BYKdb

Dataset for cluster tad of phylum all

[Download (right click)] [Alignment] [Repertoires]

517 sequence(s)

>gnl|bykdb|I0UTA4 [Bacteria] Adaptator of bacterial tyrosine kinase [Actinobacteria][Rothia aeria F0474] (length=926 residues).
MYGAAIAFGTTLVVSNGIGPAGAGEFFRLMALFAIATSTAVFGADTGLVRTISAQNALGRYSAIPRLIRYAVLPPLALSL
GITAVACIYSVAVPMPHEYAVALRMSALFVIVAAVMSVYFGALRGLNHVVTFTVMQNVLLPTLRFGAIALVVFASGHLLD
LVFAWTLPVAATALLTLWVVESYMPRSKDRPQSEAAATTPQESAHSFWTFSSARGVATIVETILEWIDVLTVTTVLGPAA
GGVYGAVNRCVRVGTMVEHTGRIVTGPSISAALATQNIDRARQIFLATTRVLTAISWPFYLTLAAFGPTLLGFFGKGFEE
GAGILWVICPAAMLSMSAGGVQSILLMSGKSRWQLLNKLSSLAVAIILNVALVPLWGLYGAVTAWASALLIDTFLASYQV
FRLVGIRTSLTEMAPALTLGALVPLGCSFVVLTVVGQGLLGLVLYVILLAPSYVALLYYFRTQLGIERFLASRKGGGKGA
GTRSALAHQLSIQGENTMSKLSATTDAPAVSLREQLHRVWRHKMIVIITIVVCTLIAVAFSFLAPPKYTAKSSVLVNPLV
TDPAAGGNANSLKVDISTESRAAGSREVADKAADNLRSEGVDTDSKLTDKLMNSTKVVPTSQTAVLDIEVSDSNAKRSAQ
YANAIAKAYLEVRQNNLKETITDSVKKLDAQIKQLEDEDKNNNGNANSAKISQMRERRNQIQLTSTVGGRVLTEAQPPKK
ATGLGHRKTALAGVGTGLLLGVLIAYVYDRMMRTVGYSDRLKDLGIPVQTVRPRSSDEDTLLLMRRIGSPDGNLRASNIS
GIVIVSDSPALADQLHRQLYRTIPSGKAYFTDYPALSKVLEHYSPEQVIESNEIPMVINLADEAPLSTLLRLSEACRVCL
VPVGELSSRAQVRELFSHLRTLENTVSIAIFMDTDPEKEKVDGATA
>gnl|bykdb|Q1AUN7 [Bacteria] Adaptator of bacterial tyrosine kinase [Actinobacteria][Rubrobacter xylanophilus] (length=253 residues).
MSTDTTTAREAAPAGRDAFFSAKEFLKVLRRRAWAVVFVASALAASAVGFGLLQTPVYEASITILVGQKSGEEGPRNLSG
DVEGLQQLAQTVAEAVATRPIAEAAAQKLGLSEEYAQKTLLGNLRVEQRPGTMFVEVRYRDPDPQRAQRVANAVGEVFSE
RVSEVSPGANAITATVWEEAVAPETPVSPDPLLNGLVALALGLLLGLGLAFLLEYLDDSWESPEEVERVSGVPTFGVIPG
FQVKTSEKKKGGG
>gnl|bykdb|B7B948 [Bacteria] Adaptator of bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=384 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLQAVPVSGKEVMLS
GFTLGDQEVSDGKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVALLFQSGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISAYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKNSDLIPANTGISDVNIESQIGEFNEMLLKRDKLIS
>gnl|bykdb|B7BDT7 [Bacteria] Adaptator of bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=264 residues).
MATQNNISRPKQTDDFIRIQDLFYLCLNRWYWFVISLAVTVGVAVVYLLTTPPVYTRSASLLIKEDSKGNSLGDAAGLMG
DFDLFQTNTNVNNEIQSLQSPAVMLDVVKRLHLDVNYHTDGGFYKKVLYGRDCPYTVDFNDLQDNESVAFTINPSQNGQV
LLTDFSRNGEDVAGNITATLNDTVDAPIGRLVVKVANDSAIQDAPVYVSRRGYQDATGGYASNLSVTLSDEKSTVINLSF
KDVCIQRAEDVLNTVIAVYNENWI
>gnl|bykdb|C2MBF7 [Bacteria] Adaptator of bacterial tyrosine kinase [Bacteroidetes][Porphyromonas uenonis 60-3] (length=566 residues).
MEYATDSIQQEPARSLEEASTLSLQDILMILKANWLFILLSLIVCLTLGFLYIKSSPHQYSRSASLLIKNETPMSSAMQQ
LAQFAGDKHAYSDDVSNQIIILSTERVVSETVRRLGLDVQYHYNAGLREKDLYKQSPVSIRFVNADPDEKITLRVKPDKG
SDSQVILYDIKSSLVGKVQEPITAPLGDTIATPIGQVVVEATPYYSNFPSYEVLKVQKENFHSIVDSYMRSLQVSLQQKD
ASVIKLTMQSSNPQLAEDFLSTLILVYTELEREDKVKVAESTQRFVDDRLAIISSELGQVDAEIEGFKQSQQIADIQAEA
QEYIKGRSEIKTRLVELNNSISIAQFVRGHLKDKNQMEALIPANVGIASPAIEAAIAKYNELLLKRDQLQANSSSQNPLV
QELNTQLAAQRLSIITSIDNLISTLEVERQGILSEQSSYKGRITSVPMQERIVGSIYRQQKIKEELYLFLLNVREQNALS
IESAESNARLIQAPTGPVAPVSPRVPIIMLAAGLLGLLIPTAIIYIRSIANNKVRGKADSRALHDYTCTRRGATLQGLQA
PRQEYW
>gnl|bykdb|A5V0I4 [Bacteria] Adaptator of bacterial tyrosine kinase [Chloroflexi][Roseiflexus sp.] (length=240 residues).
MQLSDYLAVLRRRWWVILLTMVVAVASALIFSRLQERIYRSEASYLVVPNRIDNGLSIVLQNSMSSFREMALARPQLQKI
SDELKLDRTPEWLLKRVAIQPRPDERKMIVQVDYPDPATAQRLADAIGNNMVALVSARNNFLEGTDRISMTVLEPATPPV
LHRPQTRVNMLAGAVLGLVLGVLLAFVLEALDDTIKTPSDVERYVQLATLGAIPAVSSDSRGATFTARRARKNEELEVVP
>gnl|bykdb|A7NQ70 [Bacteria] Adaptator of bacterial tyrosine kinase [Chloroflexi][Roseiflexus castenholzii] (length=229 residues).
MQLSDYLAVLRRRWWIILLTTVVAVASALIFSRLQERVYRSEASYLVVPNRIDNGLSIVLQNSMSSFREMALARPQLQKI
SDDLQLDRTPEWLLKRVAIQPRPDERKMIVQVDYPDPATAQRLADAIGNNMVALVSARNNFLEGTDRISMTVLEPATPPV
LHRPQTRVNMLAGAVLGLVLGILLAFVLEALDDTIKTPDDVERHVQLATLGAIPATGSDTRSAALPARR
>gnl|bykdb|A0NKF7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Oenococcus oeni ATCC BAA-1163] (length=233 residues).
MDTAISYQRLWELFKKNFFFMLFSALFFTAITFAACKFVIAPKYQSTAALLVNRSQDDTAATALNDQQADVQLIYTYKDL
ITRPVILNKVAKELKSTYPTLTSTALAKMITVSSTTNSQIFSIAVRSTSSQEAKDIANETASVFKNEAVKLMGKTISNVT
IVSSGLKNNTPVFPNTKLFSLAGFLIGGFLAVAYVLIKEISDNIYRETEYIGQLGFNNLGTVNYVAFHKRRNN
>gnl|bykdb|A0PZ01 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium novyi] (length=229 residues).
MEDEITLDLRDLFFVLRKRFKLIVSITLIATILSGIISFFVIHPTYEATLSVFIGKNENEQSQKISYNESDIMMYQRLVK
TYATIAKTNDVLEQVIEKLNLDVTTKELDKMIEVTPQQDTQIMDIKVQSKDPEKARKIAETLTPIFIQKSKITIPNGNVQ
ILDKVQVPEKPVKPHKALNVAIAFFLGLMVSIGLVFVLEYMDNTIKTQEDVEKCLDIPVLGTIPNHLSE
>gnl|bykdb|A0RL71 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=259 residues).
MLCANFRKLEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQ
TNIQLTNTYKVIIKSPVILEQVNEKLNLNMTAQALTKKINVANEKDSQVISVTAEDKDPKVARDIANATADVFKGEVAKI
MNVDNVTVLSKAEVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETM
NVKSHAPSSRKVRGQTIGS
>gnl|bykdb|A1ILY0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIALVAFVTGIVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLELPPKGLASKIKVTVPVDTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVKRPEDIEDVMQIALLGVVPNLDKLK
>gnl|bykdb|A3CQY3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|A3ICA4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus sp. B14905] (length=238 residues).
MNEEMTIQSLVKVLQKRWFLILILMMLSIGIAVFISYFLQTPIYEAETQLLVNQKSYENQQLIGAQNVDTDLRLINTYNV
IIKSPVILTKVIDVLALDTSPETLMKQIEVSSANNSQVVNIRVQDENEARAVKIANTIAEIFKEEIPVLMHVDNINILFI
AQSSEHPVPVKPNKLLNLLIAAISGFSLALVLAYFLETLDRTIKTEQDIEEILSLPVIGVVSNIELLHSKKSRARGSS
>gnl|bykdb|A4ITF4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Geobacillus thermodenitrificans] (length=247 residues).
MEETISLRELFETLRKRLWLIVLITALATVVSGVVSYFLLTPIYQASTQILVNQAKSEQQMYNVGEIQTNLQLINTYSVI
IKSPTILEKVKGELQLDQTLDELNEQIQVSSEKDSQVFSVTVQDPDPAMAAKIANKTAEVFKNEIVKIMNIDNVTILSKA
EVKEDQTPVKPKPLLNMAIAFVVGLMTGVGLAFLLEYLDNTIKTEADVEKHLGLPVLGSISVMSPSTAKTTRTGLSMQRA
RGETVGR
>gnl|bykdb|A4J8V1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfotomaculum reducens] (length=234 residues).
MNDDKIESRDDFEVIDLRDIWRIIKKGKWILISLPLIAMLTSGIISFFVLTPRYEASTTLMVGKTYSGQDAMMLQYNDIL
TANQLVKTYSQIAKSRTVVEKVMQSEKINTTYEQLSQSIDVKPVKDTQLIQITVEDIDPERAARLANFTAVVFIRKVTEI
MKVDNVNIIDHAVVPTLPVKPNKKLNIIIAGVVGLMVALGIVFLLEFLDRTIKTGDDVERYLELPVLGVIPKIE
>gnl|bykdb|A4VTU2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
AKDYREIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAVQKVVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGIVPDSKKLK
>gnl|bykdb|A4ZGZ7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus helveticus CNRZ32] (length=294 residues).
MEQEQKQTDNTIDLTQLLQLCRRHIWALILWSVGLALVGWGIANFVISPKYTSSAQILVNQKSNKNDPNTAYITQQANMQ
LVNTYKDIVTSHVILQDASDRLANPVRVVKKAKPAKYKTIDGRKVLVRKAQPAVIERDGKSYSVSASQLAKNISVNTQQQ
SQVFSVSATADTPEKAKAEANAVARSFRDQIPNIMNIDNVTIFAPATNGVQSSPNVKMFTLAGFVIGLVLTFAMILIREM
TNTTVRDDTYLTQDLGLTNLGYVSHFHVSSSFKLIKKNNNKPAAKREQRKRRRV
>gnl|bykdb|A5LJR9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae SP6-BS73] (length=230 residues).
MKEQNTIEIDVFQLFKTLWQRKLMILLVALVTSAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVK
DYREIILSQDALEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDVT
TLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDIEDVLKIPLLGLVPDFDKMK
>gnl|bykdb|A5M4L2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae SP14-BS69] (length=230 residues).
MKEQNTLEIDVLQLSRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVKRPEDIENTLQMTLLGVVPNLSKLK
>gnl|bykdb|A5YTT8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIALVAFVTGTVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLELPPKGLASKIKVTVPVDTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVEILDTRVKRPEDIEDVLQIALLGVVPNLDKLK
>gnl|bykdb|A5YTV6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIVLVAFVTGAVAFSYSSFIVKPEFTSTTRIYVVNRNQGNKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLDLPPKGLAGKIKVTVPVDTRIVSISVTDRVPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVKRPEDIEDVLQIALLGVVPNLDKLR
>gnl|bykdb|A5Z5P8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Eubacterium ventriosum ATCC 27560] (length=256 residues).
MKQQVEKIKINEKEDEVEINLLDLFNYYRKKILFIIAGFLIGAIIAGVWTKVGITPKYTATAKVYMVSASKNSVVDLADL
SIGTSLSEDYAELLHVRPIIEAINEENDLGYTYEQLNGMIDISTVEDTRILKISATSIKPEEAKTIANALAEKAVTEIPK
LMGTSSPNIAERAITPKGKSSPSLKKNVMMGAFGGMVVVLAIFTFLFITDDTIKTEEDVEKYLGIIPLTVIPDGNVKYGA
YSKYNYYKGKKYYTPK
>gnl|bykdb|A6BIG6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Dorea longicatena DSM 13814] (length=250 residues).
MSQDNNIIVLNQEADEEEISVNIAELIHVLCSKIHIIVLSAILTALVAFLATKLFMTPVYTSVTKLYVMTKNGENSSSAT
YTELQSGSMLTKDYMEMVKSRPVLEKVISELNLDMEPEDLEEMITTETPTETRIMSIYVQSTSPKQAKQIADAVRNAVSV
QIKQIMNVDSVNTVEEANLPMYPSSPSTKKNMLIGGLLGILASVGIVLFVYLSDDTLKTPADIERYLGLNVLTSIPIQTE
EKKVKKRKKR
>gnl|bykdb|A6M2M0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=230 residues).
MMNNDIIRIDEIANPIIKRWKMILLVTLVTTLLALIISYFIIPPKYEANTKVFIGKENTTGQDQNYSTNDVQMYQKLIKT
YAEIIKTNDLVQRAIDSSDINLNSENVLDNLSVTPRTDTQILEISYVSANQALAGDVVNSVTNEFIRSSREFIPNGNVKV
VESVKVPQKPVSPNKKMYIGVGLLLGLIGSAGASFLLEFLNNTFKTREQIEEILGLPVLGVIPDLFKEGK
>gnl|bykdb|A6YIA7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWQRKLMILLVALVTSAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLV
KDYREIILSQDALEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLKIPLLGLVPDFDKMK
>gnl|bykdb|A7VF43 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. L2-50] (length=273 residues).
MSTENKRVSESDTAKEEKNNYIRVVQAEEDDKEIDLVDLGYALMDKLHFIVLSFLLGAVLLNACAYFLIKPTYQSTAKLY
VVSASEDSVVNLSDLNIGTSLTKDYEDLMLSYPLLEQVIAKLDLSYDYEQLADMITLENPTDTRVLKITVTSTDPEEAMN
IANTLAEISVKYLPETMSTNAPNIAQVARIPDEKAGPSYLKFTLIGALLGAFLYCLVIIIRYLLDDTIHTASDMEKYFGI
VPLTSIPESDQFNQGDSATDKDKAKSGLKGRSK
>gnl|bykdb|A7Z922 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus velezensis] (length=235 residues).
MNENMSFKELFDIIKHRFLLIFIMTAVVTLVTGYIQFRVISPVYQASTQVLIHETSGEKNSNLSDVQLNLHYNNTFQTIM
KSPVVLEKVKQTLHLSETASALKAKITTSSETDSEIITIAVQDENPKQAAAIANTLMKTFKKEVRDRMNIKGVIVLSEAK
ASESPMVKPSRIRNIMMAFGAALMAGVTLAFFLHFLDETVKSERQLSEKTDLPVLGVVYDIKNQQTRSDEKHFGE
>gnl|bykdb|A7Z9K1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus velezensis] (length=248 residues).
MGESTSIKEIFAILRKRLLFILIITAAASAAGGLISFFALTPVYENSTQILVSQSKNNQKEVQFNDVQTNLQLINTYNVI
IKSPVILDEVIKQLHLSMTSKELESKITVSSEQDSQVVTIAVRDTDAKRAAVMANAVAAVFQDKITAIMNVDNVSILSKA
EAADSQSPAEPNRKLNIAIAFAAGLLGGIGLAFLLEHLDNTIKSEEQLESLLGIPILGTVTSISTKDSVAKNLRMAETKQ
AGGGHVDA
>gnl|bykdb|A8AZR4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=231 residues).
MNKENQLVEIDVLSLIKTVWKRKFIILLTALVAAVLALGYSLFIAKPSYQSTTRIYVVNRQQTDNNTLTNQDLQAGSYLV
KDYKEIILSQDVLSTVISELKLPGTTAEISKSVSVSVPTDTRIVSITVKNSDPNQASRIANTLREVAAEKIIAVTKVSDV
TTLEEAEVPKSPSSPNIRRNVMLSFFAGVIVMVIIVVFVEVLDDRVKKPEDIEEVMGLSLLGVVPDMRKLK
>gnl|bykdb|A8FHM0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=243 residues).
MNENIGFKQLFSVIKEKMALLILIVLIVTGISAYYQFYVSTPVYQATTQILVHKRSNDAQANLNDIQMNLQYTRTFQVLL
KSPIVIEKVKETLNLTESAEGLKHKIATSTENESEVINISVQDEDRAKAVAIANTATEVLQEEIKKTMNMDRINVLSEAK
LSNTILMNSRKFVHIVLALGASLLGGVTLIFLMNLLDDTVKRTHQIREEIGLPSLGSVYQMQADRRAKKDKQSVITGGQN
IDL
>gnl|bykdb|A8RK86 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium bolteae] (length=256 residues).
MEKRYREDDMEIDLLELLFEFKKRAWVIILAAVLGCLGAGAYSRLILTPVYTSTAMVYVLSKETTLTSLADLQIGSQLTK
DYSVMITSRPVLEQVIKNQGLNMTYGQLKARIRISNPADTRILNMTVSDTDPVRAKAIADEVANASSDYIGDIMEMVPPK
IIEQGVVPAAPASPSIKKNAALGGLACIAAACGVITLKVIMNDTIRSEEDVGKYLGMSVLASVPDDDGMAKEQQRNRSKR
KLERKKRKTEKNRRGE
>gnl|bykdb|A8RSL0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium bolteae] (length=261 residues).
MEKTYDDDEIEIDLLELLGEFRRKIWIILGTIILFGSVAGAFSAFVLTPQYKSTAMVYILSKETTLTSLADLQIGSQLTK
DYKIIVTSRRVLNQVIEDMELSLTYKELVEKVTIDNPQDTRILSISVEDPDPAMAKLIADKIAVTSSDYIGDIMEMVPPK
LIEEGEVPILKSSPSNTKNALIGGFIGAVLVCGFITVNVILNDTIRTEEDVTKYLGLSVLASVPEREGEKPEDKEAMISS
KPKNKPAVGKSRKKKRGGHAS
>gnl|bykdb|A8SQS9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Coprococcus eutactus ATCC 27759] (length=272 residues).
