLRKHEKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAISFAEADNRVLFIDADIRKSVLVG
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVID
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGKYYGNYGEETKK
QDKK
>gnl|bykdb|A0A174UYE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=270 residues).
MQKVEFKKLPRLDFRANEAFKTLRTNITFCGDAQRVILFTSTIPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
HYRVDQETRGLSHYLVGQESAENVAYRTNIENMDIIFAGPSTPNPAELLGNAKFEEMLCGAREHYDYVLIDSPPLGSVID
AAIIAKNVDGSVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVNQESKGYYGGYYNKYYGKNYGKYSGYGDGGSRG
RAEKSEEKTEMKTAAAGGEENQVKRSRRRK
>gnl|bykdb|A0A174V4X2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=232 residues).
MQEIELKEIKKDYRSNEAYKSLRTNIEFSGEDNKVLVFTSCTPNEGKSTVTLALAQSLAEAGKKVLFIDADLRKSVLAGR
HKVHGQLKGLSHFLSGQTELGEVMYRVKDTNMVMIFAGVVPPNPAELLGGKRFESLLTSARKAYDYVIIDAPPLGSVIDA
AIIAKQSDASVLVISANTVSHKFAKVVKEQLEKSGCPILGVVLNKVDMAQNKYYGKYYGTYGDYGRVEEGKV
>gnl|bykdb|A0A174WTS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=312 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSVLKG
RYKSNAARYGLSHYLSGQASISDIFCKTNIPNFYVIFSGPVPPNPSELLGNDAFRILLEYLRNEYDYVIVDTPPLGSVID
GAVAARYCDGTLIVIESGAISYKFAQKVTEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGKYYGNNEE
GGLHAAVVQKGLKNGKAAKGEENTHSHEIKNGSDPVKEKIPEENQIPEDDMIQLDIDMVELTEDTEPIEKLK
>gnl|bykdb|A0A174XJN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=234 residues).
MECIELDHIGQFNRQYREEIKTLRTNIGFLSAAFTMIMFTSTAPNEGKTSTAFQLAVSLAEAGKKILFIDTDIRKSVLVH
KLNLSKKINGLSQALSGQIEPNEIIYKTSKENLSIIFSGPYAPNASELLDNDVCRQLMADLKDKSKYSFDYIIVDTPPLG
NVIDAAIVSKYCDGAVLVVEADRISSRWVRRARQQLEKTGIRILGVVLNKVNPEKGSYYYEKYGNYYNKYAGYY
>gnl|bykdb|A0A174XPP4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=308 residues).
MQTVIFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSILKG
RYKTNASRYGLSHYLSGQANISDICCKTNIPNFYVIFSGPVPPNPSELLGNDAFRLLLDYLRKEYDYVIVDTPPLGSVID
GAVAAQYCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGMKGSRAVKGEGNGFPHETKGKPETEKEMGKEDTLTEEDDMIQLDIDVVELTEDMEQIEELK
>gnl|bykdb|A0A174Y0Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=231 residues).
MAIQRVMMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSY
IKRYQIKQKTNGLSQYLSGQVALEEVIYSTNYRNLEIIFSGPYAPNPSELLEQGRFSRLIEETRKAYDYVLIDTPPIINM
SDAAIVAKQCDGAILVIESEAVSRRDAMKAKDQLTKSGCKLLGAVLNKVDMKKEKYYSKYNSYYYGKSKQE
>gnl|bykdb|A0A174Y5V4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=255 residues).
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYEPKDKK
NSSDSAAADKNSTGK
>gnl|bykdb|A0A174YNA0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] eligens] (length=236 residues).
MQEFSVKQSNLDFRTREAYKMLRTNIEFSGDNNKVIFITSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
GKKGKIKYGLTHYLSGKNELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFVKMVEEARATFDMIIIDTPPIGSVIDA
AVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYYGKYYGKYYGKYYGHEDNN
>gnl|bykdb|A0A174Z985 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=230 residues).
MAIQRVLMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVTFQLAVEIGKMGKKVLIIDADIRKSNY
VKRFQVEQKVDGLSQYLSGQVNKEKILYSTNYSNVDFIFAGPYAPNPSELLEQELFSKLIEETRKGYDYVLIDTPPMLSM
SDASIVAKQCDGAILVIQNEAVSRKDALRAKDQLKKSGCKLLGAVLNKVDMKKEKYYNKYNSYYYYGSKE
>gnl|bykdb|A0A174ZLX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] eligens] (length=236 residues).