MNSNRVETTERDTGTQPSALSAYKAAEGEENEIDLLDMGMALLEKLPYIILCFLVGAVLFNAYAYFFIKPTYQSTAKLYV
VSASDDSIVNLQDLNIGSSLTADYEELILSYPVLDQVIDKMNLNMDSEQLAKMISLVNPTDTRVLQIVVTSTDKQQACDI
ANTLANVAIDYLPDTMSTNAPNIAQVARVADKKVGPSYMKYTAIGALLGALIYCIFIIIGYLMDDTIHTSEDMEKYFGIV
PLTVIPESEQFRTDDVQDITQKHSKRKERSKA
>gnl|bykdb|A8U9F5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Carnobacterium sp. AT7] (length=246 residues).
MEEEISLSELFATLKKRLTLIVSLGLIGLIVAAGFTFFIATPQYNATTQILVNRTTESAEGLQLNDINSNVQMINTYKDI
IKGPVVLNEVRENLGTNLTTTELSEKIEITTQENSQVFSLTVTDESPYEASEIANAVAEIFQSEIGNIMNVENVTIISEA
VPVTDQISPNNLLNLVIGLLVGLMLGVGSAFLLEFMDKSVRDERFITETLGWSVLGSVSEMSNDELHAKLNIKRPELNSR
RTKSRV
>gnl|bykdb|A8YPQ6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=222 residues).
MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNPQFMAQEVQSNIQLVNTYKEI
VKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKA
DGTAVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
>gnl|bykdb|A8YX90 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus helveticus] (length=295 residues).
MEQEQKQTDNTIDLTQLLQLCRRHIWALILWSVGLALVGWGIANFVISPKYTSSAQILVNQKSNKNDPNTAYITQQANMQ
LVNTYKDIVTSHVILQDASDRLANPVRVVKKAKPAKYRTNADGRRVLVRKAQPAVIERDGKSYSVSASQLAKDISVNTQQ
QSQIFSVSATADTPEKAKAEANAVARSFRDQIPNIMNIDNVTIVAPATNGVQSSPNVKMFTLAGFVIGLVLTFAMILIRE
MTNTTVRDDTYLTQDLGLTNLGYVSHFHVSSSFKLIKKNNNKPAAKREQRKRRRV
>gnl|bykdb|A9QSJ3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGGIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQTNSQVITLTVKYSNPYIAQKIADETAKIFSSDAAKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIGGLVLGLAIALLQELFDNKINKEEDIEALGLTVLGVTTYAQMSDFNKNTNKNGTQMGT
KSSPPSDHEVNRSSKRNKR
>gnl|bykdb|A9VRC4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus weihenstephanensis] (length=247 residues).
MEETISLKELFYILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEIQTNIQLTNTYKVI
IKSPVVLDQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVVIAFIVGLMASVGLAFLLEYLDNTVKKEEDVESLLGLPVLGIVARMDEETASVKSHASSSRKV
RGQTIGS
>gnl|bykdb|B0GAL4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Dorea formicigenerans ATCC 27755] (length=249 residues).
MGKNYDNDEMEIDLLELFYVLKSKILAILGVGLLFGCIACAYAGFLVKPLYTSSSMMLVLTKETTLSSLADLQMGSQLTK
DYSILITSRPVLTDVIDQLDLDMDYKQLKNMITVTNQDDTRILQLSVEYSDAKQAKEIVDKLSEVASEYIGDKMEVTPPK
IIEKGEVPTSRSNTGVAKMAVMGVLAGMILCAGVIVIRTIMDDTIKSEEDIEKYLGLSTLSVIPDRKDYINGSGKKKSKR
NDAGKRKAS
>gnl|bykdb|B0K4N2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter sp.] (length=227 residues).
MAEEEIDLREIFLIIRKRTKMIVIITLLATIISGIFSYFIATPVYKASTSLIVSRTQSSALNNSQIQVQDIQTSRMLAAT
YSEFVKSRRVLQPVIERLRLPLTVDQLKNSVDVAAKGNTEIIEISVKNSDPRKAAEIANAIADSFVENIVKIMNIDNVQV
IDKAIPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIKSPEDIKKYLDLPVLGVIPEIKN
>gnl|bykdb|B0KAR6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter pseudethanolicus] (length=239 residues).
MYTKERIKGGLKIAEEEIDLREIFLIIRKRTKMIVIITLLATIISGIFSYFIATPVYKASTSLIVSRTQSSALNNSQIQV
QDIQTSRMLAATYSEFVKSRRVLQPVIERLRLPLTVDQLKNSVDVAAKGNTEIIEISVKNSDPRKAAEIANAIADSFVEN
IVKIMNIDNVQVIDKAIPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIKSPEDIKKYLDLPVLGVIPEIKN
>gnl|bykdb|B0P2G1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. SS2/1] (length=240 residues).
MYELENDDEIEIDLRELFLALKKKIVWILLTAIVFAGASGLITKFAMTPIYSSTAQLYVVSKGGLSQLTDLTMGSQLTQD
YMVIVKTRPVLEQVIADLKLDMDYKELEKKITVENPSDTRIMQITITDKDAALAQSITQDLAEVTAKTVAEKMDVKSPTI
IEKAYKADKPDSPSLKKNVLIGAVLGFILMAAAIVIQYLMNDTILKEEDIEKYLGINTLAQLPLVKGTTKRTKKVKRARE
>gnl|bykdb|B1B737 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium botulinum C str. Eklund] (length=228 residues).
MEDEITLDLRNLFFVLRKRFKLIIFITLIATILSGIISFFVIHPTYEATLSVFIGKNENEQSQKISYNESDIMMYQRLVK
TYATIAKTNDVLEKVIEKLKLDVTTKELDKMIEVTPQQDTQIMDIKVQNKDPERARKIAETLTPIFIQKSKITIPNGNVQ
ILDKVQVPEKPVKPHKGLNVAIVFFLGLMVSIGLVFVLEYMDNTIKTQEDVEKCLDIPVLGTIPDHLS
>gnl|bykdb|B1BNH4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens E str. JGS1987] (length=231 residues).
MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQYEATTKLFIGKQESQDNNAYNNNDVMMYQQLMKTYA
ELAKTSDLVTKAVKSADLDYNQEDIKAILKNLNATPSAETQILDLSFKGGNPKEVLKLTEALTNEFISESKELIPNGNVQ
VIQKPQLPEKPVSPNKKLNIFIAFVLGLMVGVGVVLLLEYLDNTFKSREDLENTLDLPIIGTIPDYDNVGK
>gnl|bykdb|B1BNK2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens E str. JGS1987] (length=220 residues).
MEEKTLDIQEILYALKKRYKLIIIIMLLPILFSAYKAYKMKPSYQSRVKFFIGKEGIKGTYSVGELEEYKKMIGAYVEIF
NNEDVVSKLLKKANIDLPTNYVRSGLSFIPGNGSIPTLEISYRSYNKEEVDQIIKVMTDEFESTVGEYIVNSNIEILDYP
KSITIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIKNKKELEKILPIPVIGEIPIHD
>gnl|bykdb|B1HR40 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lysinibacillus sphaericus] (length=238 residues).
MNEEMTIQSLVKVWQKRWFFILILMILSIGIAVFINYFLQTPIYEAETQLLVNQKSYENQQLIGAQNVDTDLRLINTYNV
IIKSPVILTKVIDVLALETSPETLMKQIEVSSANNSQVVNIRVQDEDEARAVKIANTIAEIFKEEIPILMHVDNINILFV
AQSSEHPVPVKPNKLLNLLIATIGGFSLALVLAYFLETLDRTIKTEQDIEEILSLPVIGVVSNIELLNSKKSRAGGSS
>gnl|bykdb|B1I966 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVK
DYREIILSQDVLEKVATNLKLDIPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDVT
TLEEARPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|B1MZT2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Leuconostoc citreum] (length=297 residues).
MNNVLELRQLWDIIRKHFFAIFFMALIGAGIGYGIAKFLIAPTYSASTSMLVNRSTDNTTGNANLSDQQADVQIINTYKN
LVISSNVLGDVADKLKQPKTEVVQPAKPAVYETLADGTRRLVSPEQKEITKTSSQQTYDFTVDQLKKMVSISNQQNSQVF
AINVTSKDPKQAALVANTVADSFKAKIGGFMKINNVSIIDSAKIDNKPVGPKIQIFMLAGLVILGGLAFLVALVRELSDT
TIKSPDEVSQLFGFTNLGVVSHIKGMKHFDMAPTVQSMSDDGKAMHSRSRLSRLNKD
>gnl|bykdb|B1R3V2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens B str. ATCC 3626] (length=231 residues).
MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQYEATTKLFIGKQESQDNNAYNNNDVMMYQQLMKTYA
ELAKTSDLVTKAVKSADLDYNQKDIKAILKNLNATPSAETQILDLSFKGGNPKEVLKLTEALTNEFISESKELIPNGNVQ
VIQKPQLPEKPVSPNKKLNIFIAFVLGLMVGVGVVLLLEYLDNTFKSREDLENTLDLPIIGTIPDYDNVGK
>gnl|bykdb|B1R3X7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens B str. ATCC 3626] (length=220 residues).
MEEKTLDIQEILYALKKRYKLIIIIMLLPILFSAYKAYKMKPSYQSRVKFFIGKEGIKGTYSVGELEEYKKMIGAYVEIF
NNEDVVSKLLKKANIDLPTNYVRSGLSFIPGNGSIPTLEISYRSYNKEEVDQIIKVMTDEFESTVGEYIVNSNIEILDYP
KSRTIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIKNKKELEKILPIPVIGEIPIHD
>gnl|bykdb|B1V0N8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens D str. JGS1721] (length=220 residues).
MEEKTLDIQEILYALKKRYKLIIIIMLLPILFSAYKAYKMKPSYQSRVKFFIGKEGIKGTYSVGELEEYKKMIGAYVEIF
NNEDVVSKLLKKANIDLPTNYVRSGLSFIPGSGSIPTLEISYRSYNKEEVDQIIKVMTDGFESTVGEYIVNSNIEILDYP
KSITIMPNKKKVILVGAIAGLVIALGIVFILDYLDNSVKNKKELEKILPIPVIGEIPIHD
>gnl|bykdb|B1V1Z3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens D str. JGS1721] (length=231 residues).
MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQYEATTKLFIGKQESQDNNAYNNNDVMMYQQLMKTYA
ELAKTSDLVTKAVKSADLDYNQEDIKAILKNLNATPSAETQILDLSFKGGNPKEVLKLTEAITNEFISESKELIPNGNVQ
VIQKPQLPEKPVSPNKKLNIFIAFVLGLMVGVGVVLLLEYLDNTFKSREDLENTLDLPIIGTIPDYDNVGK
>gnl|bykdb|B1YMM6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Exiguobacterium sibiricum] (length=243 residues).
MNETISLQELFSTLRKSLWRILALTIVAALISFAVSTFLIKPTYQAGTQILVTPKKQENDVIDASQVQSSVTLVNTYRVI
IKSPAILEKVQAEVKNAPDSISALNNMITVESEQNSQVINVSVQNTDAALASNVANSVAKVFSDDITDLMNVDNVKVLSV
SGIPTTPVSPNILLNTAIAAVVGFLLGVGLAFLREVLDRRIRTEEQVHQILDLPVLGSIPDIESKVFNASKKASKREAVK
QYG
>gnl|bykdb|B2GF32 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=256 residues).
MESEKNTNAIDLQHLWKLFVQHVRMILIWTVGLGVIAWGIATFVIPAKYTATTQILVNQRNSNDNNGQAYNNQQADIQMI
NTYKDIITNQVILKSASKQLANPSGSQRAYTLSVAKLKGLLTVSTQNNSQVFSLSAEAGNPTEAKVIANTVAKVFKKQIR
SMMNVNNVTIVSEATTPTSQSFPNKELFALAGLVLGFLISYVYVLIRDLTDTTVRDNDFMTNELGLTNLGQVGEIYMPAD
FEFKPFDDRAAGHRRV
>gnl|bykdb|B2ILP4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLSRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVKRPEDIENTLQMTLLGVVPNLSKLK
>gnl|bykdb|B3XL22 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=291 residues).
MNSSQQTANNTIDLHRLMMLCRKHIKMLIIWTLLAGILGYVVAQFVVVPKYTATTEILVNQKHENNDNGQAYNNQQADIQ
MINTYKDIITNQVILSKASKQLKNPVRVIKPAQPAEYRRNADGTRRLIKEAQPAVVERGGKSYSLSTDELKKAISVSTQQ
NSQVFSLQVKTDDPQESAVVANTVANVFKQQIKKIMSVNNVTIVSRASTPDEPSFPNKKLFALAGAVLGLMLSFLYILIG
DLMDTSVHDDDYLTNEVGLTNLGHVNHIEMSRDFKVNNQTSRRQNNGNRRV
>gnl|bykdb|B3ZRD5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus 03BB108] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALTKKINVANEKDSQVISVTAEDKDPKVARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVGENQSPIKPRPMLNVVIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|B5UQ74 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus AH1134] (length=248 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAVIQYNEVQTNIQLTNTYKVI
IKSPVILEQVKEKLGLNIPVQELNKRIEVTNEKDSQVVTVTAQDNDPKVARDIANTIAEIFKSEVAKIMSVDNVTVLSKA
EIMENQSPIKPVPMLNIAIAFIVGLMAAFGLVFLLEFLDNTVKKEEDVENLLGLPVLGVVARMDEETQINRSVHTSSSRK
VRGQTIGS
>gnl|bykdb|B6W7H3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Anaerococcus hydrogenalis DSM 7454] (length=230 residues).
MDEREIDLLELAKKLRQHLFSILCLAVIFAALSYAASVFVITPKYEATTTMIVSNSKNEDPNQKGDVDINQINANRALVS
TYSEIVKSKGVADKVIDNLKLDMDYGDFSQKVSIEPVKDTQIISVKVVDTVAERAMDIANATSMVFKDSVTKIMKVDNVQ
ILDKANLPEKPSSPNIKKNTLVGFVLGFILGVGISLFKELSDTTFKTTDDIQEAFDIPVLGMVPDKSKGE
>gnl|bykdb|B7HFH2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=247 residues).
MEETISLKELFHILRKRLGMILIIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGTALQIGEVQTNIQLTNTYKVI
IKSPVILEQVKQKLNLNTTVQALTGKINVMNEKDSQVISVMAEDKDPKLARDIANATAEVFQAEVAKIMSVDNVTVLSKA
EVVENQSPIKPRPMFNVAIAFVVGLMAAVGIAFLLEYLDNTVKKEEDVESLLGLPVLGIVARMDEETTNVKSHTLSSRKV
RGQTIGS
>gnl|bykdb|B7HXB5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGVAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEVQTNIQLTNTYKVI
IKSPVILDQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFIVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETPSVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|B7IQS9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEIQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTSQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENLSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|B8D0N1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Halothermothrix orenii] (length=474 residues).
MDNIPHNYEYEIDLTEYLGILNKRKWLILAITILAGVMGYILTSYKPAVFQSDALLMIDETPTTLNQIELSPFNNNNRDL
ITYSKLLKTRKLLKKVSQHFDENKVSVKYLITNLNIEIIPDTRLIKISIKHTDPVIARQIISYLIEEFIINNRNLKKSAT
VNARNYVARQLEKVSRDLKNIEAEVRHYKEENKSLVLSNFTQKIMQSMLDLEENLAEVEINIKTHRAALNHLYNKLQSSR
ELILSSKTLSKNPAYTELKNRLTELEIELDSLTTVYTDKHPEIIKLKAEKKSILNEISNTLGEVITSTIYTTNPVYNNLK
QELVKLETELTSLKAQKESLNIQFQKIKAKTEQLPKKELEYSRLLRKLEVSEKLYTMLLTRYQELKITEAMKVSDIITVD
PPVVPESPVGPNMKLNLAIAIIMGLFVGVFIAFILEFINNTIQRVEEIEEITDVPIIGYIPYIDKKNDGRDHNN
>gnl|bykdb|B9DUJ5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus uberis] (length=229 residues).
MNTTETPSMEIDVLSLLKKLWMKKFLILFMALFFGTLALLGSVFLIKPSYSASTRIYVINQQNAENITATDLQAGSFLVN
DYKEIITSRDVMKDVIATNSLSLSPDTLSKMISVTIPADTRVISITVTNHDPQQAKDLANSIREVASEKIKSVTKVQDVT
PLEKAQLPSKPSSPNIKRNTMIGMLIGGLFTIVIIVIKEVLDDRVKRPEDVEEALGMTLLGIVPNIDKM
>gnl|bykdb|B9IRQ7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=247 residues).
MEETISLKELFLILKKRLAMILIIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGTAIQLGEIQSNIQLTNTYKVI
IKSPVILDQVKSKLGLNITIQDLNKKIEVANEKDSQVVTVTAQDKSPSLARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVTENQSPIKPRPMLNVAIAFVVGLMAAVGLSFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETTNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|B9Y883 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Holdemania filiformis DSM 12042] (length=235 residues).
MYENDEIEIDLSRVFEIIKKYFKPFALIILAASIVAALITLFLIPKKYTAEAKLIIVQKSNPDSQQISYNDLQTSQKLVN
TYSEILKSEAISDEVIQNLKLEDLDTEGYQKIVKISSVKDTEVITIAVTSKDPKEAAVIANEIVDVFRDKIYSIMNIENV
TVLNSAKIPEKKSSPSNVKNTLIGFLLGCVIDGCIVLYILLNDRNIRTEEELKQIFDYPIIGLIPDMTHGTGGAE
>gnl|bykdb|C0C0F9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] hylemonae DSM 15053] (length=257 residues).
MNQNSVANREFENDEINIDLTELFLAVWSKIHLVILAGIFMALLAFAGTKMFITPMYSSTTKMYVLTKQDSSAGVTYSDI
QTGTQLTKDYMELVKSRPVLEQVIAVLNLDMEAEELEETITAETPVDTRILTIIVENQDPKLAKEIADALRESVSIQITE
IMDADSVNTFEEGNLPTEPSSPSLVKNMAIGGLLGLIIALGIIVLIFVLDDTIKTPDDVEHYLGLNVLTSIPIQEGVKKS
KKVKGMSARKFVKSMKR
>gnl|bykdb|C0CK72 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Blautia hydrogenotrophica] (length=236 residues).
METEHLNDELEIDLIDLLLYLKRKIWLLLLGLLAGVLLSALFTFKIVEPMYGASSMIYMRGAGNTISSLQDLQIGAELTN
DYEIIFTSRPILQEVIDELKLDMDYKELQARIELSNPTDTRILKVEYKDKDPKMASKVVNTLVQVSMDSVKEIDAKEPYL
VEEAVADNEPVSPSPKKNLAVGALAGLFLVGMVLVIRYVSNDKVCGEDDVTKALGVPVFCIIPESASMLYKGQKKR
>gnl|bykdb|C0CZV8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] asparagiforme DSM 15981] (length=264 residues).