MQEFSVKQSNLDFRTREAYKMLRTNIEFSGDNNKVIFITSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
GKKGKIKYGLTHYLSGKNELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFAKMVEEARATFDMIIIDTPPIGSVIDA
AVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYYGKYYGKYYGKYYGHEDNN
>gnl|bykdb|A0A175C561 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc gelidum subsp. gasicomitatum] (length=254 residues).
MAFFRKRSQIGRDRLSTETMTKGARLITAAEPKNPVSEQFRTLRTNIEFASVAKGDVKTLLISSALPSEGKSTITANLAV
ACAQQGKKVLLVDADLRRPTVAVTFGITDNHGLTNYLADANSDIQAIIHKTSMDKLDVVTSGPVPPNPAELLGSGRMTTL
ISELRAHYDLVIFDVPPFLMVTDAQVLMSKMDGVAIVVSADKTTKGALQRTNDILKIAGSPVLGFIYNDMNRKKKGSAGY
GYGYGYGYGDTKAK
>gnl|bykdb|A0A175M618 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum B2 433] (length=236 residues).
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDEKKKKRSKK
>gnl|bykdb|A0A176J4N3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SJS] (length=231 residues).
MALKRKEKLQSRRRLISLLKPKSPIAEEYRTIRTNIQFSSVEKDIRSAIVTSSGPEEGKSTTIANLAIVFAQQGKKVLLV
DADLRRPTMHLTFSLDNRTGLTNVLTRQATLQQGVRHTEQENLDVLPSGPIPPNPSELLASQMMTTVLEEALAIYDFILF
DTPPVLAVTDAQVLANLVDGAILIADRGKTQIEHAKKAKEQLQNAQAKLLGVILNNKKRNKSKYGYYYGAN
>gnl|bykdb|A0A176TK17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus parvulus] (length=251 residues).
MPLFRKKHKLDNESLKRGVGLVTVTDPNSVVSEQFRTIRTNIQFSSAEKKLQSIVITSAEPSEGKSTIGSNLAVVWAKQK
QKVILLDADSRRPTAHRTFNLLNAAGLSSYLTNNAVYEEIIQKTDIPNLSVISSGPVPPNPAELLNSHHVSTLLERLASE
YDMIIVDAPPINTVTDAQLLASKVDGVVLVVPQGIAEKGSVTHAVEQLKMVHAKLLGTVMNRFKADKAPGYYGGYYGGDY
GGYYGVDDKDD
>gnl|bykdb|A0A177KM93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus aminovorans] (length=236 residues).
MALKRKKKTTVAPGSAKRKLITYTDPKSPISEQYRTIRTNILFSSVDESLRSILVTSTSPGEGKSTTIANLAVVFANQGK
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLEHSLEKY
DFVLFDTPPVLAVTDAQVLANQCEGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGKE
>gnl|bykdb|A0A177KZU6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus aminovorans] (length=236 residues).
MALKGKKKTPAAPGSAKRKLITYTDPKSPISEQYRTIRTNILFSSVDQSLRSILVTSTSPGEGKSTTIANLAVVFANQGK
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLENSLEKY
DFVLFDTPPVLAVTDAQVLANQCDGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGKE
>gnl|bykdb|A0A177SHW3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. KKBO11] (length=231 residues).
MAKKSKMNKDARKLITVTQPKSPVAEQYRTIRTNIEFMAVDREVQAILVTSATQGEGKSTTSSNLAVAYAQQGKKVLIID
TDMRRPTVHYTFRVANGLGLSSLLTRQAEKEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLTEQLREEFDIIIFD
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|A0A177ZII9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus galactosidilyticus] (length=231 residues).
MAKQNLKPQSGKRKLVAKANPKSPISEQYRTIRTNIEFSAVDEEIRTLMVTSSGPAEGKSTTTANLAVVFAQQGKKVLIV
DADMRKPTVHYTFGVTNTIGLTNVLTRQATLEDAARPTDVENLHVLSSGPIPPNPAELLGSKGMQLFFEKGKELYDMVIF
DTPPVLAVTDAQILANKCDGTVLVVASGKTELESAQKTKELLAAAQAKLLGVVLNNKKMEKTDYYYYYGTN
>gnl|bykdb|A0A178HI32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=251 residues).
MFNFKQRKIDKKNKEQRRGVSLITAADPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
DEDIDSEDLQS
>gnl|bykdb|A0A178K546 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. CCUG 49591] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A178TAJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=235 residues).
MARKPAASIRKAERKLITFDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTRPGEGKSTTVANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYWLFTTTCT
>gnl|bykdb|A0A178TM66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus flavithermus] (length=233 residues).