METYMNDNEEIEIDLFELFMELKRKIWVILGVAVLCAGAAGAFSAFVLTPQYTSTAMVYILSKETTLTSLADLQIGSQLT
KDYKIIVTSRPVLEDVIEGLELNTTYKDLKKKITIDNPADTRILSISVMDPDPQMAKAIADKVAATASDYVGDIMEMVPP
KLIEDGEVPLLKTSPSNTKNALIGGLVGTLLVCGFVTARVVLNDTVRTEEDVTRYLGLTVLASVPARKGETPEDKEAMVS
SKSRKKTQTPSGRSRKKKREEKVR
>gnl|bykdb|C0EBA5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] methylpentosum DSM 5476] (length=240 residues).
MNEGLDLKQILRILVKRLWIIVLCLIVGGLGAFSITKFLMTPMYTSSATMYVNNKTKTDNVDIISGSDLVTSQKLISTYS
QIAQTPEVIDQVIRKLKLDMTVGQVRSMLSFSAVGETEIMRITATSEDPELAANLANAVTEFAPAVIKSVIGIGEDSVSV
LESARPSGSPSSPSTTKNTLIGALAGAVIAVLIVLLMEMFDTTIRGEEDVAAHYNIPVLTCIPELESTTKKGKYAYEYKS
>gnl|bykdb|C0GGR6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Dethiobacter alkaliphilus AHT 1] (length=223 residues).
MEQEIEIREIVAIVSKRWKAILALFIFAVATSLVASLYFIQPVYESSATLLVGKPTEGTQVVIQDVQLNRQLVKTYEEIA
RSGVVASAVIQDLNLDMSVNQLRGMINVRQVSDTEIISISVSDNSPDRAAFLANSVANTFITKVGTIMNLDNVSIIDEAE
PSTSAVSPRPNLNAAIAGVLAIMLGVFMAFALEYMDNTIKTPKDVEQNLELPLLGTIPFFEGE
>gnl|bykdb|C0WV34 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus buchneri ATCC 11577] (length=285 residues).
MENYLDLRQILGIIRKHIIFIIISFILCLIIAVGLEKFVITPQFTSTAQILVNQKKDTSVPGAAFQDQQADVQMISTYKD
IITNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASRPAVVKSTGTPYDVSVKQLQGAISVTNQQNSQVFAL
NVESDDPQKSAAIANTVAKVFKQKIRRIMSINNVTIVSEATPVKQKSFPKTSIVLLAGAVIGLLVGLGYAFIRELTDTTI
KDDEFLTNELRLTNLGHIAEIRKIHGSHLANKRHGEHLKPNHRRV
>gnl|bykdb|C0WW25 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum ATCC 14931] (length=256 residues).
MESEKNTNAIDLQHLWKLFVQHVRMILIWTVGLGVIAWGIATFVIPAKYTATTQILVNQRNSNDNNGQAYTNQQADIQMI
NTYKDIITNQVILKSASKQLANPSGSQRAYALSVAKLKGLLTVSTQNNSQVFSLSAEAGNPTEAKVIANTVAKVFKKQIR
SMMNVNNVTIVSEATTPTSQSFPNKKLFALAGLVLGFLISYVYVLIRDLTDTTVRDNDFMTNELGLTNLGQVGEIHMPAD
FEFKPFDDQAAGHRRV
>gnl|bykdb|C0ZHV9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Brevibacillus brevis] (length=250 residues).
MNEELNLREILLMLLKRWKLILLITSLCTIGTALVSFYLLTPIYQAKTEILVNRSLDSTVESMLSVAEIDSNLKLIETYR
VIIESPRVMERVLEVIGAGSTMEELLLQTKVEPVKDSQVISITVEDPDQGRAVLIANTIAKTFQEEVVKMLSMNNVHILA
EARNNPAAIPVSPKPILNSVIAFVLGLATSMVVVFLLVQMDTRLQSEKEVEEYLGLPVLATIAVIDKKTRKAFRQPKVEE
VRNEYEKAEA
>gnl|bykdb|C1CBD0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MEKQNTLEIDVLQLFRSLWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVSRDQGEKSGLTNQDLQAGSYLTK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVAVPVDTRIVSISVNDQVPEGASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKLNTLIGFLVGLIVINVTVLLLELLDTRVKRPEDIEDALQMTLLGVVPNLDKLK
>gnl|bykdb|C1CCB8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLSRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVKRPEDIENTLQMTLLGVVPNLSKLK
>gnl|bykdb|C1J9I2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=306 residues).
MNEQIDLAQLWNVFKRSFLAMIVFGIIGMAAAYFGAKAFIAPKYESDTSLLVNRKQDNDPNMQLNAQQADIQIINTYKDI
ITRPVVLQAVAEDLTSPQRVMVKKAKPAVYGTRYNAATGTRERYVTEEAQPAKYKLKPAKYSNISEEDLTKMVSVSTQQN
SQVFTVNVKDTSPVRARDIANEIAKVFEKKIAKIMSISNVSVVSRATANTIPVSPKLKLLSIVGLALGILIALSWGLVRE
LTDQTIKDIDFITDDLGLVNLGIVNYVVRMKDMDQAIQQSRATDSGNDVQDDLDGIDFPQRSRRRI
>gnl|bykdb|C2CI43 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Anaerococcus tetradius ATCC 35098] (length=231 residues).
MNEQEIDLIELSKKLVKHLPMIFLFAIVIGALSFVLSSFIITPKYDSNATMIVSNSTQNNDQNPQANVDYGQIQANKALI
STYSEIVKSKGIADKVIKNLGLDMDYEEFSSKVSIEPVKDTQIISVKVVDTIPERAMDIANETANIFKGSIGDIMKVDNV
QILDGATLPEEPSSPKIAKNTAIGLVLGFVLGMAVALFRELADSSVNSAEEVTEFFDIPVIGIVPDRKQGN
>gnl|bykdb|C2EFR7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius DSM 20555 = ATCC 11741] (length=247 residues).
MDNIKKEYRELDLFEIFQMLLRHWWIILLSGLLCGLAAFTYSKFAVVPQYTSVTKIYLSNKLTENQTNPTPSTELIKDYE
EMVKSRAVLENIIEKQDLRYSYGELSKKVNAENKDETQIISISVTDPNPVVAQRLANSIRDESIKHVTKVMKVISVGVVD
KANYPQSQSYPITIKWIEYGFLIGFVLSIGVLLIRFILDDTIKTSEDVEKYLGLSTLAVIPKISDSNNKKKYYGNYGKGK
SKRRKRV
>gnl|bykdb|C2EPK4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus ultunensis DSM 16047] (length=291 residues).
MEQEQKQTDNTIDLTQLLQICRRHIWALILWSIGLAVIGWGLAEFVVTPKYSSSAQILVNQKSRNNDPNAAYVTQQANMQ
MVTTYKDIVTSHKILEEASNRLANPTVVVKKAKKAVYRIDENGRRRLVRRAQPAVIERSGKSYVVSAKQLAKNISVNTQQ
QSQVFSISAESNTPAKARAEVNAVAETFSKEIPNIMSVNNVTIVARGTMGTQSSPNVKLYTLAGFVIGLVLSFAVIIIRE
MTNTTVRDDNYLTQELGLTDLGQVAHFHLSSSFSINKNKPNKRERLTRHRV
>gnl|bykdb|C2EWM2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus vaginalis DSM 5837 = ATCC 49540] (length=272 residues).
MEICRDHAKLFILWTVIMGIVGFVVAEFVITPQYTASTQILVNQKHDNADGQAYNNQQADIQVINTYKDIITNQVILSKA
SKQLENPVRVITPAKKAVYERNANGRRVLVRSAKPAVVERTNGKSYHVTTAQLKKAISVQTQQNSQVFTLNAKTNNAEES
AAIANTVASVFKQQIKHIMSVNNVTIISRANTPKAPSFPNKKLFTLAGAVLGLLLSFAYVLIKELTDTTVKSDDFLTNEL
GLTNLGAVGHIQMRADQDGIGTSRSDDHHRRV
>gnl|bykdb|C2JZS0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus LMS2-1] (length=304 residues).
MNEQINLSQLWDVLKKSFIAMILLGLIGMAVAYFGTKMLVAPKYQSSTSMLVNRKQDNNPNMQLNAQQADIQLINTYKDI
ITRPLVLKTVSKNLTSPQKVKVQKAEKAVYGTRYNSITGVQEKYLVKKEQPAKYKLEPAKYDNLTESDIASKVTVSSSQN
SQVFTISVTDTSPTRARDIANEIARVFKTKIATIMSISNVSIVSDALANPNPVSPKLKFLAVLGFVAGIVIAYGWGLIRE
LTDTTVKDIDFITDDLGLVNLGIVNYVQKMKSMDEAIRQKQNADEPDSVGFEPEGYPQRSRRRV
>gnl|bykdb|C2KHF2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Leuconostoc mesenteroides subsp. cremoris ATCC 19254] (length=299 residues).
MNNVLELRQLWHIIQKHFFAIIFMAIIGACAGYGVAKFVIAPTYSASTSMLVNRSADDTSTATANLSDQQADVQLINTYK
NLIISSNVLGTVSDKLKNPAPIVVQKAKDAVYKTLADGTRRLVTPAQKEITKPSNKKKYYLSVDELKSMVTISSQQNSQV
FSINVKSKDPKLAADVANEVADVFKDKIGGFMKINNVSIIDSAKANKKPVSPNTKLFTLAGLLVLGGLTFLYMLIKELAD
TTIKSPDEVSQLFGMTNLGVIGHVKPIKNFSMAPSSTTSVKINQSSGAQRSRLSRLDRE
>gnl|bykdb|C2LSE5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius SK126] (length=230 residues).
MTQENTKRVEIDVLALLHKLWTKKVFILFTAFYVAVFAFLGTYFLIQPTYTSSTRIYVVNQANDGKNLSAQDLQAGTFLT
KDYKEIITSNDVLSEVIKDEKLNMTEAELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVREVASEKIKNVTKVEDV
TTLEEAKLPESPSSPNIKRNVLLGAVLGGFLAVVGVLVREILDDRIRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|C2MTG4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus m1293] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIISAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEVQTNIQLTNT
YKVIIKSPVILDQVNEKLKLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTV
LSKAEVAENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETPSVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2NQN7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus BGSC 6E1] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALTKKINVANEKDSQVISVTAEDKDPKVARDVANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2P8H2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus 172560W] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQFNEVQTNIQLTNTYKVI
IKSPVILDQVKEKLGLNITVQELNNKIEVANEKDSQVVAVTAQDKDPKLARDIANTTAEVFKGEVAKIMSVDNVTVLSKA
ELSEELSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNIKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2PN23 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILAITLIVAIVMAIISFFFMTPLYQSSTQILVNQKKQEGTAIQIGEIQSNIQLTNT
YKVIIKSPVILDQVNEKLNLKMTAQDLTGKINVANEKDSQVISITVEDKNPKLARDIANATADVFKGEVAKIMNVDNVTV
LSKAEVAENQSPIKPRPMLNVAIACIVGLIASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETTNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2QJY6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus R309803] (length=247 residues).
MEETISLKELFYILKKRVAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQSLAGKINVANEKDSQVISVTAEDKNPKLARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPLPMLNVAIAFVVGLMAAVGLSFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETTNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2RG50 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus m1550] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQLGEIQSNIQLTNTYKVI
IKSPVILDRVNEKLNLNMTAQALTKKINIANEKDSQVISVTAEDKDPKLARDIANATADVFKDEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2SBU5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus BDRD-ST26] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGVAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEVQTNIQLTNT
YKVIIKSPVILDQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTV
LSKAEVAENQSPIKPRPMLNVAIAFIVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETPSVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2SSX9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus BDRD-ST196] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGTAIQYNEVQTNIQLTNTYKVI
IKSPVVLDQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNIDNVTVLSKA
EVAENQSPIKPVPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVESLLGLPVLGIVARMDEETANVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2T8T7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus BDRD-Cer4] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQLGEIQSNIQLTNT
YKVIIKSPVILDRVNEKLNLNMTAQALTKKINIANEKDSQVISVTAEDKDPKLARDIANATADVFKDEVAKIMNVDNVTV
LSKAEVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2ULR7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus Rock1-15] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMFQAGEIQTNIQLTNT
YKVIIKSPVILDQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTV
LSKAEVVENQSPIKPRPMLNLAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVESLLGLPVLGIVARMDEETMNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2V4M3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus Rock3-28] (length=251 residues).
MEELMEETISLKELFHILRKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQFNEVQTNIQLTNT
YKVIIKSPVILDQVKEKLGLNIATQELNKQIEVTNEKDSQVVSVTTQDKDPKLARDIANTTAEVFKSEVAKIMSVDNVTV
LSKAEVAENLSPIKPLPMLNVAIVFVVGLMAAIGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2WVG7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus Rock4-2] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSAIQYNEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALMGKINVANEKDSQVISVTATDKDPKLARNIANATADVFKDEVAKIMSIDNVTVLSKA
EVVENQSPIKPRPMLNVAIAFVVGLIAAVGLAFLLEYLDNTVKKEEDVEKLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2XJI0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus F65185] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQTNIQLTNT
YKVIIKSPVILEQVNEKLNLNMTAQELTKKVNVANEKDSQVIAVTAEDKDPKIARDIANATADVFKGEVAKIMNVDNVTV
ISKAEVAENQSPIKPVPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C2Y451 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=247 residues).
MEETISLKELFHILRKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNIQLTNTYKVI
IKSPVILDQVKEKLGLNITVQELNNKIEVANEKDSQVVAVTAQDKDPKLARDIANMTAEVFKGEVAKIMSVDNVTVLSKA
ELPEELSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C2YZB3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus AH1271] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNIQLTNT
YKVIIKSPVILDQVKEKLGLNITTQELNQKIEVANEKDSQVVAVTAKDKDPNLARDIANTTADVFKGEVAKIMNVDNVTV
LSKAEIAENQSPIKPRPMLNVAIAFIVGVMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C3EBC1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar pakistani str. T13001] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSAIQFNEVQTNIQLTNT
YKVIIKSPVILDQVKENLGLNITVQELNKKIEVANEKDSQVVALTAQDKDPKLARDIANTTAEVFKGEVAKIMSVDNVTV
LSKAEVAENQSPIKPAPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C3GBJ9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSATQILVNQKKQEGAMFQAGEVQTNIQLTNT
YKVIIKSPVILDQVNEKLNLNMTMQELTKKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTV
LSKAEVAENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C3GRR1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALTKKVNVANEKDSQVISVTAEDKDPKVARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETTNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|C3H980 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] (length=251 residues).
MEELMEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNIQLTNT
YKVIIKSPVILDQVKEKLGLNMTVQELNNKIEVANEKDSQVVAVTAQDKDPKLARDIANTTAEVFQGEVAKIMSVDNVTV
LSKAEVAENLSPIKPRPMLNVAIAFVVGLMASIGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|C4VP07 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus jensenii 269-3] (length=290 residues).
MEQLQENNTIDLAQLLKILRRHLVSLLVWSFGFAIVAWGVSALIIQPKYTAATQLLVNQKTDKNDIGAAYTLQQANMQVI
TTYKDIVTSSKILKDASNLLANPVKVVREAQPAKYQTLADGTKKLVKKAQSAVLERSGKSYMVSATQLSKAISVKTQQQS
QVFSITATADTPEKAEAEANAVAETFKNEIPKIMNVNNITIIADANKGKQSFPNVKLFTLAGLVLGFAVCLFIIILQELL
NTTVRDDEFMTKKLGLTNLGQIEHYHLSNSFTISKVKKSTKSSRLRSRRV
>gnl|bykdb|C4Z673 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Eubacterium eligens] (length=283 residues).
MQEKSKETENIEIDLREIFGVLIHRLWIIVVAALVCGSVAFMYSFFVITPQYESTTKVYILNKQNASGSVTYSDVQLSST
LSKDYEQLVTSRYVIEGVINDLKLDETYESLVKRVSASNATDTRIIAITVTDPEPEQAQKIANSVRDLAAKHITEVMDIE
AVNVVDQANLPDEPVSPSIPKWTIIGVLVGIVISAAVIIIQHLLDDTIKTSEDIERYLGLSTLALIPVNEGQNSNQGKRR
VPVPSKGGSKTDITMNDDKGRSFKASELENKKKSNGAKESVEE
>gnl|bykdb|C4Z8M6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Agathobacter rectalis] (length=262 residues).
MRGYVMEREQDFDNEIEIDLKDLFLEIISYWQWIILVTIATGAVAFAISRFMITPMYESTSELYVLSKSTSITSLADIQT
GTSLTNDYIVVVKGRPVLDQVIENLNLNESYKTLGGRVTLDNPSNSRVLNITVTDPDPQMAKTIADEIAKVASAYIAEKM
KQDPPTIIQSGYDDGGAVSPNIGKNTVIGAFAGAFLSIAVIVVSYLFNDTIIDTEDVEKKLGMNVLGTLPLDEAEDDGEH
GKGRKHSRGSHRKKRKKKSASA
>gnl|bykdb|C5D962 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Geobacillus sp.] (length=247 residues).
MEETISLRELFETLRKRLMLIVLITALATIISGVVSYFFLTPIYQASTQILVNQAKSEQQLYNYNEIQTNVQLINTYSVI
IKSPTILEKVKEELNLDLTVDELNEQIQVSSEKDSQVFSVTVQDPDPAMAAKIANKTADVFKNEIVKIMNIDNVTILSKA
EVKENQAPVKPKPMLNMAIAFVVGLMTGVGLAFLLEYLDNTIKTETDVEKHLGLPVLGAVSIISAEESKKAKKQVSMVKT
RGETIGS
>gnl|bykdb|C5EN02 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 1_7_47FAA] (length=260 residues).
MEKTYEDDEIEIDLLELLGEFRRKIWIILGVIVLFGGVAGAFSKFVLTPQYKSTAMVYILSKETTLTSLADLQIGSQLTK
DYKIIVTSRRVLNQVIDDMKLNLTYKELLEKVTIDNPQDTRILSISVEDPAPDMAKLIADKIATVSSDYIGDIMEMVPPK
LIEEGEIPIQKSSPSNVKNALIGALLGAVIVCGLITVQVVMNDTIRTEEDVTKYLGLSVLASVPIREGEKPEDKEAMISS
KSKTKTAPGKSRKKKGGRAS
>gnl|bykdb|C5NWJ9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Gemella haemolysans ATCC 10379] (length=232 residues).
MDNQEKDLIQLDIMLLLRRIWEKKVLIVLVTLLFTAASLAYSIFLVTPQYSSTTKVYVVNQKKDDKAITTQDVQLGSLLV
KDYKEIILSNKVMEDAAEKSGTEITARQLAGKVSVDAPKDTRIISITVRDKDPQVASDLANTVKEVSADQIKDVTKIEDV
TTLEEAKAATSPSSPNIPKNGALATALGFILAVAGVILFELLDDRVKRAEDIEETMGLVLLGVVPDTKTGKR
>gnl|bykdb|C5QNG5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus caprae M23864:W1] (length=220 residues).
MENTLDLMRVWEIIKKNWKLLVIIPLIFLILSAIFTFFLAKPKYEASTQILVSQKEKESKMMAQEVQSNIQLVNTYAEII
KSPRILDDVAKENKDYSADKLSKMIDVNTEADSQILNVGVRSKSEKESEKIANDVAKVFSKDVPDIMSVDNVSILSKANG
TAEKVSPRTIMNLFAGLILGLVLAIIIAALREIFDKRIRTEEDVEKELGVPVLGSIQKIK
>gnl|bykdb|C6CS79 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus sp.] (length=254 residues).