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
LIDADLRKPTVHYTFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVV
LFDTPPVLVVTDAQILANQCDGTILVVHSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESNYYYYYGNK
>gnl|bykdb|A0A179CLV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus aviarius] (length=269 residues).
MGLFDRFKKNKTKLDEDSMKYGVALITRDDPKSGISEQYRTIRTNLKFSFLDPDFKILAVMSALPSEGKSTVSANLAVTW
AEEKKRVLLVDADLRRPTVHRTFKVSNRYGLSNIITSSASTVDISEMIDKTEVENLDVLTSGPTPPNPAELLGSERLSQL
LDFLRERYDFIILDAPPVDTVTDGQIVGTRADGVALVTPQGIATKDAVMRAVKLLQRVNANILGVIMNRFTAQEAGGYYG
GYYGNYYGGSYYGTDDSSSRKGSKKRGKK
>gnl|bykdb|A0A179T2A4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus litoralis] (length=233 residues).
MARKDRKQLFQLQNRSLISFTSPKSPIAEQFRTVRTNIQFSSVDEDLQTMIVTSSGPAEGKSTTTANLAVVFAQQGKRVL
LIDADLRKPTSHYTFRTENHVGLSNVLTRQATLDEAVKTTDQDNLWVLTSGPIPPNPSEILGSKGMQMLLEKAKNEYDVI
ILDSPPVLAVTDAQVLSNLTDGVVLVVSSGKTEIESAKKAKELLDSAKAKILGVVLNNKKVQDSQYYYYYGGK
>gnl|bykdb|A0A179XB34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=250 residues).
MNFSLEKVLHRHKEDQETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALDQCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRQPTVHATFRTLNLDGVTTVLTGKEKPDDVVEETFVDNMSIITSGPVPPNPSELLNSKRMAGLLE
WAREKYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLKRTVEVLKLANAKILGSVERVKAKHGDRGYGYGY
GYGYGNESNK
>gnl|bykdb|A0A179YJI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=250 residues).
MTLKFKKLFSHNHVDQETQKNGVFLVTFAEPKHVVSEQFRTVRTNIEFAGAALDKCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLVDADLRRPTVHATFRKLNLDGVTTVLTGKTKPDEVVEDTFVDNLSVITSGPIPPNPSELLNSKRMGQLLD
WTREKFDIIVLDAPPVLAVSDVQVLVPRSDGVVVVANMGKTLKGDLKRTVEVLKLAKAKILGSVERVKARRGDKGYGYGY
GYGYTTENQR
>gnl|bykdb|A0A181EI04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A192F4W5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. AntiMn-1] (length=196 residues).
MFSNANSEIKSLLITSEKPSSGKSTVTANIATTYAQAGYKTLIIDGDMRKPTQQYIFDLTNFNGLSNFIIGKALSKDAIK
ETHIENLSVLTSGPVPPNPSELITSEKFTELFNKLSEEFDCILIDTPPVTTVTDAQLYAQNVRDCILIIDITANDKSEVK
KAKELLEKSGGKVIGAVLNKATIDKGSNYYYYYGDE
>gnl|bykdb|A0A192H246 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus backii] (length=248 residues).
MALFRRKEKKLEDKSMKYGVDLYTLSNPTSTIAEQFKTIRTNIQFSMIDRKLETLLVTSAGPSEGKSTVSSNLAVTWAGQ
GKNVLLVDADLRRPTVHQTFQVSNSQGLTTLLTNPKLNLDQAITETAIDHLYVLPSGPIPPNPAELLATERMNHLIEALK
EHFDLVLFDVPPVISVTDTQILASKVDGTILVTPQGIVEKAAILKAKELLDKVHARILGTVMNRVTPQNSGGYYGGYYGG
YYGTDDKK
>gnl|bykdb|A0A193D087 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar coreanensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSIYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A198A864 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 1ZS3-15] (length=230 residues).
MRSMRTLINKHPLITESHPKSQVSESYRTLRTNIQFSSIDRSMKTLLVTSAQPGDGKSTTAANLSVAYAQEGKKVLIVDA
DLRKPTLHHYFGKSNRYGLTSAIVNRNQFDEFICETSIENLFLIPSGPIPPNPSELLMSQKMTVFLEEMAARFDVIIIDS
PPTLAVADAQILATKCDGVVMVIRDGKVKRDMARKAIHNLQRVQAKVLGVVLNNKRPKKSDGAYYDYYGD
>gnl|bykdb|A0A198ALD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 1ZS3-15] (length=229 residues).