MSSQLDLKEIVWLIRKKLWLVVLVTVLGASAAGAYSAWVMKPVYEAYTKLIVNSTAGQAGSFKLDLNMINTNLSLINTYK
EIIKTPAIMDLVVKKHPELGLTTQQLMHNIRFSSVNGTQVVTISYLDTDYKRAAQVVNTVSYVFQQQIPLIMKVDNVYIL
HTADSNDQPVKVKPETKLNIAIGFVAAFLLSITLVLALNYFDDTLRTESDVERYLGLPTLAAIPNIKQGDLKPKALAIGK
TTIGKEGEKNNVSQ
>gnl|bykdb|C6CSC7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus sp.] (length=254 residues).
MSEELDLREYFLIVRKRLLLIVIFVLVCTVASGVYTKMFKDPIYEASTKIVVNQPSQQLAVGQLDLNQINSNIKMIDTYK
EVIKTPAILGKVAEKYPQLGLSAKELTKKISVSSVNGTQVMTLAVQDVSYQQAAKIVNAISLVFQQEIPNIFQVENVSIL
NEALLDDQPAPVSPNVTLNIIIAFVVSLMIAVGIAFLLEYMDDTIKTETDVQRYLGQPTLAMVARVEASEFQTGSSRTEN
RQKAGGLENVTIGE
>gnl|bykdb|C6CW36 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus sp.] (length=254 residues).
MEIKQYFRIVLKKWWLILILVLLASVISGIKSSFYTTPIYEATAKLIVNQSSGAYQQGYPDVGLLQSNLMLMDSYKEIIS
SAAILDKVVEKNPSLSDSSYEMSKILQVYSYENSQVLNLTYQATSYESAAETVNAISLVFKEEIPKIMNVDNITILNEAK
VKDTRPHNPVNINLVTSILVAFVLSLLASVALVLILHFLDDTLKSEEELKEVLGIPLLAAMGKMKKEDLRGRRGEQVLIR
KEAGGDNVYASINQ
>gnl|bykdb|C6LCS6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Marvinbryantia formatexigens DSM 14469] (length=249 residues).
MEENTSYTNEIEFDLKAIFTAVRDRIFLLILVAAAGMIITYLCSRVFITPTYDSTTKIYVLNRQNSDAAAITYSDLQSAT
QLTKDYMELVTTRPVLEAVISALELENISYEELADKISVSTATDGRIISIRATDENPQEAKAIADEVRNAVSAQIIKVMD
VEAVNVVEEANLPEKKARPANIKNAVIGGTVALLVALVIILIQTVMDDRIKNADDVQNYLGVSVLGTIPMDEKKQRRKQV
KKKKAKKKF
>gnl|bykdb|C6LDI9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Marvinbryantia formatexigens DSM 14469] (length=262 residues).
MELINNNPGLKNDEIRINLIELFYALLHKMKVIIFAVILGAAAAFTVTKILITPMYSSSSMIYIVGDSLDVSFLVNMEVG
TALTADYQMIATSRPVVDQVIENLELDMTYENLEKAIEVTNTTDTHILKITVSDSDAERAKRIVDELTVILIDTAAEVMD
SAKPNIIQNGYVSQYPDSPSIMKNTFLGALAGFIISCVSVISAFIMNDTINTEEDIEKYLGLNMLGVIPKSEKDDHIPDS
GGKKTRKKKHQGASVCRLHLKN
>gnl|bykdb|C7ISF8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter ethanolicus CCSD1] (length=227 residues).
MAEEEIDLREIFLIIRKRTKMIVIITLLATIISGIFSYFIATPVYKASTSLIVSRTQSSALNNSQIQVQDIQTSRMLAAT
YSEFVKSRRVLQPVIERLRLPLTVDQLKNSVDVAAKGNTEIIEISVKNSDPRKAAEIANAIADSFVENIVKIMNIDNVQV
IDKAIPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIKSPEDIKKYLDLPVLGVIPEIKN
>gnl|bykdb|C7RGH5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Anaerococcus prevotii] (length=232 residues).
MNEQEIDLIELSKKIGKHLPMIIIFSIIVGAASFLLSKFVITPKYDSNTTMIVSNSNQNNDPNNPQTNVELGQIQANKAL
ISTYSEIVKSKGIAERVINNLGLDMDYEEFSSKVSIEPVKDTQIISVKVVDTIPERAMDIANETANIFKSSIGEIMNVDN
VQILDGAILPEEASSPNIKKNTAIGIILGFVLGVAVVLFKEIADSSVKSSEEVTEYFDIPVIGIVPDSEQGN
>gnl|bykdb|C7XKF2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus 125-2-CHN] (length=292 residues).
MEQEQKQTENTIDLTQLLQICRRHIWALIIWSVGLALVGWGVANFIISPKYTSNAQILVNQKANKNDPNAAYNTQQANMQ
MVTTYKDIVTSHVILQDASNRLANPVRVVKKAKPAKYKTNAEGRRVLVRKAQPEVVERSGKSYSVSTSELAKSVSVNTQQ
QSQVFSISATADTPEKAKVEANAVARSFRDQIPNIMNINNVTIVAPATDGNQSSPNVKLFTLAGFVIGLVLSFAVVLIRE
MSDTTVKDDAFLTDNLGLVDLGQVSHFHVSSSFVIRKKNKNSNGPKRRSRRV
>gnl|bykdb|C8VYQ7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfotomaculum acetoxidans] (length=221 residues).
MELRDILGILKKGKWFLIILPIAAMLTSGIVSYFLITPIYKSSTTLMVGKTYAGENGPLLQYNDILTANQLVKTYSQIAK
SRTVAEKIIEQEKLDITPEAFSAKINVEPVRDTQLISISIEDASPDKAARLANISGQVFMKKVVEVMKLDNVNIVDPAVP
APAPVKPNKKMNILLAGVIGLMAAVGLVFLLEFLDQTIKTNEDINRYLELPVLGVIPKIDA
>gnl|bykdb|C8W5K3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfotomaculum acetoxidans] (length=223 residues).
MELEIKDIIRILKKGKLLLLILPFIAVLTSGIISYYFLTPVYSATATILVNNKSQRIMGGLDYQDIMLSTELAKTYSKIA
VSRTVAEKVLQVEKLDITPDQFIGKVSVQPVKESQLINITVVDPNPNTAAHLANITSRVFVEIIVDIMELNTNGAKVIDI
AIPSNSPIKPNEKLNILIAGLLSLMIAIGILLLREFIDQTVKSNEDIERYFGLPVYGNIPKIK
>gnl|bykdb|C8ZXT8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus gallinarum] (length=259 residues).
MEETISLKEIFDILRKHLAAIFISLFAGLAFAGIATFFVITPKYSSQAQLIVTLPQSETTNVNDVNTNLQMINTYKDMIV
SDLVLNEVKDRLESESNVKMTAGEIKDAISVNQSQNSQMFSIQATNPNAVTAQKIANTTALVFQENAKDVMNVDKISIIS
SAVASTSPVSPNNKLNLAIGLVLGLMVGVGLAFLFELLDRTVKDDKFVTETIGYTILGTVPQMSQKELNATIQKKPARPT
LKKPTNEKTTESRRSRSRV
>gnl|bykdb|C9A6V4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus EC20] (length=259 residues).
MEETISLKEIFAILRKHLAAIFISMFAGLALAGIFTFFVITPKYSSQAQLIVTLPQSETTNANDVNTNLQMINTYKDMIV
SDLVMTQVKDRLESENNLDLTVGQLKESISINQSQNSQMFSIQATSTNAVSAQNIANTTALVFQENAQDVMNVDKISIIS
SAVASTTPVSPNNKLNLAIGLVLGIMIGVGLAFLLELLDRTVKDDKFVTETLGFTVLGTVPQMSPKELAATIQKKPSAPF
IKKPQGDKSAESRRSRSRV
>gnl|bykdb|C9AAE4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus EC20] (length=244 residues).
MNKEINMKKLKQVLQQRIGWILMIISIPLLAMFLYLTFFAEPIYQKSAQLLISQSETTSGNRLENQTIQADLQLVSTYST
IIMSPRILNEVSEALEGSYDVAELSEILSVTNATNSQIIEINAYHQSPKIAAEIANTTASVFSEEIPKIMNIDNVTILAE
GTVLPQETPARPNKFLFYSLTTFLSLLFAFTYLFLLLVFERSFASNTEIEEVLGLKVIGEISKEKRVASFKTIQSRSLRG
RKRV
>gnl|bykdb|C9ALZ8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus faecium Com15] (length=259 residues).
MEETISLKEIFETLRKHVITILISMFAGLAISGIVTFFILTPKYSSQAQLIVTLPQSDTANVNDVNTNLQMINTYKDMIV
SDLVLNEVKDRLETEDNVKMTAGQIKDAISVNQSQNSQMFSIQATSTNAVTAQQIANTTSQVFQENAKDVMNVDKISIIS
GAVANTTPISPNNKLNLVIGLVLGMMVGVGLAFLFELLDRTVKDEKYVTDTLGFPILGTVPEMSAKELNAGIRKKGPAQT
QPKATNDKTAPSRRSRSRV
>gnl|bykdb|C9B453 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus faecium 1,231,501] (length=259 residues).
MEETISLKEIFGTLRKHLATIIISMFAGLAISGIVTFFILTPKYSSQAQLIVTLPQSDTANVNDVNTNLQMINTYKDMIV
SDLVLNEVKDRLETEDNVKMTAGQIKDAISVNQSENSQMFSIQAISTNAVTAQQIANTTSQVFQENAKDVMNVDKISIIS
GAVANTTPVSPNNKLNLVIGLVLGMMVGVGLAFLFELLDRTVKDEKYVTDTLGFPILGTVPEMSAKELNAGIRKKGSAPA
RPKATNDKTAPSRRSRSRV
>gnl|bykdb|C9BUG6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus faecium 1,231,408] (length=259 residues).
MEETISLKEIFETLRKHLVIIIISMFAGLAISGIVTFFILTPKYSSQAQLIVTLPQSDTANVNDVNTNLQMINTYKDMIV
SDLVLNEVKDRLETEDNVKMTAEQIKDAISVNQAENSQMFSIQAISTNAVAAQQIANTTSQVFQENAKDVMNVDKISIIS
GAVANTTPVSPNNKLNLMTGLMLGMMVGVGLAFLLELLDRTVKDEKYVTDTLGFPILGTVPEMSAKELNAGIRKKGPAQT
QPKATNDKTAPSRRSRSRV
>gnl|bykdb|C9CHY7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=259 residues).
MEETISLKEIFAILRKHLAAIFISMFAGLALAGIFTFFVITPKYSSQAQLIVTLPQSETTNANDVNTNLQMINTYKDMIV
SDLVMTQVKDRLESENNLDLTVGQLKESISINQSQNSQMFSIQATSTNAVSAQNIANTTALVFQENAQDVMNVDKISIIS
SAVASTTPVSPNNKLNLAIGLVLGIMVGVGLAFLMELLDRTVKDDKFVTETLGFTVLGTVPQMSPKELAATIQKKPSAPF
IKKPQGDKSAESRRSRTRV
>gnl|bykdb|C9LAS2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Blautia hansenii DSM 20583] (length=245 residues).
MMENTREDELEIDLKQIFYVLKEKILVILAVGLLFGCLSCVATKLLITPTYTSTSSMLLLTDQGLETVSDVQMGTQLTKD
YSVLITSRPVLDETVKNLDLELPYEELKEKISVENPEGTRILNITVEDSEPKMAQKIVNEVASISSQFIGDKMEVKAPKI
IDEGQLPTHKASPNMKKNALLGLLLGLFLSAGMIAVVAIMDDTIKTEEDIEKYLGLSTLTSVPDRKDYINEKKHGKKKKG
KKGRK
>gnl|bykdb|D0DJG9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus MV-3A-US] (length=292 residues).
MEQEQKQTENTIDLTQLLQICRRHIWALIIWSVGLALVGWGVANFIISPKYTSNAQILVNQKANKNDPNAAYNTQQANMQ
MVTTYKDIVTSHVILKDASDRLANPVRVVRKARPAKYRTNEEGRRVLVRKAQPEVVERSGKSYSVSTSELAKSVSVNTQQ
QSQVFSISATADTPEKAKVEANAVARSFRDQIPNIMNINNVTIVAPATNGSQSSPNVKLFTLAGFAIGLVLSFAVVLIRE
MSDTTVKDDAFLTDTLGLVDLGQVSHFHVSSSFVIRRKNKNSNGPKRRSRRV
>gnl|bykdb|D0DSJ3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum 28-3-CHN] (length=256 residues).
MESEKNTNAIDLQHLWKLFVQHVRMILIWTVGLGVIAWGIATFVIPAKYTATTQILVNQRNSNDNNGQAYNNQQADIQMI
NTYKDIITNQVILKSASKQLANPSGSQRAYALSVAKLKGSLKVSTQTNSQVFSLSAEAGNPTEAKVIANTVAKVFKKQIR
SMMNVNNVTIVSEATTPTSQSFPNKKLFALAGLVLGFLISYVYVLLRDLTDTTVRDNDFMTNELGLTNLGQVGEIYMPAD
FEFKRFDDRAAGHRRV
>gnl|bykdb|D0RXH3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. 2_1_36FAA] (length=230 residues).
MNKENQLVEIDVLSLIKTVWKRKFIILLTALVVAVLALGYSLFIAKPSYQSTTRIYVVNRQQTDNNTLTNQDLQAGSYLV
KDYKEIILSQDVLSTVISELKLPGTTAELSKSVSVSVPTDTRIVSITVKNSDPNQASRIANTLREVAAEKIIAVTKVSDV
TTLEEAEVPKSPSSPNIRRNVILGFLAGAMVMIVIVLIVEILDDRVKKPEDIEDVMGATLLGVIPNLKKL
>gnl|bykdb|D2ERX9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. M143] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLIILLVALVTGAGAFAYSAFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLV
KDYREIILSQDVLEKVATNLKLDMPAKTLASKVQVTVPTDTRIVSISVKNKQPEEASRIANSLREAAAEKIIAVTRVSDV
TTLEEARPATTPSSPNVRRNTLFGFLGGAVVTVITVLLIELLDTRVKRPEDVEDLLQIPLLGVVPDLDKMK
>gnl|bykdb|D2RIR1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Acidaminococcus fermentans] (length=482 residues).
MNEQEIDLRELWQIVRTNQKTIAKITGGFLGLAVAYLLIVPNTYQSTALLRIKQERGLSSSIMEQLPIGNAQLTKQQMNT
NAEILKSRHVVIPVIEQTEEEKDGKYPRYEDYVKSHIVTKPYKDTEILEVDVTGKSPEQAQEANQLLVQGFLDRLAQLSH
AESSATREFLEQRVKSSKKELDDAETKLKNYQVKHKIFSTDNQMKSLAERITDLDKAKAQNKLDMETAQAALGSINDQLA
GAGAALADSPSIQQAKNKLVDLETQKAGYTGKYTSENPKMKEINRQIGAARYSLRKEIQAIIAQKAPSSSSVQQKLLSDK
FTNEALIAVAQGKNNAIDQLEKKNADEIARLPQTQQGYLQVKRDADVAQEIYVMLAKRLEEAKVAEVMVPTEVQVVDEAT
LPDKPIKPRKLLTLVLALFLGLFGGTGYTIARTLLNRKIRTAADVEQYLELPVLGVIPEAGDHKQPEEEGFWAGLRRKLW
KK
>gnl|bykdb|D3AC81 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi DSM 13479] (length=243 residues).
MGTNQDDEIEIDLKELFYVIKRKLWIILLTGIVGAVGFGLFTAMVMKPVYTSSTMLYIVNKTTTLTSLTDLQLGTQLTKD
YKVLVTSRPVTAQVITNLDLNLSHEQLVRKIKVDNPTDTRILTISVEDTDPYMAKSIADEFASVASARMAEIMDSAPPNI
VEEAYLPTQKTKPSITKNTMIGGLAGVFLAGAIILVLFVMNDAIKTPEDVERYLGLNTLATIPVFEGETGTKKKKSKRKK
SGR
>gnl|bykdb|D3AE79 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi DSM 13479] (length=244 residues).
MKDTRDDEIEIDLLQLFWVMKRRLWIMILAVVVGAAAAMLYTTTLVEPVYTSSTMIYILNKTNNITSLSDLQLGTQLTKD
YKVLVTSRPVLEQVTENLGLNLGYQQLNGKITVNNPTDTRILTISAKDTNPETARAIADEVASVSVARIAEIMDSVPPKI
VETGNLPTAPSSPNVKKNTVLGGLAAGIAAAGIIILLYLMNDSIRNAGDIERYLDLNTLGQIPEFEENERRKKKKSRWGR
RAVE
>gnl|bykdb|D3FZP5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus pseudofirmus] (length=251 residues).
MEETISLRELYETLKKRIIMIITITVLAVATSGVVSYFVLTPMYQSSTQILVSQQAAGAASAALQQAGFDVDSKYIQTYN
VIMKSPYILDQVIDELDLNRTHGQLNGQLNVSQEGQSQVVTIRVEDANPAMAVNLANATAAVFQREIANLLRVDNVVILA
PAELSSNPTPVSPNPSLNMAIAFVVGLMAAVGLAFLLEYLDQSVRTEQDIEQLLEIPVLATIAHMDENETQVSKGLTKLG
SDDHAKKKSVG
>gnl|bykdb|D3LB11 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Oenococcus oeni AWRIB429] (length=233 residues).
MDTTISYQRLWQLFKKNFFFMLVSALIFALMAFAVCKFVITPQYQSTTALLVNRSQDDTAATALNDQQADVQLIYTYKDL
VTRPVILNKVAKELKSTYPSLTSTALSKMITVSSTTNSQIFSIAVRSTNSQESKDIANETASVFKNEAVKLMGKTISNVT
VVSSGLKDNTPVFPNTKLFSLAGFLIGGFLAVAYVLIKELSDNTYREPDYIDQLGFNNLGTVNYAAFHKRRNN
>gnl|bykdb|D4CG07 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. M62/1] (length=234 residues).
MEKNRYEENDEIDLLELFYELKKKLWLIILAAIIGGGAFGLYSKMILVPKYTSTAMMYVLSKETTLTSLADLQIGSQLTQ
DYKVMITSRPVLQQVVDELGLEYGYKALREKLTIDNPKDTRILTLSVEDPDPILAADIVNTVAECSSEYIGEIMEMIPPK
IVEEGEAAVAPTSPNVKKNAVMGAAGGIFLVCAFVAVRVIVNDTVKTEEDVEKYLKLSVLASVPEKDKGKRGQR
>gnl|bykdb|D4G1R3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. natto] (length=234 residues).
MNENMSFKELYAIVRHRFVLILLITIGVTLIMGFVQFKVISPTYQASTQVLVHESDGEENSNLSDIQRNLQYSSTFQSIM
KSTALMEEVKAELHLSESASSLKGKVVTSSENESEIINVAVQDHDPAKAAEIANTLVNKFEKEVDERMNVQGVHILSEAK
ASESPMIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVHKGRNRGIKHFGE
>gnl|bykdb|D4G2E2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. natto] (length=227 residues).
MIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERKEVQFNDVQTNLQLINTYNVIIKSPAILDEVIKEMGLSMTSQ
ELNDKITVSSEQDSQVVNISVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKAEVSEHPSPVSPKPLLNIAIAF
AAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEKTGSGHFGA
>gnl|bykdb|D4J4T5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Coprococcus catus GD/7] (length=265 residues).
MEKKRNDNEEMEIDLLELLMVMKKHLSAILLAGIVGLVIMFAYTSFLVTPLYSASSMMYVMPDNSNSMNSSTLSDMQVGQ
QLTSDYSSMIKSRSFMEDVIKKLNLTIDYQQLLEKVEVTNPTSSRILQVTVNDPNPQTAADIANEMASVAESKLKEITGM
QAIKIYEEAAVPDRPSSPSLKKNCALGLLAGIVLAMAVITILYLLDDTIKTEDDIEKYLGMTTLAVLPYNGRKQQRQAQK
HKKQRAKQERQTSRKRKEIETDEFN
>gnl|bykdb|D4JI68 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale M104/1] (length=257 residues).
MEREQDFDNEIEIDLKDLFLEIISYWQWIILVTIATGAVAFAISRFMITPMYESTSELYVLSKSTSITSLADIQTGTSLT
NDYIVVVKGRPVLDQVIENLNLNESYKTLGGRVTLDNPSNSRVLNITVTDPDPQMAKTIADEIAKVASAYIAEKMKQDPP
TIIQSGYDDGGAVSPNIGKNTVIGAFAGAFLSIAVIVVSYLFNDTIIDTEDVEKKLGMNVLGTLPLDESEDDGEQGKGRK
HGRGSHRKKRKKKSASA
>gnl|bykdb|D4JMC3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale M104/1] (length=260 residues).
MENNEPIRDQEIEIDLLALFHELVKHWKALVASMVLLAAVFGLYSKITFVPEYEASAEMYVLTKSTSITSLADIQVGSSL
TNDYEYVITGRTVLSQVIDNLDMDETYEQLSKRVSIENPTDTRVLKIVVTDTDLEASKTVADEIAKVSSQYIADNMEQSQ
PKIIQTAYASKTPVNNNILKNTVIGAVLGLILAAGIVVLGYMLDDTISNADDMETRTGLKVLASLPVDETEYDGAKTKRR
KKKKTQSSKSDDSKNKKRAV
>gnl|bykdb|D4LG05 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. SR1/5] (length=249 residues).
MNQKDMNDEMEIDLLDLAYMLMDHWHHLLLCLLAGALALNAFAFFFIEPTYESTAKLYVVSTSDDSVVNLNDLNLGTSLT
SDYEELMFSYPVLNRVIEKLKLDMDYEDLAKLYTLNNPSDTRVLQITATTTDPQLSMDLAETMAEEAVSYLPDTMSTKAP
NIAQHAKLPEHKAAPSYFKFTVIGGLLGLLICAGILIVRYLMDDTIHTAEEMEKYFGLVPLTTIPESSKVKSYDGEEEYS
SRKRRKRNE
>gnl|bykdb|D4LTH3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Blautia obeum A2-162] (length=248 residues).
MNQKEQNEEMEIDLLDLAYMLLDNWHYLLICLLAGALLLNAYSFFCIQPTYQSTSKLYIVSTSDDSVVNLNDLNLGTSLT
SDYEELMLSYPVLNRVIEKLDLDMDYNQLKQLYTLNNPTDTRVLQITATTTDPQLSMDLAETMAVEAVSYLPDTMSTKAP
NIAQHAKLPEYKAAPSYSRYTMMGGLLGLILCAGVLIVRYLMDDTIHTAEDMEKYFGLVPLTVIPESDQVAQMETTHSSK
KKRRKKNG
>gnl|bykdb|D4M2S1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques L2-14] (length=252 residues).
MGKTHDDDEVEIDLRELFYALKKRILVILAAILAGAVIAGAVTKLFITPVYSATATMLVLTKETTLSSLADLQIGSQLTK
DYNILITSRTVLQDVVDELNLDMTYKELKERITVENPSDTRILSITATDKDPEMAKKIADTLAKTSADFIGDKMEVTPPK
IIEEGEVPTIQTSPSTKKNVLIGALAGLVLSAGVIILLTLMDDTIKSEDDIENYLGLTTLASIPDRKDYITGKGLRNSSK
TTPKKKKKRRKK
>gnl|bykdb|D4MP31 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][butyrate-producing bacterium SM4/1] (length=234 residues).
MEKNRYEENDEIDLLELFYELKKKLWLIILAAIIGGGAFGLYSKMILVPKYTSTAMMYVLSKETTLTSLADLQIGSQLTQ
DYKVMITSRPVLQQVVDELGLEYGYKALREKLTIDNPKDTRILTLSVEDPDPILAADIVNTVAECSSEYIGEIMEMIPPK
IVEEGEAAVAPTSPNVKKNAVMGAAGGIFLVCAFVAVRVIVNDTVKTEEDVEKYLKLSVLASVPEKDKGKRGQR
>gnl|bykdb|D4MW28 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=240 residues).
MYELENDDEIEIDLRELFLALKKKIVWILLTAIVFAGASGLITKFAMTPIYSSTAQLYVVSKGGLSQLTDLTMGSQLTQD
YMVIVKTRPVLEQVIADLKLDMDYKELEKKITVENPSDTRIMQITITDKDAALAQSITQDLAEVTAKTVAEKMDVKSPTI
IEKAYKADKPDSPSLKKNVLIGAVLGFILMAAAIVIQYLMNDTILKEEDIEKYLGINTLAQLPLVKGTTKRTKKVKRARE
>gnl|bykdb|D4RJF5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus faecium E1679] (length=259 residues).
MEETISLKEIFETLRKHLVTIIISMFAGLAISGIVTFFILTPKYSSQAQLIVTLPQSDTANVNDVNTNLQMINTYKDMIV
SDLVLNEVKDRLETEDNVKMTAEQIKDAISVNQSQNSQMFSIQAISTNAVTAQQIANTTSQVFQENAKDVMNVDKISIIS
GAVANTTPVSPNNKLNLVIGLVLGMMVGVGLAFLFELLDRTVKDEKYVTDTLGFPILGTVPEMSAKELNAGIRKKGPAPA
RPKATNDKTAPSRRSRSRV
>gnl|bykdb|D4RX68 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Butyrivibrio crossotus DSM 2876] (length=236 residues).
MMEKLENKNKNDEIDLMKILRMLASKWMFIVITAVVLAGAAFIYFNFVVTPRYTSTARIMVINRQNSDSLTSTDLNSSTT
LSSDYVEIVKSRTVLEQVIANLDLKYSVGELKGMVSASIVNNTRMISIKVTDKDPILAKEITDDIATVTSERICEVMKVE
NMVSLVDSADLPTTPSSPATKRNTVIALLLGVVISSAVIIIIGIKDDRIKTQEDVEKIFGMSVLGLIPKFEGEGDK
>gnl|bykdb|D4YF14 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Aerococcus viridans ATCC 11563 = CCUG 4311] (length=245 residues).
MEKEYELYDLWLLFKKYFIRILNMTIIGATLAAIVVMFFVEPQYSSQAQLIVNQRSSQDTSIQYNEIQTNVTLVSTYRDI
ILGDGVLTEVNNSLDGKFTVPQLRNALRVEQSTDSQAFNISATMDTPGDAQNIVNSVITEFEKTLISIYGDDVSNLYVVS
SATFNPSPVSPNVVRVTIIGGLLGAMIMVAIALVIEVLDSRVKSSDDLIDLQMVKLGGIFELSEDQKEHSRVQSTVATKS
RERRV
>gnl|bykdb|D4YHG8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Aerococcus viridans ATCC 11563 = CCUG 4311] (length=257 residues).
MLEEDEMNDTQEISLIEILNILTANIWKIISTTVIGIVLAALVTFFLMTPKYTSTTDIVVNNAATATTENTITQSGLQAN
LTLLNTYQSLVSRPLVLDPAIADVPEAEGMTAAELAENVTVSMDSDSLLFTISVENESPYVAANLANAIAVSFSEVVQQV
LQVENVSIVTPAEPGQSPTSPNVILNIIIGALLGLIVGVVWQLVNAMLDNSVKSSDIVEELGWTLLGTIPQMDKSKVENT
RFKGNAVKDGSRNRRRV
>gnl|bykdb|D5AGQ4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
AKDYREIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAVQKVVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGIVPDSKKLK
>gnl|bykdb|D5DBK2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=250 residues).
MEETISLRVFFQVLRKRLWLIALITVIAATISAVISFFVLTPVYQTNTQILVNQAKSEQQLYNAGAVQTNVQLISTYNDI
IKSPAILDKVIDKLKLDSSAKSLSGQIQVTSSENSQVAQITVQDTNAKRATEIANTTASVFQKEVPKIMNIDNVSILSKA
DLATSKSPIKPQPLLNIAIALVVGLMVGVGLSFLLEYLDNTVKTEQDIENLLELPLMGVITNIKDVPKVTNVQRPDMNAR
VPQRGETFGS
>gnl|bykdb|D5DY80 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=250 residues).
MEETISLRELFAVLRKRLWLIVLITIVAATVSAVISFFVLTPVYQSKTQILVNQAKSDEQLYNMQAVQTNIQLINTYNDI
ITSPVILDKVIKELKLDGSGQSLSGKIQVINAKDSQVVQIVVQDTNAKRATDIANTTASVFQKEVPKIMNVDNVKVLSKA
TVGESSSPVKPQPLLNVAIAIVVGLMLGIGLSFLLEYLDNTLKTEQDIENILELPVMGVVTTIKDVPKATNVQRPDITAR
VPQRGETFGS
>gnl|bykdb|D5GZJ9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=292 residues).
MEQEQKQTENTIDLTQLLQICRRHIWALIIWSVGLALVGWSVANFIISPKYTSNAQILVNQKANKNDPNAAYNTQQANMQ
MVTTYKDIVTSHVILKDASDRLANPVRVVRKARPAKYRTNEEGRRVLVRKAQPEVVERSGKSYSVSTSELAKSVSVNTQQ
QSQVFSISATADTPEKAKVEANAVARSFRDQIPNIMNINNVTIVAPATNGSQSSPNVKLFTLAGFVIGLVLSFAVILIRE
MNDTTVKDDAFLTDNLGLVDLGQVSHFHVSSSFTIRRKKNNSNGPKRRSRRV
>gnl|bykdb|D5HFS3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Coprococcus sp. ART55/1] (length=272 residues).
MNSNKKMAAVQDETTQIAAVNTYKNTEDDENEIDLLDMGMALLEKLPYIILCFLIGAVLFNAFAYFLIKPTYQSTAKLYV
VSASDDSIVNLQDLNIGSSLTKDYEDLILSYPVLDQVIEKLGLDMDSEGLAKMITLENPSDTRVLKITVTSTDKQQACDI
ANTLANVSIEYLPDTMSTSAPNIAQVARVADQKVGPSYLKYTAIGALLGALIYCLIVIVGYLMDDTIHSADDMEKYFGIV
PLTTIPESDQFRTDDTEDEFGKKHNRKERVRA
>gnl|bykdb|D6E0V3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale DSM 17629] (length=260 residues).
MENNEPIRDQEIEIDLLALFHELVKHWKALVASMVLLAAVFGLYSKITFVPEYEASAEMYVLTKSTSITSLADIQVGSSL
TNDYEYVITGRTVLSQVIDNLDMDETYEQLSKRVSIENPTDTRVLKIVVTDTDLEASKTVADEIAKVSSQYIADNMEQSQ
PKIIQTAYASKTPVNNNILKNTVIGAVLGLILAAGIVVLGYMLDDTISNADDMETRTGLKVLASLPVDETEYDGAKTKRR
KKKKTQSSKSDDSKNKKRAV
>gnl|bykdb|D6E329 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale DSM 17629] (length=257 residues).
MEREQDFDNEIEIDLKDLFLEIISYWQWIILVTIATGAVAFAISRFMITPMYESTSELYVLSKSTSITSLADIQTGTSLT
NDYIVVVKGRPVLDQVIENLNLNESYKTLGGRVTLDNPSNSRVLNITVTDPDPQMAKTIADEIAKVASAYIAEKMKQDPP
TIIQSGYDDGGAVSPNIGKNTVIGAFAGAFLSIAVIVVSYLFNDTIIDTEDVEKKLGMNVLGTLPLDESEDDGEQGKGRK
HGRGSHRKKRKKKSASA
>gnl|bykdb|D6R2T7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis] (length=231 residues).
MEKKENQMMEIDVLSMLRTLWLKKFTIVLGAVVFALLALGYSAFIAPKVYQTTTRIYVVSRQNTTESALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISDLQLKISPAELAKNISVSVPVDTRIVSITVKNKSPEEAARIANSLRNVAAEKIIEVTKVPD
VTTLEEAEIPKEPSSPNIRRNILLGFLVGGLVFALVIITVELVDDRVKKPEDIEDILGLTLLGVVPDMKKM
>gnl|bykdb|D6S4X3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus jensenii JV-V16] (length=290 residues).
MEQIHENNTIDLAQLLKLLRRHIGSLLIWSLGFAIIAWGVSSFMIQPKYSASTQLLVNQKTDEKNIGAAYTLQQANMQVI
TTYKDIVTSPKILKAASKQLANPVKVVKEAVPAKYETLADGTKKLVKKAQPAVLERSGKSYTISATELSKAISVSTQQQS
QVFSIKATSDTPEKAQAEANAVAQTFKTEIPEIMSVNNVTVIADANNGTQTFPNVRLFTIAGFVLGFVICLFVIILKEML
NTTVRDDEFMTKTLGLTNLGQIDHYHLSNSFKITRVTKSPSSSRIRSRRV
>gnl|bykdb|D6Y035 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus selenitireducens] (length=248 residues).
MEESISLKEIIDVLKKRLAMIVSITMIAVIAAASVSYFVLTPKYQASTQVLVSQAATGASILSSANPFESDARYIETYSV
ILKSPYILDQVVDELELEESHRSLNTALNVQQEGGSQVVTISIEDTDPSMAVSKANATAEVFRNEIETLLNIDNIHILSP
ADLADSMNPVSPNPELNIAIRLVVGLMGAVGLAFLLEFLDNTIRTEDDLDKTLGLPVLGAVTIMDQEEASVDDRMKPSEK
GREKHGVS
>gnl|bykdb|D6ZQI7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae serotype A19] (length=231 residues).
MMKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLV
KDYREIILSQDVLEKVATNLKLDIPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDV
TTLEEARPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|D7UYE3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Listeria grayi DSM 20601] (length=222 residues).
MGDVVDLSKVLKVLKQNLKWIVIIPVVFLIIAMALTYFFMTPKYASSTQILVNKKESNSQFMAQEVQSNLQLVNTYAEII
KSPRILESVSKNLDREFSSSEILSMLTVNNQSQSQILNISVRSNSRATSKKVANEVAKVFSKDIKKIMNVDNVSILSKAD
VKAVQVSPKPLVNAGIGIFLGLIVALLFIFLKQVLDKSLKTEEDVAEILDLPVLGIIQDFRK
>gnl|bykdb|D7VBW5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437] (length=252 residues).
MEQVITFDFIVKLIRQYWKVLLSLMILGGTIATVVTLWVIQPEYQANVQILVNRKHSSAGADLTGQQADVQMITTYKELI
TKPVVLKPARQTLMAETDIRRSLESLKQTVSVTSTANSQVFSIVVRDKNAKASAMIANQIAATFKDQVQHIIRVNNVTIV
APAETPDQPVAPKKIINILIGFVGGLILGLVYASVRILSNRRVQTLEYLADELMLTSLGIINHQQPVTATHDQPAIKPQP
VTSVVKAAVKRV
>gnl|bykdb|D7VC12 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437] (length=256 residues).
MMDQAVSFDFFIRLIRKYWRAIVSFTLVGLIVAAGLTFFVITPKYQSSVQILVNRKNTNAATEYVGQQADVQMITTYKEL
IAGQVVLNPAKQQLSKRYGIERSLNSLKSEVSVTSTTNSQVFSIAVTDANAKASATIANQIARSFKNQVQKIIKVNNVTI
VAPAETPSGTVSPKKPLNMLIGLVVGLLLGFVYAAIRMLTDRRVHDADFLTDELGLTSLGLVNHQHHHSMKKQALNLNGG
YHTHNDRTSSQAMKRV
>gnl|bykdb|D7WMM9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lysinibacillus fusiformis ZC1] (length=242 residues).
MKETITLQDMLKIVRENFLFIISFTLFAALVTAFISIFVLKPTYEAETQILVNQKNIEQPHLGVQQVETDLRLINTYNII
ITSSAILSKVINKLDLDVTPEVLMDQITVSSANNSQVVNINVVDKQAELAVDIANTIADVFQEEIQVLMTVDNVNILSVA
QLDKEPVPIAPNKTLYIVAASFIGFVISAALIIILESLDTTIKTEQDIEELVGLPIIGLISQISDAHHKSTRVKSRKTRR
GS
>gnl|bykdb|D8FLF7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] (length=295 residues).
MSAEQQNNEEVTIDLRRLFILIRKHIISILIWMIGLGLIAYGVSEYVLVPKYTASTQLLVNRKSTDANQAYANQQADINA
VTTYKDIITSNVILKGASKYLANPVTLVKKATPAKKAVYRTNDDGTRTLVKKAVKAKPAVYKRESKSYSVSASELASAVS
VTTTTSSQVLTLSATAETPAKAQAIANAVAKEFKEQIPKIMDVNNVTIVAEAPKGTKSFPKVSLITAIGVLAGLVISLLI
IIIKDLSDTTVRDDSFMTNELGLTNLGEIASITMPKDWTFTAKTAEKRGSSRRRV
>gnl|bykdb|D9QTC7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Acetohalobium arabaticum] (length=503 residues).
MDNLERQTTDSDITEDMVEIDLREYFTILWKRKMIIIGLLIVAIIGSLVASSLMTKIYQTSALVMVKEDKGMENLFSEQM
GALGSLAGSTSNKLATYTQILKSRSIIQQTIEELELKSKETGELISPQALRNKISISGGQEGSGNLITITVNYSDPVVAK
RIANTLVDKFQQMNQAMNQSDLQGAAGFVSKQLKEVKTRLANLEEKLLEYKKEHDVILPEKQGEDLLEKLTKLETAKSKA
EVELKQAEAGLKEVRANYNDQDKDIISARTIAQNPMVQKYKEQLSNLEVELTGLKESYTDNHPKVIATNRKIDEVTKRLN
ETVEEIVRSKTETINPIYQTLKEKVITLQSKIITTKVQIDTHQQQIKELEKELNALPDKALALARLKRKNKIAEKVYTML
RERKEELQIQKAMKTSDIVVIDPAVVGDEPKPIKPKTKLNVAIAIILATFMGVGIIFVLEYLDTTIKEEQDIEELTDLPV
LGTIPDFDTVDHSQGYGRDDQDG
>gnl|bykdb|D9S1J8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermosediminibacter oceani] (length=237 residues).
MEEINIYEEEISLREIISVLKKRLRLITVVVAICIMAAATYTFWIKKPVYESYTTIMVGKPVQRVQDSSAPITYQELQTN
RLLVSTYGEIAKSRSTLEEVLRRLNLNTTYEKLKSRIKVNLVKNTEIIEIRVSDHDPVMAATIANAVSESFSRQVIRIMN
VENVQVIDEAIPIYQKVQPKPVLNLSLSLILGLMMGVFFAFLQESFDTSIKSPEDVAKYLGLPVIGSIPYIEKGEVA
>gnl|bykdb|D9SR42 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium cellulovorans] (length=224 residues).
MELKEYWYIIKKRLILIISFTLLCGAISGIITTFVIDKIYTADISVLIGKQESSDSEKTSTTYNDILMYQKIVKTYSQIA
KSRKVADDVKEKLSLNMSSGALLGSMSVSSSTDTEFMTIRFSSKDPELAAKITNQWAASLKEISKKIKGSDNVQILDNAL
VPSSPSSPNVRSNVIMTLFFGFVLSIGLTFLVDYLDNTVKSEDDLSKILDSTVLGSIPDLKFEE
>gnl|bykdb|D9ST43 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium cellulovorans] (length=229 residues).
MEEERALVLGDFIRIFKKQIKLILLITILSTFLAGILSFLIIEPTYEAKSTIVVGKADRGSNDNPKYQFDDIMMYKNLIT
TYAEIGRSASVAENASKMLKDVSTKDILDSIIVIPKEDTQLIEFKVQNENPQEAYRILNAVCNAFMEEGERIYSGQNIKV
IDGAKIPEEPIKPNKLLNIAIAFFIGMVVSMGLAVLREYMDNTLKVEEDINKYLGIPVIGVIPKDVGKY
>gnl|bykdb|D9SVC8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium cellulovorans] (length=226 residues).
MDLHELLYIIKKRMVLMVSITLVIGASGWIFSTLFINKLYTSDISVIIGKNYRNPAEGESSIATYSDILMYQKAVKTYGK
IATSRTVASDVIDKLSLNYSPSALLGSVAVVTPSETEFMTIRVTLRNPEEAALIANQWALSLKEISKEIQGTDNVKILDT
AQVPKSPSSPNLKLNIIFSFGAGFSLSVVLCFLLEIFDTTIKSENDVLKLVSLPVLSSIPNFEIDE
>gnl|bykdb|E0I7B6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus curdlanolyticus YK9] (length=253 residues).
MELKEYIQTVMKRKWLIISIVLVACILSGIKGFFYTTPVYSASAKLVVNQSYEYNGISMLDYNLIQTNLMVINSYKEIIK
SKAIMDKVAAAYPDLGLSSDQLISGVSVSSSNESQIMDITFASTSYPQAAKAVNAIAKIFKGQNPSIMKVDNVTVLNEAN
VSATNPHPINMDPFSSLMISFIVSAMLAVGLAFLLDYMDDTIKTERDIEKALELPMLTLITKMDRSELKRKRPSKPQSHT
STQVGESTYVPAK
>gnl|bykdb|E0NHP5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Pediococcus acidilactici DSM 20284] (length=260 residues).
METAETQQISIGQILAILRKHIGLIFASTFIITLLAALMTFFVMTPKYSATTQILVNRKLSDDMAGAQLQQTQADVQMIN
TYKDIITSPTVLREADEKLTGLPGYKSGVDNLKSSISISSQQNSQVFSINAKSTNPNTAAKMANETAKVFKRKVVKIMSI
NNVSIVSKAAPDDDPVSPRTKLNIAAGIVIGFLLGVGLAFLREFSDRTVTSEEFLTEELGLKGLGIISEIDENEIRRKIA
PKIGGNKRRDDGETRMRRRV
>gnl|bykdb|E0PD82 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus equinus ATCC 700338] (length=228 residues).
MNSNDQASIEIDVFYLLRKLWSKKFFIIFIALVVGTVALLGSIFLIKPKYTSTTRIYVVSKTADNITSQDLQAGSYLVND
YKEVITSSEVLSSVIDQQKLALSTSELSDMITVDIPTDTRVISISVEDTDAQEAADIANAVREIAAEKIKAVTKVDDVTT
LEAAATPKHPSSPNVKKNLALGMLVGGALAVIVILVVEVLDDRVRRPEDIEEVLGMTLLGVVPDIDKM
>gnl|bykdb|E0PPH8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis ATCC 6249] (length=230 residues).
MKEKNVMEIDVFHLLKILWKRKLLIVLVAFVTGAVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLELPPKDLAIKIKVTVPVDTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVKRPEDIEDVMQIALLGVVPNLDKLK
>gnl|bykdb|E0Q2S9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 071 str. 73H25AP] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIVLVAFVTGAVAFAYSSFIVKSEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQGVLEKVATDLKLDLPPKDLAGKIKVTVPADTRIVSISVTDRLPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVKRPEDVEDVMQIALLGVVPNLDKLK
>gnl|bykdb|E0RZL4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Butyrivibrio proteoclasticus] (length=243 residues).
MNNRDDVLEINLGELFAVLMGRAFLIISAGIFFALAGLFLSKFVIRPEYESTTKIYILNKEENQTVTYSDVQISTQLTQD
YAELIKSRRVLEEVIQRLHLTDMEYKDLYDVLKVDTPSDTRIVAITVRDKDPLMAMKIANCIREVASEHITNVMDIDAIN
IAETANVPTDKASPSVARWTIIAGFIGAVVVAFFAILGYLLDDSIKSNDDVERYLGLSTLALIPLTTDEMDKKKKKQKPK
KVK
>gnl|bykdb|E0TTZ7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=248 residues).
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNDRKEVQFNDVQTNLQLINTYNVI
IKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNISVKDESAETAAHIANTIASVFKDKITSIMNVDNVSILSKA
EVSEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKSLQGIQSEK
AGSGHFGA
>gnl|bykdb|E0U2Z4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=234 residues).
MNENMSFKELYAIVRHRFVLILLLTIGVTLITGFAQFKVISPTYQASTQVLVHESDGEENSNLSDIQRNLQYSSTFQSIM
KSTALMEEVKAELHLSESASSLKGKVITSSENESEMITVAVQDHDPAKAADIANTLVNKFEKEVDERMNVQGVHILSEAK
ASESPMIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVQKGRNRGIKHFGE
>gnl|bykdb|E1LPE6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK564] (length=230 residues).
MKDQNTLEIDVFQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEKVVSDLKLDLTPKGLANKIKVTVPVDTRIVSISVNNRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIRRNTVIGAGLGAGLVIVVVLLIELFDDRVKRPEDIEDVMEIPLLGIIPNLDKVK
>gnl|bykdb|E1LQJ6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK597] (length=230 residues).
MKENKEIMIDVFQLFKVLWKKKIAIILTAIVAAVIAFGVSSFVLTPEYSSTTRIYVVNRNQSEKAGLTNQDLQAGTYLVK
DYKEIILSQDVLEKVISNLKLEKTVRELSKKIQVTVPVDTRIVSITVKNAQPEEASRIANALREVAAEKIISVTRVSDVT
TLEEARPALSPSSPNIRRNTLLAFLAGGVVMVVSILLFELLDDRVKRPEDVEEVMQIALLGIVPDLNKLK
>gnl|bykdb|E3CBR9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis F0405] (length=231 residues).
MNNKENQAVEIDVFAMLKTLWKRKFSIVLVALVFAIAAFGYSAFLAKKEYQSTSRIYVVSRQNQDNNALTNSDLQAGSYL
VKDYREIILSQNVLSQAIEELKLDLTPAELSKKISVSVPTDTRILSITAKDGDPKEAARIANGLRNVAAEKIISVTKVSD
VTTLDEAEVPQSPSSPNIRRNVLLGFIAGAGLMVVLMVVVEVLDDRVKRPEDVEELMGLTLLGVVPDIKKL
>gnl|bykdb|E3CP61 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus vestibularis F0396] (length=230 residues).
MTQENTKRVEIDVLALLHKLWSKKVFILFTAFYVAVFAFLGTYFLIQPTYTSSTRIYVANQTNDSKNISAQDLQAGTFLT
KDYKEIITSNDVLSEVIKDEKLKMTEAELAKKISVNIPTDTRLISISVSAKTGQDAQLLANKVREVASEKIKNVTKVEDV
TTLEDAKLPESPSSPNIKRNVLIGAVFGVFLAVVGVLGREILDDRIRRPEDIEETLGMTLLGIVPDTDKI
>gnl|bykdb|E3GPC7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Eubacterium callanderi] (length=236 residues).
MEEISLHDILDMLKENWKFIVILTLCFMIVVSVFTIFFMNKEYSSYTTLMIGKSEGYSDTNANANYNEVLTNQKLVGTYS
EIAKSKSVVSEVENNLNLDLSDGQLSKMIDVTTVNDTELIKITVTDEDPVEAASIANETAKVFMSNIGELMKISNLQVVD
AAEVNSTPVSPNLKLNVAIAFLLGIVVSVFIIFIREMLNTSVKSVEELKELIDGVPVVAVIPHSEELMTHSEGGKK
>gnl|bykdb|E3R265 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus CTV-05] (length=292 residues).
MEQEQKQTENTIDLTQLLQICRRHIWALIIWSVGLALVGWGVANFIISPKYTSNAQILVNQKANKNDPNAAYNTQQANMQ
MVTTYKDIVTSHVILQDASNRLANPVRVVKKAKPAKYKTNAEGRRVLVRKAQPEVVERSGKSYSVSTSELAKSVSVNTQQ
QSQVFSISATADTPEKAKVEANAVARSFRDQIPNIMNINNVTIVAPATDGNQSSPNVKLFTLAGFVIGLVLSFAVVLIRE
MSDTTVKDDAFLTDNLGLVDLGQVSHFHVSSSFVIRKKNKNSNGPKRRSRRV
>gnl|bykdb|E4Q5T6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Caldicellulosiruptor owensensis] (length=228 residues).
MEIKEYILIIRKRLPLIVATTLISTFIAAILSFYILPPIYKATVTLFAGRSTNSNGSNDNIQALYSDVLLGQQLVKDYRE
IAVSRTVLERVIKELNLKMTTEELSNMVSVQLKNDTRILMINIESKDPKFAATVANKLAEVFIEAVQRIMKIENVQIVDK
AVVPDKPEKPKKLLNTAVAFILGLMVGVGIAFFIEYLDNTIKTPDDLEKYLQLPVLAVIPDLDEGGKN
>gnl|bykdb|E4S7Y7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Caldicellulosiruptor kristjanssonii] (length=228 residues).
MEVKEYFLIIRKRIILIITTTILSSLIAAILSFYVLEPVYRASVTLFAGRSTNNSASSDSIQALYSDVLLGQQLVKDYRE
IAVSRTVLERVIKELNLKISIDQLKSMVSVQLKNDTRILMINIESKDPKYAALIANKLAEVFIEAVQKIMKIENVQIVDK
AVVPEKPERPKKALNIAIAFVVGLLIGVGLAFFIEYLDNTIKTPDDVEKFLQLPVLAVIPDLEKVERN
>gnl|bykdb|E4SDX3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Caldicellulosiruptor kronotskyensis] (length=228 residues).
MEIKEYILIIRKRLPLIVATTLISTLIAAILSFYILPPIYKATVTLFAGRSTNSDGANDSIQALYSDVLLGQQLVKDYRE
IAVSRTVLERVIKELNLNMTPEELGSMVSVQLKNDTRILMINIESKDPKFAATIANKLAEVFIEAVQRIMKIENVQIVDR
AVVPDKPEKPKKLLNTAVAFVLGLMVGVGIAFFIEYLDNTIKTPDDVEKYLQLPVLAVIPDLDEGGKN
>gnl|bykdb|E4SMV6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus] (length=289 residues).
MEQKQENTIDLTQLLRICRKHIWALILWSVGLALVGWGVSEFVISPKYTSTAQLLVNQKSRNNDPNAAYATQQANMQMVT
TYKDIVTSNKILTEASNRLANPTVVVKKAQKAVYRTDENGRRRLVRKARPAVIERSGKSYSVSAKELAKSISVGTQQQSQ
VFSISAKADTPAKAKAEVNAVAETFRKEIPNIMSVNNVTIVANGTNGVQSSPNVKLFTLAGFVVGLVLSLAVIIIREMSN
TTVRDDEFLTRELGLTNLGQIAHFHLSSSFTIKKSASMTNRGQTKRRRV
>gnl|bykdb|E5F5C4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWQRKLMILLVALVTSAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGTYLV
KDYREIILSQDALEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKNKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLKIPLLGLVPDFDKIK
>gnl|bykdb|E5VMX9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 5_1_63FAA] (length=240 residues).
MYELENDDEIEIDLREMFLALKKKIVWILLTAIVFAGASGLITKFAMTPIYSSTAQLYVVSKGGFSQLTDLTMGTQLTQD
YMVIVKTRPVLEQVIADLKLDMDYKELENKITVENPSDTRIMQITITDKDAALAQSITQDLAEVTAKTVAEKMDVKSPTI
IEKAYKADKPDSPSLKKNVLIGAVLGFILMAAAIVIQYLMNDTILKEEDIEKYLGINTLAQLPLVKGTTKRTKKVKRARE
>gnl|bykdb|E6IZC3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus anginosus F0211] (length=231 residues).
MKNQDNQTVEIDVLSLVKTLWRRKFLIVVTAFVIAIIALGYSTFIIKPTYTSSTRIYVVNRQPGDNSTLTNQDLQAGSYL
VKDYKEIILSQDVLAKVISDLKLNMQPSALAKKITVTVPTDTRIVSIAVSDGDAKEAARIANSLRQVAAEKIIAVTKVAD
VTTLEEAEIPNAPSSPNIRRNTLIGFLAGGVLISVVILVVEVLDDRVKKPEDVEEALGITLLGVVPNMNKL
>gnl|bykdb|E6KKR9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis ATCC 49296] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIALVAFVTGIVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVTTDLKLELPPKGLASKIKVTVPVDTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVEILDTRVKRPEDIEDVLQIALLGVVPNLDKLK
>gnl|bykdb|E6LD65 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus italicus] (length=264 residues).
MEKTYTVKQLLDMFKKHIQLILTCMFAGLALSGVVTFFIVTPKYSSQAQLVVTLPQSDSTNVNDVNSNLQMINTYKDFIV
SDLVLNQVQSRLDTQYKIAMEPKEIKKLISVEQSQNSQMFSIIVTTTKSVEAAHIANTVAKTFQDNAKDVLNVDRITITS
SAVAESDPVSPNKKLFLAAGLILGALIGIIGTLLIELMDRTVKDATFLTEELGFTLLGTVPDISDKDIAVNIKKTRKLVD
GELSQAATQKTESSTEPRRRRSRV
>gnl|bykdb|E6U7N3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Ethanoligenens harbinense] (length=236 residues).
MNETNEPTSYDQELDLGRLLLILKRGWLPILLASFLGLIVAFSLAAWAISPLYASSTMLVVNANNNQNNTTTITNDQLTT
AQELVNTYSVILTSDTVLDQVISDLNLKTDASALAKNISVEGVNQTQVLKITVKDTNPQVAKNIANDIARVAPSIIIQTV
KAGSVEVVSDAKLELKPVFPNIVLFSAIGLLIGFIGAYATLLVRDLLDHTFDSEEDVENRLGISVIGVIPVVQVKE
>gnl|bykdb|E6UHY5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Ruminococcus albus] (length=262 residues).
MEGKEISIQEILGILLSHIRMIIVVTILAGIVGYSYAKFVLPLQYTASIKIYVTNGKTGDQDNDDNLINAQDLNTARSLA
TTYIVILDDPLLYESISDKLLKDYDVDDLKNYFTISVDEKGNEYIPYGQIKRLINISAVNNTEVLQVTVTSQVPKFSADI
CSYISELAQEVITRTTKAGSVETVSPPKVPTTPSGPNISKYLMLGLIAGLAVSVGFALITSFFDNTVKSGEDIKERFGVP
VLAEIPDIFMDERGGNGKYGKY
>gnl|bykdb|E7GL39 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] symbiosum WAL-14163] (length=272 residues).
MEKVYQDDEIEIDLRELLFEMKKKIWFIIAGLLIGAAITGAYSKFLITPQYKSEAKLYVLSKETTLTSLADLQIGSQLTQ
DYKVLVGSRPVLQGVVDHMKLDMTYRELEKKLTIDNPNNTRILTLTIKDPNPYLAKSIVDEVANTASDYIGEIMEMVPPK
LIEDGEVASEKASPNVLKNTIIGGILGLLLVCGFIVVRVILNDTVKSEEDVSKYLDLPVLAVIPKKDGNEDRKKGQGKQK
KSRSTGRGAKAPEKGAGTRQKSGADRKGRGEN
>gnl|bykdb|E7GL56 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] symbiosum WAL-14163] (length=274 residues).
MEKMYTEDKEEIEIDLRELLFELKKRLWLILVALFLGIGIAGAGSAFLITPQYKSEAKLYILSKETTLTSLADLQIGSQL
TQDYKVLVSSRPVMEGVINHLKLDYSYKELAGKLTVENPQNTRILSLTVRDENPYMAKQIVDDIANTASDYIGEIMEMVP
PKMIEDGVVASEPYSPSIKRNALLGGILAVFLICALIAVRVVFSDTVKSEEDVERYLSIPVLAVIPKKREKGKKKEKHKS
PKEPGKGETRKGENGKEEIRKEVKGPKEEEQING
>gnl|bykdb|E7GL80 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] symbiosum WAL-14163] (length=293 residues).
MEKITHQHLDDDEIVIDFRELFYEFKRRIWWILLAAVLGTGAAGAYSYYLLTPQYISEAKIYVLSKETTLTSLADLQMGT
QLTQDYKELIGSRPVMQEVINTLNLDITYRQLAEKLKLENPKDTRILYLTVTDPNPYMAKAIVDEIANAASDYIGEIMEM
TPPKLIEDGMVATVQTSPNVKKNAAVGGLVMLVLACGVITLSVIMNDTIRSEEDVFKYLELPVLAVVPERKDSKVERSSS
SGRFFGRKKKVSGKRGSRKKTEITRKTPEETRQPEKTDQEIPAAALKDKTENS
>gnl|bykdb|E7RDR2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis MPA1U2] (length=240 residues).
MEETISLQDLFKTLKKRAGLIALMTILAITIAGVVSFLVLTPMYQTSTQILVNQEQSEAAQLTNQNIQTDLQLINTYSVI
IKSPAILDEVASQLDLDMSVEQLNSKITVATAQNSQVVDITVQDENPAQAVDIANTTAKVFEGEIQNLMNVDNVSILSPA
VLKDNPSPFAPNPKLNMAIAAVIGMMLGVGIAFLLEYLDTTIKDQQDIEEILDIPLLGVISPIKEEAKLEQTTSSKRRAG
>gnl|bykdb|E7RG09 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis MPA1U2] (length=244 residues).
MIETISLREIYSILKNKIRLILAITIVIMIITALISYYFITPIYQTSTQLLISQKQSEVIVDSQSIDIDLQLVSTYSEIL
KSPIILDQVISQLDLEMSYQEMVEKVNVEVTENSQLLTIFVTDPDPAVAVGIANKVAEVFETEIMELMNIDNVSILSPAV
VLENQTPVSPNPPLNILLSAIVGLIIGAAIAMILRYLDTTIRVEEDVTDLLNLPVLGAISPMNDEEDIPVNEPIAFKRRE
EQEW
>gnl|bykdb|E7S8W2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus australis ATCC 700641] (length=231 residues).