MSNSTNKRPIITHQNPKSPISESYRALRTNIQFSSIDEELRVIMVTSAGPGEGKSTTLINLAVAYAQTDKRVLVIDGDLR
KPTMHHTLRVSNRWGLTNLLTNELTIREVLQDTFIPNLQIITSGPIPPNPSEILASKKMTSTIEELKQRFDVILIDAPPA
IAVTDSQIISSRSDGVILVVNSDRTKREAVLKAKQNLDNVRARILGVVLNNVDRKNKDAYYYYYYGESQ
>gnl|bykdb|A0A199QC01 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paraplantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A199QE22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paraplantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A199QH59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNMTTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHQLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAILNDVRDGSHHGYYGYNNGYGYYSNE
DK
>gnl|bykdb|A0A1A5VE64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus acidilactici] (length=248 residues).
MFFKKKPKLDNESLKNGVGLITYNDPTSTIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTVSNNVAVTWADQGK
SVLIVDADMRRPTVHRTFRTSNAVGLSNLLAGTGSLDDAIHSTVVENLSVMPSGPIPPNPSELLGSSKMVNLLGVLTTKF
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYYGGYYG
GYYGTDDK
>gnl|bykdb|A0A1A5YS96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus oryzae] (length=229 residues).
MSQSKNKRQLITLSNPRSPISESYRSLRTNIDYSAIDEKIQVIMVSSAGPGEGKTTTITNLAITYAQSERKVILIDADLR
KPTAHHNFSISNRWGLSSVLSQQCTLEESIQSSSVPGLDVITSGTIPPNPAEMLGSNRMNAVIQQLRDMYDIILIDTPPL
LAVTDAQIVATKSDGAIMVVDQGRVKRDIAKKAIQNLQTVNARILGVVLNNVKRKANEESYYYYYGAKE
>gnl|bykdb|A0A1A6AIM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium ragsdalei P11] (length=240 residues).
MEKPDIITVKNPKDPIAEAYRTLRTNIQFSSFDKKIQTIMLTSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRL
HKIFLTSNEIGLSDVLAGKVEFEDAVKETGVENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVT
DAQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYHYYYGSDGTKIKKKKKKTKK
>gnl|bykdb|A0A1A7LXF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Solibacillus silvestris] (length=235 residues).
MKKKKNGLKDSQIARKLVTFTETKSHIIEQFRTIRTNIKFSMPDEPLKTILITSSTPGEGKSTNAANLGVVFAQEDKRVL
IIDADMRKPTLHHTFKTFNKVGLSNILARRSALHDAVQETFIVGLDVITSGPIPPNPAELLSSQGLDALLQHVKNDYDII
ILDSPPLLSVTDAQILANKCDGTIMILNTGVVDKRAVKKAKALLSASHTKILGVVLNNYKTPNHFNYYNGYHYAE
>gnl|bykdb|A0A1A7LXJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Solibacillus silvestris] (length=237 residues).
MFNKFKRKKSQPTTLARKLITDSNPKSIVSEQFKTVRTNINFSMPDKDLKTLVVTSSTPGEGKSTNASNIAVVYAQSGKK
VLLVDGDMRKPTTHHTFGVRNVGGLSTVLIRQDTVEEVVHETHIEGLSLITSGPIPPNPAELIASKTMDHFIETVKGKYD
LVIFDAPPVLSVTDAQILSNKCESTILVINSGKAEKENVIKAKEMLIASKANIIGAVLNNYAIDKNHYYYQYYGAVE
>gnl|bykdb|A0A1A7T279 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=227 residues).
MKVRETRLISIENRFSPITEQYRNVRTSIQFAASAGDPLKLLLVTSTEQEEGKTTLAANLAVVMSETNKKILLIDGDLRR
ATAGKYFNMRSSQAVGLSTLLNNGRSSLNEAIQRTQVKNLDFLPAGPIPPNPSELLNSLRLHELFSELEDQYDAIIVDSP
PLLVVTDAQIFSSKVDGVILVVRENRTKRNNLIKCKTLLERSKAHLIGVVYNGAKSMGAGNYKYYKY
>gnl|bykdb|A0A1A7UGI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENMSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A1A9BK55 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=226 residues).
MPTLEISQAKLELAKKTEEYYNALCTNLQLSGDDLKVFSISSVKAGEGKTTTSTNIAWAFAHAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
DAAIIMQKCDASILVTKAGETKRRELQKAKEQLEQTGKSCLGVVLNKFDTSVDKYGFYGSYRKQKK
>gnl|bykdb|A0A1A9BK99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDDLKVFSITSVKLGEGKSTTSTNIAWAFAHAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNVENLFVIQTGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEVGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|A0A1A9E1L1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVSESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1A9PPL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1B1IEU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 064] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1B1LFY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1B1S2X0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus versutus] (length=233 residues).