MKNQESQEIELDVVSLFKTLWRRKFSIIITALLFAIGALGYSAFVAKKIYQSTSRIYVVSRQNQENNALTNQDLQAGSYL
VKDYREIILSQNVLNQAIEELKLEMTPAELAKKVSVAVPTDTRILSITASDPDPQEAARIANGLKDVAAERIIAVTKVSD
VTTLDEAVVPQNPSSPNIKRNVVIGFVLGGVSISILVILSEVLDDRVKKPEDIEEVMGITLLGVIPHVKKL
>gnl|bykdb|E8JMT8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus equinus ATCC 9812] (length=229 residues).
MNSNDNASIEIDVLYLLRKLWSRKFFIIFIALVVGTVALLGSIFFIKPKYTSTTRIYVVSRSSDSSLTNQDLQAGSYLVN
DYKEVITSNEVLSSVIDQENLSLSTSELSDMISVDIPTDTRVISISVEDTDAQEAADIANTIREVAAEKIKSVTKVDDVT
TLEAAEVASKPSSPNIKRNAALGALVGGFLAIVGILVLEVLDDHVRRPEDVEEVLGMTLLGVVPDIDKL
>gnl|bykdb|E8JWI4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus cristatus ATCC 51100] (length=231 residues).
MNQENQMIEIDVLSLLKTIWKRKFLIILTALLTGILALGYSVFIAKPAYKSTTRIYVVNRQQGENPTLTNQDLQAGSYLV
KDYKEIILSQDVLASVISELKLSGSPSDLASKVTVTVPTDTRIVSITVTHADPAEASRIANTLREVAAEKIIAVTKVSDV
TTLEEAETPKTPSSPNIRRNTIIGVLAGGVLMVLVVVSVEILDDRVKKPEDIEETLGMTLLGVIPDMSKVG
>gnl|bykdb|E8K321 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus infantis ATCC 700779] (length=230 residues).
MKEQDKIEIDVLQLVKVLWKRKFLIALVALLAGITAFAYSSFVIKPQYTSTTRIYVVNRNQADKPGLTNQDLQAGAYLVK
DYREIILSQDVLEKVVADQSLTIDAKTLGKKVSVTVPADTRIVSISVRDGKPEEASRIANALREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMMATIAGVGFVVVIVLLVELLDDRVKRPEDIEEVMHLSLLGVIPNLEKLK
>gnl|bykdb|E8K787 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis ATCC 903] (length=231 residues).
MNNQENQAVEIDVFAMLKTLWKRKFSIVLVALVFAIAAFGYSAFLAKKEYQSTSRIYVVSRQNQDNNALTNSDLQAGSYL
VKDYREIILSQNVLSQAIEELKLDMTPAELSKKISVSVPTDTRILSITAKDGDPKEAARIANGLRNVAAEKIIAVTKVSD
VTTLDEAEVPQSPSSPNIRRNVLLGFIAGAGLMVVLMVVVEVLDDRVKRPEDIEELMGLTLLGIVPDIKKL
>gnl|bykdb|E8KDN1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus peroris ATCC 700780] (length=230 residues).
MKEQDKIEIDVVQVLKVLWKRKLMIALVAIATGVLAFGFSSFIVKPQFTSTTRIYVVNRNQGDKPGLSNQDLQAGSYLVK
DYREIILSQDVLEKVVTEQNLKFDAKALAKKIQVTVPADTRIVSISVKDGNPEEASRIANGLREVAAQKIISVTKVSDVT
TLEEARPALSPSSPNIRRNTILGVGVGAGIVILLAISVEVLDDRVKRPEDVEEVMHISLLGVIPNLEKLK
>gnl|bykdb|E8KLZ0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis VMC66] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|E8KUY7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus vestibularis ATCC 49124] (length=230 residues).
MTQENTKRVEIDVLALLHKLWSKKVFILFTAFYVAVFAFLGTYFLIQPTYTSSTRIYVANQTNDSKNISAQDLQAGTFLT
KDYKEIITSNDVLSEVIKDEKLKMTEAELAKKISVNIPTDTRLISISVSAKTGQDAQLLANKVREVASEKIKNVTKVEDV
TTLEDAKLPESPSSPNIKRNVLIGAVFGVFLAVVGVLGREILDDRIRRPEDIEETLGMTLLGIVPDTDKI
>gnl|bykdb|E8UV30 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter brockii subsp. finnii] (length=239 residues).
MYTKERIKGGLKIAEEEIDLREIFLIIRKRTKMIVIITLLATIISGIFSYFIATPVYKASTSLIVSRTQSSALNNSQIQV
QDIQTSRMLAATYSEFVKSRRVLQPVIERLRLPLTVDQLKNSVDVAAKGNTEIIEISVKNSDPRKAAEIANAIADSFVEN
IVKIMNIDNVQVIDKAIPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIKSPEDIKKYLDLPVLGVIPEIKN
>gnl|bykdb|E9DM16 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. C150] (length=230 residues).
MTQENTKRVEIDVLALLQKLWTKKVFVLFTAFYVAVFAFLGTYFFIQPTYTSSTRIYVVNQADDGKNLSAQDLQAGTFLT
KDYKEIITSNDVLSEVIKDEKLNMTEADLAKMISVNIPTDTRLISISVNAKTGQDAQSLANKVRDVAAEKIKKVTKVEDV
TTLEDAKLPDSPSSPNIKRNVALGAVLGGFLAIVGVLVREILDDRIRRPEDIEDALGLTLLGIVPDIDKI
>gnl|bykdb|E9FEC6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. C300] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKFLIALVAFVTGTVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLDLPPKGLASKIKVTVPVDTRIVSISVTDRLPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVKRPEDIEDVMQIALLGVVPNLDKLK
>gnl|bykdb|E9SAU2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Ruminococcus albus 8] (length=264 residues).
MEEKEISVQEILGILLAHIRLIVIVTVVAGVAGYSYAKFVLPLQYTSSIKIYVTNGVRNSHDDDDENELINGADINTARS
LAATYIVILDDASVYEAISDRLLEDYKIEDLRNYFTVATDEKGKEYIPTGQIKRLITIAAVNNTEVLQVTVTSEVPNFSA
DICSYISEIAPDMIIRTTKAGYVETVSPPRVPTSPSGPNIMRYLLLGLVAGLVISISIILVTNFFDNTVKSGEEIKERFG
VPVLAEIPDIFMDEKGGSSKYGKY
>gnl|bykdb|F0EKB8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus ATCC 12755] (length=259 residues).
MEETISLKEIFAILRKHLAAIFISMFAGLALAGIFTFFVITPKYSSQAQLIVTLPQSETTNANDVNTNLQMINTYKDMIV
SDLVMTQVKDRLESENNLDLTVGQLKESISINQSQNSQMFSIQATSTNAVSAQNIANTTALVFQENAQDVMNVDKISIIS
IAVASTTPVSPNNKLNLAIGLVLGIMVGVGLAFLLELLDRTVKDDKFVTETLGFTVLGTVPQMSPKELAATIQKKPSAPF
IKKPQGDKTAESRRSRSRV
>gnl|bykdb|F0FHA9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK353] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F0FQQ4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK678] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F0GT82 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Anaerococcus prevotii ACS-065-V-Col13] (length=234 residues).
MNEKEIYLIDLVDLIKKVFKHLFLIIILTILFGLGSFAYSNFVVTPSYNANATMIISSSSKNEDQQDLADIDFYQIQANK
ALISTYSEIVKSKGIADQVIKNLSLNMGYEEFSKKVSIEPVKDTQIISVNVVDSVPTRAMDIANETANIFKSSIGDIMKV
DNVQILDGATIPVEPVSPNVSKNTVVGAIIGLVLGIIISMFKELYDISIKSAEEVEEYLNLPVIGVLPDVKKGN
>gnl|bykdb|F0HVF2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. lactis DSM 20072] (length=295 residues).
MSAEQQNNEEVTIDLRRLFILIRKHIISILIWMIGLGLIAYGVSEYVLVPKYTASTQLLVNRKTEDANQAYANQQADINA
VTTYKDIITSNVILKGASKYLANPVTLVKKATPAKKAVYKTNDDGTRTLVKKAVNAKPAVYKRESKSYSISPSELASAVS
VTTTTSSQVFTLSATAETPAKAQAIANAVAKEFKEQIPKIMDVNNVTIVAEAPKGTKSFPKVSLITAIGVLAGLVISLLI
IIIKDLSDTTVREDSFMTNELGLTNLGEIASITMPKDWTFTAKTAEKRGSSRRRV
>gnl|bykdb|F0I4H6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK72] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F0IAY2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK115] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F0IJI1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK150] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F0IS52 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK160] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F0K0J8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=284 residues).
MSAEQQNNEEVTIDLRRLFILIKKHIISILIWMIGLGLIAYGVSEYVLVPKYTASTQLLVNRKTADANHADANQAYANQQ
ADINAITTYKDIITSNVILKGASKYLANPVTLVKKATPAKKAVKAKPAVYKRESKSYSVSASELASAVSVTTTDSSQVFT
LSATAETPAKAQAIANAVAKEFKEQIPKIMNVNNVTIVAEASKGTKSFPKVSMFTAIGVLAGLVISLLIIIIKDLSDTTV
REDSFMTNELGLTNLGEIAHITMPKDWTFTAKTAEKRGSSRRRV
>gnl|bykdb|F0NWJ8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus helveticus] (length=295 residues).
MEQEQKQTDNTIDLTQLLQLCRRHIWALILWSVGLALVGWGLANFVISPKYTSSAQILVNQKANKNDPNAAYATQQANMQ
MVTTYKDIVTSHVILQDASDRLANPVRVVMKAKPAKYRTNADGRRVLVRKAQPAVIERDGKSYSVSASQLAKNISVNTQQ
QSQVFSVSAEADTPEKAKAEANAVARSFRDQIPNIMNIDNVTIVAPATNGVQSSPNVKLFTLAGFVIGLVLTFAVILIRE
MTNTTVRDDTYLTQDLGLTNLGHVSHFHVSSSFKLIKKNNNKPAAKREQRKRRRV
>gnl|bykdb|F0PU65 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. finitimus] (length=247 residues).
MEETISLKELFHILKKRLAMILVITFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGSMFQAGEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALTKKINVANEKDSQVISVTADDKDPKVARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFLVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|F0SX23 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Syntrophobotulus glycolicus] (length=251 residues).
MPTQLYREFDLWKTLNVLWKKAWIIILGTGLSGAIALGITYYFMTPLYTASIKLYVNNSTELAVQITDSDMKASQSLIKT
YMTIIQSDTVLEKVITTLGLPPSNEQTKKIREMVSTNTIYDTEVFAVSVTAANPDEAAQIANTIAGIVPNYIGEIVQGSS
VKVVDMAKAPTEKASPSLALHTLIGLMLGLVLSISGILLTELLDRRIETESDLERMFKLPVLGSITDFEHVSKHGYASYN
YELSHQEGVQI
>gnl|bykdb|F0TGY3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus] (length=291 residues).
MEQKQEQENTIDLTQLLRICRKHIWALILWSVGLALVGWGVSEFVISPKYTSTAQLLVNQKSRNNDPNAAYATQQANMQM
VTTYKDIVTSNKILTEASNRLANPTVVVKKAQKAVYRTDENGRRRLVRKARPAVIERSGKSYSVSAKELAKSISVGTQQQ
SQVFSISAKADTPAKAKAEVNAVAETFSKEIPNIMSVNNVTIVANGTNGVQSSPNVKLFTLAGFVVGLVLSLAVVIIREM
SNTTVRDDEFLTRELGLTNLGQIAHFHLSSSFTIKKSASMTNRGQTKRRRV
>gnl|bykdb|F1Z125 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis NCFD 2020] (length=230 residues).
MNNMEKPTMEIDVLSLLKKLWTKKFLIIFMALFFGTLALLSSIFLIKPSYTASTRIYVLNKTQQADNLSATDLQAGGLLV
NDYKEIITSRDVMKDVIANDGVSMTPEELSKMIAVTIPADTRVISIAVTNHDPQAAKDLANSVRDVASEKIKSVTKVQDV
TPLEKAVMPTSPSSPNIKRNTLVGILFGAFLTIVTVIVGEVVDDRVKRPEDVEELLGMTLLGIVPNTNKM
>gnl|bykdb|F2C9N1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK330] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F2CH54 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK408] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F2I4B6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=254 residues).
MEEEISLLDLWQIIKEHIYVIFISSLVGVLLAAAYAFVLATPIYQSSTEILVNQSESKGQNNTLNQDINASLQLINTYSD
VIRNEVVLSPVIDQLNLQENPDQLREKISVESKNNSQVFSIIVNDPNPERAATIANTTAEVFQKAIRKMMNIDNVSIISK
AQASHSPVSPRKGLALLIGLVLGMGVGLVIAFIHELTDNTVKDVDFLTKEIGWNMLGRVSELSENDLKVTHKANELQQIY
HPDQDQGQGQRKRV
>gnl|bykdb|F2I6Z8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=234 residues).
MASFFRGLKRQWLFIFLGILLGIVVASAYNFLWAEAEYASQTQIVVTPKDSDKDKADEKKAGLKTYDDLLHTPLILQPVA
QAHQRDVETLSENIHLEADQQSAVFNVIVTDDNASQAQGLASDISKEFIQQLPQVLAVDKVTLLSPASYNEKPVSPNYGL
NLLLGAVLGGLISLVIQAIRVLNDDTVRSQAVVEEMGWSLIGVLPQMSEESIEVTRFKRRYRSQDDNDETKRRI
>gnl|bykdb|F2M2M7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus] (length=291 residues).
MEQKQEQENTIDLTQLLRICRKHIWALILWSVGLALVGWGVSEFVISPKYTSTAQLLVNQKSRNNDPNAAYATQQANMQM
VTTYKDIVTSNKILTEASNRLANPTVVVKKAQKAVYRTDENGRRRLVRKARPAVIERSGKSYSVSAKELAKSISVDTQQQ
SQVFSISAKADTPAKAKAEVNAVAETFRKEIPTIMSVNNVTIVANGTNGVQSSPNVKLFTLAGFVIGLVLSLAVVIIREM
SNTTVRDDEFLTRELGLTNLGQIAHFHLSSSFTIKKSASMTNRGQTKRRRV
>gnl|bykdb|F2QF91 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIALVAFVTGTVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLELPPKGLASKIKVTVPVDTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVEILDTRVKRPEDIEDVMQIALLGVVPNLDKLK
>gnl|bykdb|F3A498 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Gemella haemolysans M341] (length=232 residues).
MDNQEKDLIQLDIMLLLRRIWEKKILIVLVTLLFTAVSLAYSIFLVTPQYSSTTKVYVVNQKKDDKAITTQDVQLGSLLV
KDYKEIILSNKVMEDSAEKSGLGLTAKQLAGKVSVDAPKDTRIISITVRDKDPQVASDLANTVKSVSADQIKDVTKIDDV
TTLEEAKAATSPSSPNIPRNAVLATALGFILAVAGVVLFELLDDRVKRAEDIEEAMGLVLLGVVPDTKTGKR
>gnl|bykdb|F3AH93 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 6_1_63FAA] (length=241 residues).
MEKKMEEQSIDLIEIFYVLKQKILWILAAGLLFGCGAAAYTQFCIAPTYTSTSSMLVLSKETTLTSMADLQLGTQLASDY
QVLIKSKPVMEQVIENLNLKISPNALKGMVSITNPANTRILNVSVTSTDPKQAKILVDELAVVSSEYVGDKMEVIPPKII
EKGEIPTYKDGPNIKKNAFLGLFAGLFASAGVFALLAIMSDFIKTEEDIARYLDIPVLATVPDRKDYIGKNKKSGRKKKK
H
>gnl|bykdb|F3AHH1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 6_1_63FAA] (length=256 residues).
MEMNQPKDNEIQINVREIFFALLSKMGVILLSGVLLAVLAVTGTKLFMTPQYQSVTKMYVLSKQDNATLTSMDMQTSTLL
TKDYAELILSRTVTEAVIGKLDLDLKPEQLASKVEIGNTTDTRIVTIKVTDADPYQARDIANTLRDTAAEHIKNVMNIEA
VNVVDEANIPDSPVGPSAMKNGMIAGILGCVIAVMIVIIRYLTNDTIQTAEDVERYLDLSTLGTLPLEKNEKKEKRDVLE
IIKGDRHHDKCRNKST
>gnl|bykdb|F3ATF6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_46FAA] (length=252 residues).
MEKTHDEEMAIDLWELISALKKRALIILAACLLGGVVAGVYTKLCITPMYTATSSMLVTTQETTLTSIADLQLGSALTGD
YSILATSRSVLEEVIEDLGLNMNHHQLRGSITITNPEGTHIMEVTARSSDPETAKKIADTMAVVSAQYIKEKMEVAPPKI
IEEAEVPSSPVSPSMNKNVMMGALAGFALAAAIVILFAIMNDSIKTEDDIERALGIPTLAVIPDRKDYIDDHGGSKKKKG
KRRRQSKWRNKR
>gnl|bykdb|F3SM33 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK1087] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRKLTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F3UDW8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK1056] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F3UNJ5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK355] (length=231 residues).
MEKQEKQIVEIDILSLLRALWLKKFTIVLGAVLFSLLAFGYSVFIAKKMYQSTTRIYVVSRQNETQAALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISELKLQTSPRELTRHITVSVPADTRIVSITVKDDNPEEAARIANAFRNIAAEKIIEVTKVSD
VTTLEEATVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVKKPEDIEEVMGLTLLGVIPDMNRM
>gnl|bykdb|F3UUQ1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis SK49] (length=231 residues).
MEKKENQMMEIDVLSMLRTLWLKKFTIVLGAVVFALLALGYSAFIAPKVYQTTTRIYVVSRQNTTESALTNQDLQAGSYL
VKDFKEIILSQAVLSQAISDLQLKISPAELAKNISVSVPVDTRIVSITVKNKSPEEAARIANSLRNVAAEKIIEVTKVPD
VTTLEEAEIPKEPSSPNIRRNILLGFLVGGLVFALVIITVELVDDRVKKPEDIEDILGLTLLGVVPDMKKM
>gnl|bykdb|F3Y921 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Melissococcus plutonius] (length=273 residues).
MEETISIQEIIKTIKSHIGFIFVCAILGVGISGIMTFFMITPKYSSQAQLIVRLPQTTNANSNEVSANLQMINTYKDLIK
SDSLIGEIHKQLNATANIQLSTEELRNSIEITQSQDSQMFTIIATAKQATTAEKIANLTANTFQQKAKHTLNVDKVIIIS
PAFADMKPISPNKKINLALGLTFGLLIGIIDTFGLEFFDKTIKNEQFLSDELGLIVLGVVPTMVGKESETNYTKIKTVNT
AIINEDKDKSTLTQEKNEYAPETMPTRRSRKRL
>gnl|bykdb|F4BS20 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Carnobacterium sp.] (length=245 residues).