MARKKKVLQETARKLITFTTPRSVVSEQFRTLRTNINFSSPDAEIRTIVVTSAAPSEGKSTTSANLAVVFAQEGKKVLLV
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSIQEVIRPTAVERLDLMTCGPIPPNPAELLASQSMNTLIGQLKNMYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDMAVKAKEAIESSNSRLIGAVLNNFALPKDSYYYQYYGNTE
>gnl|bykdb|A0A1B1S369 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus versutus] (length=219 residues).
MTITHPKSRVSEQFRTLRTNIHFTSPDGDIRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLIDADMRKPTMHQTFKI
PNTRGLSNVLARQIALKMAIQSSGIENLDLLPCGSIPPNPAELLSSPNMDFLFDHALDTYDLLIFDTPPVLSVTDSVILA
NKCEGTILVVNSGKTERAQALKAKEAITAAAKIRLLGVVINNVENQQEMGDAAYYGANE
>gnl|bykdb|A0A1B1S3A4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus versutus] (length=234 residues).
MRTKNKTKRVMPRKLVVRTNPQSIAAEQYRTIRTNINFSIPELDSKVLLFTSPAKEEGKSTTAANMAIVFAETGKKVLLV
DADMRRPTLFRTFQLGNSTGLSNLLLRKGNLKHSVKASGIANLDLLMSGQIPPNPAELLESDALDELLEEMRGLYDYVLF
DSPPILSVTDSKILANRCDGTVLVINTGKSEKISVEKARDSLATSKAFIVGVVLNNYPMTNENYYYHNYNEEMN
>gnl|bykdb|A0A1B1Z952 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus arsenicus] (length=227 residues).
MFKSKKKLNNQRLLVADLNSKSPVFESYRTLRTNIQFASVDQDIKKIVITSPKPGEGKSTTVANLAIAFAQQGKKVLLID
ADLRKPTVANTFSLPNTSGLTNVLSRQSKIEQVIQQTAVENLHILTSGPIPPNPSELLGSNSMKELVAKAENEFDIILFD
SPPVLAVTDAQVLTNLSDGTILVVRSGSTDQDAAKKAKDLLQVGKSRLLGVVLNGKNQKQEQYYYYY
>gnl|bykdb|A0A1B2A215 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc lactis] (length=252 residues).
MTLFRNKYKVGRDGLSRDTMLNGARLITALEPKNPVSEQFRTIRTNIEFASVAKGNVKTLLVSSPLPSEGKSTITANLAV
AYAQQGKKVLLVDTDLRRPTVGVTFGIADNHGLTNYLADVNSEPQSIIRHTRLETLDVITSGPVPPNPAELLASSRMTDL
IAELRQRYDLVIFDVPPFLMVTDAQVLMSKMDGVAVVVSGRQTTKGALQRTTDMLKLADAPVLGFIYNDRTRKKNSGNGY
GYGYGYGYGDAK
>gnl|bykdb|A0A1B2A5M0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus curvatus] (length=242 residues).
MGLFRKEKGLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNSAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVPPVVSVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGTE
DK
>gnl|bykdb|A0A1B2DHX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. BIHB4019] (length=225 residues).
MSRTKPNWPLITETNPKSPISEAYRILRTNIDFSNLEEEIRTLMVTSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMR
KPTQHQLFRVSNQIGLTSVLSNQKEWENAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPI
MVVTDAQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
>gnl|bykdb|A0A1B2DJQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. BIHB4019] (length=230 residues).
MRRLTSETNLVALTNPNSPISEVYRTLRTNIQYAEIDTPKQILMIASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
KPSLHQVFDKPNRIGLSSAISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPV
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETAKS
>gnl|bykdb|A0A1B3XK93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus muralis] (length=228 residues).
MKPRTATKKINKNNLITKIDPKSLISEDFRVIRTNIDYSRIDSQYKSIMITSPEPNSGKSVVSANLAVVFAQQGKSTLLI
DGDLRKSSVQYFFPEVRSAGLTALLTGRISLEEAIEETEVKNLFVLPAGFISTNPAELLSSKKMKELFKRLLTMYEQIII
DTPPILAVADAQIISSLVDGTILVFRSGYTSKTNAKKSVHVLQQVHGKIICSILNDHKNKKDAYYYGK
>gnl|bykdb|A0A1B3XRM4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus muralis] (length=225 residues).
MRSKDKKQVNLIAQNNPKSPITEQYRLIRTNIQFSSVDEDIQTIVVTSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADL
RKPSVHYAFGLSNIQGLTSVLTKKMSIETAVMQTDVPNLEILTSGPIPPNPSELLNSRAIGITIKELKEMYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTSVLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A1B8RQ73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium paraputrificum] (length=211 residues).
MLENPTTIYAEAYSKLKTSIKYSSADKNNKVFLITSSEKGEGKSTTATNLAISLSFDKKKVLLVDCDLRRPSLHKYLRIS
GECGLTEVIIGETNVEKAIVNIKDNLFFLPSGNRPPNPAELLGSENFELMLKELKDIFDYIIIDSPPLRVVADAQILSSK
VDGVILVVKYGFTKKDELLVCRETLELVGGKLIGTVINGDKKENDYKYYYY
>gnl|bykdb|A0A1B8RSH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium paraputrificum] (length=219 residues).
MFIVEKKPNSIAAEAYRTLRTNIQYSSFDKEIKTMVVTSSEPGEGKSTTAGNMALSFAQSEKSVILIDCDLRKPSLHRKF
KISNLVGLSDVLIGKEKMNDAVNEYSENLHILTSGKLPPNPSEMLGSKAMGRLLEELKSKYDIIILDSAPLQAVTDAQIL
STKVDGTILVVRAEKTKRDSVQQAKALLDKVGANVLGTVLNGVENTRKKYYYYYGNEGK
>gnl|bykdb|A0A1B8VZJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27264] (length=229 residues).
MSQSPNNQQRHLITVTNPRSPISEAFRALRTNIDFSSVDEKIQIIMITSSGPEEGKSTVSANLAAAYAQSDKKVLLIDGD
LRKPTAHKTFKLSNRYGLSSLLSKQADLEDVVQESGVPNLSLITSGPLPPNPAEMMASNRMTTVLQEMREVFDIVIIDTP
PLLAVTDAQIVASKSDGVIMVVSYGKVKRDIAMKAKSGLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1B8W3L6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-26390] (length=230 residues).
MSRSKNKRQIITLTNPRSPISESYRALRTNIEFSSIDEKLQVLMVSSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLR
KPTAHHTFSISNRWGLSSVISQQCSLEEVLQVTDIPNLDVITSGAIPPNPAEMMNSKRMTAIIAQLRGMYDIILIDTPPL
LAVTDAQIVATKSDGVILVVDQGKVKREIAGKAVKNLESVNARILGVVLNNVKRRANEESYYYYYGVQDK
>gnl|bykdb|A0A1B8WAI5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-26390] (length=230 residues).
MSRLIPKWNLITELNPKSPISEGYRMLRTNIEFSTINQKLQIIMVTSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLR
KPSQHHIFGKSNRSGLTTALFNQLKLEDIIQFTGTENLSIIQAGPTPPNPSELLSSDQMADLLKKARERYDVIIIDTPPI
MSVTDAQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVKARLIGVVLNKINRNHSDIYSYYYGEKTDA
>gnl|bykdb|A0A1B9AL51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27986] (length=232 residues).
MARKKSRQFGNSNQRKLVTYLEPKSPISEQFRTLRTNIQYSFIDEEMQTIMITSSGPTEGKSTTAANIAVVFAQQGKRTL
FIDADLRKPSSHYTFSFTNNVGLTSVLTRQIELGKAIQIVEPLGLHVLTSGPLPPNPAELLSSKSMNELINQTKEDFDII
IVDTPPITAVTDAQIIANICQGVVLVVSSGRTQVEDAVKTKELLLNTGTKILGAVLNNRKMKDNTYYYYGKK
>gnl|bykdb|A0A1B9AL75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27986] (length=232 residues).
MARNKGKQTGNRNQRKLITMWDAKSPISEQYRTLRTNIQFSSVDEEIQTMLVTSSGPAEGKSTTAANIAVVFAQQGKRTL
FIDADLRKPSSHYTFSVTNTFGLTSVLTKHSNLEEAVNIVEPLGLHVLTSGPIPPNPAELLSSKAMKELINEAKNDYDLI
IIDTPPVTAVTDAQIISSLCQGIVLVVSSGKTQIEDAIKTKELLTKTGTKILGVVLNNKQMKDNTYYYYGNH
>gnl|bykdb|A0A1B9AQ17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27225] (length=226 residues).
MSREKAQSKTSPRFLITKLHPRSYISEQYRTVRTNIQFASADADVRTLLVTSASPGEGKSTTTANLAVVFAKHGKSVLLI
DADLRKPTVHYTFSVKNYRGLSNILVGEATLIEAVVASEVENLDILTSGPIPPNPSELLDSKRMETLLQEAKSHYDIVLI
DTPPVLVLTDTQILANLCDGSILVVRNKVTQLEDAQKAIEVLKASEGKVLGTVLNGTSSKETNYYY
>gnl|bykdb|A0A1B9AVC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27225] (length=236 residues).
MALNRRKKPQTGDKRVKLVTLFDPKSTISEQYRTIRTNIQFSSVDREIRSLMITSSGPAEGKSTTAANMAVVFAQTGKKV
LLIDSDLRRPTVHYTFSLPNTYGLTNVLTKQIQFEEAIRETEVENLFIMTSGPIPPNPAELLGAATMNQLFETAYSHFDI
VLFDTPPVLAVTDAQILANKCDGTLLVIYSGKTIIEQVTKAKELLEAAQGKLLGTVLNHKEIKGNDYYYYQYYGGK
>gnl|bykdb|A0A1B9AYT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wudalianchiensis] (length=235 residues).
MALKKNKKKEAPGQAQRKLIAKTDPKSPISEQYRTIRTNILFSSVDQEIRSLMVTSAGPGEGKSTTTANLAIVFAQQGKK
VLLVDADMRKPTMQYTFNTSNTIGLTNVLAKQKVLEAAVFETDVDGLDLLSSGPIPPNPAELLGSKAMAELVQEAYDQYD
VVIFDTPPVLAVTDAQVLANQCDGTVLVINSGKTEIDGASKAKELLESAKAKLLGVVLNNRKLKESSYYYYYGTK
>gnl|bykdb|A0A1B9B2F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27986] (length=219 residues).
MSKERAKYAQIYKQSIVSEQYRLLRSSITFSRIGKDIQTLLVTSPNHGDGKTTTAANLGIVLAQHDKKVIVIDADLRRPK
IHKLFDLKQSDGLTAILAGKATVDEAICISDIPNLHIIQSGPVTKTSYELLTANRIEDIISILSQQYDTIIFDTSPILYT
AETQILANLCEASMLVVKSGQTLKEDARKAVNVLQDSKAELLGASLNGNPIKPKAYQYN
>gnl|bykdb|A0A1B9BQ18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKRLNKAVANQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1C0A6S9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Orenia metallireducens] (length=224 residues).
MIVKHNPKSPASEAYRSIRTNISFLSPDNPLTKIAVTSSGPSEGKSLTIANLAVSMAQNGKKVVIIDADMRKPMQHKFYD
LPNFEGLSNILTSEIEFEDGLRETGIDGLKVVTTGTVPPNPAELLNSKRMEEVIKKAEKEADMVFIDTPPVIAVTDAAVL
SNKVDGIILIVASHQTEEQMMVRAKENLDKANANIIGTIITKYPVSTKGGYYNYYYYYGNSFKG
>gnl|bykdb|A0A1C0BIN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. W14A] (length=224 residues).
MDPSLTFQVTEAYKVARTSLAFSLLKKGCKKVIVTSSLDAEGKSTTSVNLAKSLAQQVDIKVLLIDSDLRRPKIHEYFGL
ENTVGLTNYLGNMCGVKDVTRPTEEPNLSVICSGVAVPNPSELLASSAMKNLLACLEPYYDYIIMDTSPVNIVVDALPLA
KISDGVIIVVRDGISTYPELTKTVETLKMAEAKILGIILNGMKPEPRDCRYRYDRYGKTCEPCP
>gnl|bykdb|A0A1C0UNG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEISQAKLDFVKKAEENYNALCTNLQLSGDDLKVFSITSVKQGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITQKCDASILVTKAGEINRRDIQKAKEQLEHTGVPFLGVVLNKFNTEVEKYGAYGVYGNYKKG
>gnl|bykdb|A0A1C0Y7Z1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caryophanon tenue] (length=239 residues).
MFNKKKKQRAKRTPSTLARKLITIESPKAIVSEQFRTIRTNISFSNPDKEIKSVIVTSSSPGEGKSTNSANIAAVYAQGG
KRVLLVDADMRKPTVHHTFNLKNTKGLSNLLTHQITMSEAVHETEQENLFVMTSGPIPPNPAELLASKSMNQFILDVTAA
YDFVIFDVPPVLSVTDAQILSNRCDGTVLVVNAGEADKAMVQKAKEALVASKANILGVILNNYVLERDHYYYQYYGQPE
>gnl|bykdb|A0A1C0YM54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caryophanon latum] (length=242 residues).
MFFKKKKKSKKRTTATLARKLITVENPKAIVSEQFRTLRTNINFSNPDKVLKTILVTSSSPGEGKSTTSANVASVYAQEG
KRVLLVDGDMRKPTVHHTFGLKNTKGLSNVLTRQVSIEEAIQPSTLDNLSIMTSGPIPPNPAELLASKSMEQLIGELTAQ
YDFVIFDAPPILSVTDSQILSNRCDGTVLVVKAGEAEKAMVQKAKESLVASQANILGVVLNNFVLAKDNYYYYQYYGQAE
SN
>gnl|bykdb|A0A1C0ZRK7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus pectinilyticus] (length=229 residues).
MSNSTNKRPIITHQNPKSPISEAYRALRTNIQFSSIDEELKVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLR
KPTMHHTLRVSNRWGLTNLLTNQLSIQEVLQDTFIPNLHIISSGPIPPNPSEILASKKMLSVIEELKLQFDVILIDAPPA
IAVTDSQIIATRADGVILVVNSDKTKRDAVLKAKQNLDNVRARILGVILNNVDRKNKDAYYYYYYGETQ
>gnl|bykdb|A0A1C0ZSF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus pectinilyticus] (length=236 residues).
MRTLTNKTSKADKAVSHQLITDIRPKSQVSEAYRTLRTNIQFSSIDHMMKTVLITSAQPAEGKSTTAANLSVAYAQEGKK
VLLIDADLRKPTIHHYFAKSNRYGLTSTLANQTEIEEVIFKTTVENLFIITSGPIPPNPSELLMSQKMTALLADMATQFD
MIIIDSPPTLAVADAQILATKCDGVVMVISEGKVKRDVARKAIENLERVQAKILGVVLNNKRHKKSDVSYNYYYGQ
>gnl|bykdb|A0A1C1ZE09 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLIVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
GYGEDTK
>gnl|bykdb|A0A1C2D3B3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTVRTNINFMAVDENINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A1C2G545 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQKQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQRGLTTILTSGTNSVDLREIIQASGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
EGIYDMVIIDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDISADGDAGYGYGYGY
GYGYGEETSK
>gnl|bykdb|A0A1C2G5N7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRKKSNANNDTMNNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLALTSANVSEGKSTVTDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNREGLTTILTSGDNSVDLRKIVQPSGVENLDILTSGPIPPNPAELLNSQRIKTLIES
VKSIYDMVIVDVPPLLEVTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYGTDSAQ
>gnl|bykdb|A0A1C3F3H3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. BG] (length=236 residues).
MAYSLITLEQSKSPISEAYRTLRTNVQFTSVDSETKKIMITSSGPREGKSSTVANLAVSMAQAGKSVLVVDADLRNPTQH
KLFGLDNGQGLSVALVQDQDYRQYIQETAVPGVMVITGGPIPPNPAELVGSKRMKRLIEEFSLQFDMVLIDTPPIIAVTD
AAIIAQEVDGVILVLAAGEVNKDFAQRAKEQLDKVGAKILGAVLNKVDMKTSEYYYYYYYHGSDDAKKKPKRQKGR
>gnl|bykdb|A0A1C3F3Q4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. BG] (length=215 residues).
MLRTNIQFTSVDLETQKIMITSSGPREGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQHKLFGLDNGEGLSVFLVQDQD
YCKYIRETAVPGVMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMLLIDTPPVIAVTDAAILAQEVDGVILVLASGEV
NKGYAQKAKEQLDKLGVKILGAVLNKVDMNTKEYYYYYYYNASDDTKKKHNRRSS
>gnl|bykdb|A0A1C3SIT1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus glycinifermentans] (length=227 residues).
MAIRKKRSRKYESALVALHQPNTPIVEQYRTIRTNIEFSSFEKPFRSLLITSGLPGEGKSFTAANLAVVFSQQEKKVLLI
DADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQAESLHVLTSGPIPPNPAELLSSQAMEDLLAEAYKQYDLVLL
DSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
>gnl|bykdb|A0A1C3SPA5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus macedonicus] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQSGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSKERYQGLTSFLSGNAELSDIICDTNIDNLMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLLVVKAGADKRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A1C3STD7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus piscium] (length=231 residues).
MSKIQKDVDNNRAIITSVNPQSPISEQYRTIRTTVEFKMVDQGIKSFLVTSSEASAGKSTTVANLAVAFAQQGK