MMNTIGMVDIFKMLKKRWWVIVLLSLIGIALTTALTNYVLIPRYSSTTQLLVSRQDMNTQSIELGEIETNIQMINTYRDI
IEDPVVIDKVINELGNTMSEVELQQKVEVITQDDSQIFGIKVTDTDPNRAAEMANLMAATFQENIDGIINVENVAILSKA
KVNAVPISPNLSLNQVVGLLVGFLLGMILSIILETMDKKVRDEKVITEKLGWIHLGNISEMSKSETAIEEKNLVLQYQQI
TLKKF
>gnl|bykdb|F4BSE0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Carnobacterium sp.] (length=246 residues).
MEEEISLSELFATLKKRLSMVVSLSLIGLIVAAGFTFFIATPQYNATTQILVNRTTESTEGLQLNDINSNVQMINTYKDI
IKGPVILNEVRENLGTKLTTIELSEKIEITTQENSQVFSLTVTDESPYESAEIANSVATTFQDGIGNIMNVENVTIISEA
VPNTNQISPNNLLNLVIGSLVGVILGVGIAFVLEFMDKSVRDERFITETLGWSVLGSVSEMSNDELHAEVKVKRPEVNSR
RTKSRV
>gnl|bykdb|F4FXQ8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus buchneri] (length=285 residues).
MENYLDLRQILGIIRKHIIFIIISFILCLIIAVGLEKFVITPQFTSTAQILVNQKKDTSVPGAAFQDQQADVQMISTYKD
IITNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASRPAVVKSTGTPYDVSVKQLQGAISVTNQQNSQVFAL
NVESDDPQKSAAIANTVAKVFKQKIRRIMSINNVTIVSEATPVKQKSFPKTSIILLAGAVVGLLVGLGYAFIRELTDTTI
KDDEFLTNELRLTNLGHIAEIRKIRGSRFADERHGEHLKSKHRRV
>gnl|bykdb|F5LE49 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. HGF7] (length=252 residues).
MESGLNQYIQILRKRIWLIIITVFVVTVMSGIISYFFIDKQYAASTKLVVNKSSSYQGYDILDYNAVNTNIMLVNTYKEI
IKTPAIMEKVASRFTGEGLTSDMLAGMTKVTSIADTQVMTITATADNYATAAKLANAVSDVFKAEISGIMKVDNVTILNE
AKTTDNVGPVTPNIKLNVAAAFIVSLLISVGLVFLIEHLDDTVKTEKDVEKFLGVPTLAVISKIKTADLKNNAPSEPHKK
MAGETAYAGVNQ
>gnl|bykdb|F5LM70 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. HGF7] (length=251 residues).
MSIDFEIKRYLAVLRKRLWLILLIVAAGCLITGVVSKYYLKPVYQASTKLIVNSPADNQGMLRLDMNAINTNISLIHTYK
EIIKTPAIMDLVVKEHPEYGVTSDDLMRRIQFSSVSDTQIFTLSLEDASYSKAAQMINTVAQMFQKQIPNIMKIDNVFVL
HEADPAKTPAPVKPNVPLNVAISFLASLMFAIGLVFALEYFDDTLKTEEDVEHYLGLPTLVAVPEIRAGDMKPKRTPIGK
KVGEASGVPIQ
>gnl|bykdb|F5VSH0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis SK255] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIVLVAFVTGAVAFAYSSFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQGVLEKVATDLKLDLPPKDLAGKIKVTVPADTRIVSISVTDRLPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVKRPEDVEDVMQIALLGVVPNLDKLK
>gnl|bykdb|F5X0J8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=229 residues).
MNSNDNASIEIDVLYLLRKLWSRKFFIIFIALVVGTVALLGSVFLIKPKYTSTTRIYVVSRSSDSSLTNQDLQAGSYLVN
DYKEVITSNEVLSSVISQENLSLSTSELSNMISVNIPTDTRVISISVEDTDAQEASDIANTIREVAAEKIKSVTKVDDVT
TLEAAEVASKPSSPNIKRNAALGALVGGFLAIVGILVLEVLDDRVRRPEDVEEVLGMTLLGVVPDIDKL
>gnl|bykdb|F5X651 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pasteurianus] (length=228 residues).
MNSNDQASIEIDVFYLLRKLWSKKFFIIFIALVVGTVALLGSIFLIKPKYTSTTRIYVVSKTADNITSQDLQAGSYLVND
YKEVITSSEVLSSVIDQQKLPLSTSELSDMITVDIPTDTRVISISVEDTDGQEAADIANAVREIAAEKIKAVTKVDDVTT
LEAAATPKHPSSPNVKKNLALGILVGGVLAVIVILVVEVLDDRVRRPEDIEDVLGMTLLGVVPDIDKM
>gnl|bykdb|F6BI63 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermoanaerobacterium xylanolyticum] (length=227 residues).
MSEEEIDLKEILEILRKRWWLILIITVAAVVMSGILSFYVIKPTYQASTSLIVSKSQTAQYNNGQIQFQDVQTNRLLAAT
YAEIATSRSVLQEAINKLNLNMTTDQLKKNIDVAEEGDTEVINISVKDNDPKIAADIANAVAGSFVDNIVKIMKVDNVSV
IDEAIPPTTKISPKPTLNMSIAAILGIMVSIFIIFLFEYFDKTYKSIDDVKKYLDLPVLGVIPELKD
>gnl|bykdb|F6CNF6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfotomaculum kuznetsovii] (length=450 residues).
MAEPNQNPEFAEEVIDLRQYLKVLGKWRKVIALGTLLSVLTSAILSFFILPPVYEAQTLLLVVQATEKQQVYQTPQGGLE
GVVGSISRLPVLTMNTYLGQLKSEVLLQRVIDKLKLDPDLYTPRTLSDMIKATVVKDSNLIDVKVQNSDPVLAARIANTL
SREYLQLISEKNQEQMTRSVSFLKQQREATEKELQKAVEALKKFQAQPRGVAVLEQEFKKKSEDLAGYESQLKMAGVELE
QLSAGVARLEQELASTPKMVSVEKLDPDTGKIVTVQDVNPVYVSVSQQLSEKRAALAEKQAQVRGLKGVVDSLRAELDRL
QAELTGKKVQQDKLQSEVDRLKQTVETLAQKTTETQIARSIDLGDTSVIVVSEASVPSHPVKPKKKLNIAVAFVLGLLAS
TALAFVLEHLDNTIKTPEDVGRYLELPVLGVIPLVERRFNKNVPAEGKNV
>gnl|bykdb|F6IR92 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus MP-10] (length=251 residues).
MEQIITFDFMVKLVRHYWKVLLSLTLLGGLIATVVTLWVVKPQYQANVQILVNRKHSSAGTDLTGQQADVQMITTYKELI
TNSVVLKPARQDLMDEHGLRRSVNTLKQAVSVTSTANSQVFSIVVRDHNASASAVIANQIATTFKSQVKQIIKVNNVTIV
APAETPDAPVSPKKMINILLGLVMGLLLGLVYASVRILTNRRVQTLEFLTDDLQLTSLGLVNHQPVVATKTDNLAAKQRP
QTAAKPAIKRV
>gnl|bykdb|F6ITB3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus MP-10] (length=256 residues).
MMDQAVSFDFFIRLVRKYWRAIIGFTVAGLIVAAGLTFFVITPKYQSSVQILVNRKNTNAATEYAGQQADVQMITTYKEL
IAGQVVLKPAKQQLSKRFGIERSLNTLKSEVSVTSTTNSQVFSIAVTDADAKASATIANQIARSFKNQVKKIIKVNNVTI
VAPAETPKSAVSPKKPLNLLIGLVAGLLLGIVYAAVRMLTDRRVHDVDFLTDDLGLTSLGLVNHQHQHSMKKQVLNLNGG
YRPHNDRTSSQAMKRV
>gnl|bykdb|F7K0U2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 2_1_58FAA] (length=257 residues).
MNQNNTNMGMENDEITIDLMDLFQVVFKKLHLVLLAGIIAALVAVLVTKLFMTPVYTSTTKMYVLSKQDANSAVTSSDLQ
AGSQLTKDYMELIKSRSVMEQVISQLQLDMSVDKLSGEITVSNTADTRILSISVENESPKLAKEIADAVRESASVQITQI
TDADAVNMVEEGNLPKNPTSPNTMKNAMLGGILGIFLALGAIVLIYILDDTIKTPDDVERYLGLTVLTSIPIASGTPAAK
KVRGLSARKYTKRNGKK
>gnl|bykdb|F7K8E8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_57FAA_CT1] (length=251 residues).
MENTKGMEKDTVQQTDEIEIDLWEICLVLIHNLALIISVGIMAALVAFLATQLFGVPKYESTTKIYILNKQENNAVTYSD
IQLGTQLTKDYAELIQSRFVLEEVVQGMGLDLSYEEMKKKVSVTTPTDTRILAITVTDTDPVMAMQLANAIREAAAVHIM
NVMDIQAVNVSETANMPMEKAGPSVLKNTFIGGVIGVFLMIAIVLVRFLMDDTVKTPEDVEKYLRLSTLAVIPLNEGETD
AKKKKKKVKRN
>gnl|bykdb|F7K9V0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_57FAA_CT1] (length=245 residues).
MEENTMQQTDEIEIDLWEICLVLVHNLALIVSVGIMTALGTFLITQLFITPKYESTTKIYILNKQENNAVTYSDIQLGTQ
LTKDYAELIQSRFVLEEVVQGMGLDLSYEEMKKKVSVTTPTDTRILAITVEDTDPVMAMQLANSIREAAAVHIMNVMDIQ
AVNVSETANMPMKKASPSVMKNTFIGGVLGIFLMIAVILVRFLMDDTIKTPEDVEKYLQLSTLAVIPLNEGEEDGKKKKK
KVKRN
>gnl|bykdb|F7KL97 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium 3_1_57FAA_CT1] (length=245 residues).
MEENTIRQTDEIEIDLWEICLVLIHNLALIVSVGIMVALGAFLVTQIFGVPKYESTTKIYILNKQENNSVTYSDIQLGTQ
LTKDYAELIQSRFVLEEVVQGMGLDLSYDEMKKKVSVTTPTDTRILAITVTDTDPVMAMQLANAIREAAAVHIMNVMDIQ
AVNVSETANMPMDKAGPSVLKNTLIGGVLGVFLMIAIVLVRFLMDDTVKTPEDVEKYLQLSTLAVIPLNEGETDAKKKKK
KVKRS
>gnl|bykdb|F7V793 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp.] (length=265 residues).
MNQENNTFDKQKERRLHSSEQTEIDLGELFFCFLTRWKVLVLAFVIGAVAAGGISYGLITPKYAATSSLYMVSADRNKVV
DLTSLTAGSSMATDYEQLIRVRTIADDTIKDLHLKYDYKQLQGMIDITNVSDTRVLKITVRSENPEEAKEIANTLAYKAV
NYLPKLTKTLKPTIVDEAVTPDTQDSPNNTKNAAIGALIGLVVVLAVITVRFLMDDTFKTYEDIEKEFGVLPLAVVPEGD
FDKSRGAHKKKKTGRDRQNRRQGVK
>gnl|bykdb|F8DFF5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis] (length=231 residues).
MNNQENQAVEIDVFATLKVLWKRKFSIILVALVFAIAAFGYSAFLAKKEYQSTSRIYVVSRQNQDNNALTNSDLQAGAYL
VKDYREIILSQNVLSQAIEELKLNMTPAELSKKINVSVPTDTRILSITAKDGDPKEAARIANGLRNVAAEKITSVTKVSD
VTTLDEAEVPQSPSSPNIKRNVLLGFVAGAGLMVVLLVVVEVLDDRVKKPEDVEELMGLPLLGVVPDIKKL
>gnl|bykdb|F8DRU3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=291 residues).
MNSSQQTANNTIDLHRLMMLCRKHIKMLIIWTLLAGVLGYVVAQFVVVPKYTATTEILVNQKHENNDNGQAYNNQQADIQ
MINTYKDIITNQVILSKASKQLKNPVRVIKPAQPAEYRRNADGTRKLIKEAQPAVVERGGKSYNLSTAELKEAISVQTQQ
NSQVFSLQVKTDDPQESAVVANTVANVFKQQIKKIMSVNNVTIVSRASTPDEPSFPNKKLFALAGAVLGLILSFLYILLG
DLMDTSVHDDDYLTNELSLTNLGHVNHIEMSRDFKVNNQESRRQNNGNRRV
>gnl|bykdb|F8FCE3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus mucilaginosus] (length=224 residues).
MITSLCTALVSVQYLPRVYQASVKLLINSEGKGNGVDISSINTNLKLIKTYSEILRTSAVLEKVAAAYPEFMLTPEQMAE
MLEVKQSSDSQVMTLVIRDTDYRRAAETVNAISYTFQKEIENVMKVSNITTLGVANPEKPARPILPNTQLNVLVSVLVTL
LLGVGYAFLHHMLQDTVKNEKDVEELLGLSVLAAIPTVKSKDIALQLSPSGRKVGEIPYATAKQ
>gnl|bykdb|F8HDC4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=230 residues).
MNQDNTKSVEIDVLALLHKLWTKKLLILFTAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNKNLSAQDLQAGTYLV
NDYKEIITSNDVLSEVIKDEKLNLSEAELSKMVSVNIPTDTRLISISVKAKTGQDAQVLANKVREVASKKIKTVTKVEDV
TTLEEAKLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRIRRPEDVEDVLEMTLLGIVPDTDKI
>gnl|bykdb|F8KGP2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=291 residues).
MNSSQQTANNTIDLHRLMMLCRKHIKMLIIWTLLAGVLGYVVAQFVVVPKYTATTEILVNQKHENNDNGQAYNNQQADIQ
MINTYKDIITNQVILSKASKQLKNPVKVIKPAQPAEYRRNADGTRKLIKEAQPAVVERGGKSYNLSTAELKKAISVKTQQ
NSQVFSLQVKTDDPQESAVVANTVANVFKQQIKKIMSVNNVTIVSRASTPDEPSFPNKKLFALAGAVLGLILSFLYILIG
DLLDTSIHDDDYLTNELGLTNLGHVNHIEMSRDFKVNNQESRRQNNGNRRV
>gnl|bykdb|F8LJ76 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=230 residues).
MNQDNTKSVEIDVLALLHKLWTKKLLILFTAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNKNLSAQDLQAGTYLV
NDYKEIITSNDVLSEVIKDEKLNLSEAELSKMVSVNIPTDTRLISISVKAKTGQDAQVLANKVREVASKKIKTVTKVEDV
TTLEEAKLPSSPSSPNIKRNVLLGAILGGSVAIVAVLVREVLDDRIRRPEDVEDVLEMTLLGIVPDTDKI
>gnl|bykdb|F8LXJ5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus JIM 8232] (length=230 residues).
MNQDNTKSVEIDVLALLQKLWTKKVFILFTAFYVAAFSFLVTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTFLV
KDYKEIITSNDVLSEVIKDEKLNMTEAELAKMISVDIPTDTRLISISVKAKTGQDAQVLANKVREVASKKIKNVTKVDDV
TTLGEAKLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRIRRPEDVEDVLGMTLLGIIPDTDKI
>gnl|bykdb|F9HC66 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK1073] (length=230 residues).
MKENKEIGIDVVQLFKILWKKKLAIILTAVVTALLAFGLSSFVLKPEYASTTRIYVVSRNQSENTGLTNQDLQAGTYLVK
DYKEIILSQDVLEKVISNLKLEKTVKELTKKIQVTVPVDTRIVSIVVKDDQPEEASRIANALREVAAEKIIKVTRVSDVT
TLEEARPAITPSSPNIRRNTALAFLVGGAVMVVAVVLLELLDDRVKRPEDVEEVMQVALLGIVPDLDKLK
>gnl|bykdb|F9HJP7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 056 str. F0418] (length=231 residues).
MNQENQMVEIDIVSLLKIIWQRKFFIVLTALMTAILALGYSVFIAKPSYQSTTRIYVVSRQQSDNNALTNQDLQAGAYLV
KDYKEIILSQDVLSTVISELKLSSTTADLAGKVAVSVPTDTRIVSITVTNGDPNQASRIANTLREVAAEKIIAVTKVSDV
TTLEEAEAPKSPSSPNIRRNVMIGFVGGAVAMVVLVLIVEVLDDRVKKPEDIEEVMGMSLLGIVPDMRKLK
>gnl|bykdb|F9LZC3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis bv. 2 str. SK95] (length=230 residues).
MKEQNTIEIDVFQLFKTLWKRKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREAAAEKIIAVTRVSDVT
TLEEARPATTPSSPNVRRNTLFGFLGGAVVTVITVLLIELLDTRVKRPEDVEDVLQIPLLGVVPDLDKMK
>gnl|bykdb|F9M365 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis SK236] (length=231 residues).
MNNQENQAVEIDVFAMLKTLWKRKFSIVLVALVFAIAAFGYSAFLAKKEYQSTSRIYVVSRQNQDNNALTNSDLQAGSYL
VKDYREIILSQNVLSQAIEELKLDLTPAELSKKISVSVPTDTRILSITAKDGDPKEAARIANGLRNVAAAKIISVTKVSD
VTTLDEAEVPQSPSSPNIRRNVLLGFIAGAGLMVVLMVVVEVLDDRVKRPEDIEELMGFTLLGIVPDIKKL
>gnl|bykdb|F9MJW6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis SK569] (length=230 residues).
MKDQNTLEIDVFQLFRTLWKRKLVILLVTIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEKVVSDLKLDLTPKGLANKIKVTVPVDTRIVSISVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIRRNTVIGAGLGAGLVIVVVLLIELFDDRVKRPEDIEDVMEIPLLGIIPNLDKVK
>gnl|bykdb|F9P1W9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis bv. 2 str. F0392] (length=230 residues).
MKEQNTIEIDVFQLLKTLWKRKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATNLKLDMAAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDVT
TLEEARPATTPSSPNVRRNTLFGFLGGVVVTVITVLLIELFDTRVKRPEDVEDVLQIPLLGVVPDLDKMK
>gnl|bykdb|F9PEU3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus infantis X] (length=230 residues).
MKEQEKFEIDVFQLVKVLWKRKFLIVLAALVAGLAAFAYSSFVIQPQYTSTTRIYVVNRNQADKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVVADQSLAMDAKTLGRKVSVTVPADTRIVSISVRDGKPEEASRIANALREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMMATIAGVGFVTVIVLLVELLDDRVKRPEDIEEVMHISLLGVIPNLEKLK
>gnl|bykdb|F9PZP6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus infantis SK970] (length=230 residues).
MKEQDKFEIDVFQLVKVIWKRKFLIVLTAIIAGLAAFAYSSFVIKPQYTSTTRIYVVNRNQADKPGLTNQDLQAGAYLVK
DYREIILSQDVLEKVVADQKLTMDAKTLGRKVSVTVPADTRIVSISVRDGNPEEASRIANALREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMMATIAGVGIVIVVVLLVELLDDRVKRPEDIEEVMHLSLLGVIPNLEKLK
>gnl|bykdb|F9Q346 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis SK313] (length=230 residues).
MKEQNMMEIDVFQLLKILWKRKVLIALVAIVTGVVAFAYSSFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLDLPSKGLASKIKVTVPADTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMIGFLAGAVVMIVAVLLIELLDTRVKRPEDVEDVMQIALLGVVPNLDKLK
>gnl|bykdb|F9UMZ5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=256 residues).
MMDQAVSFDFFIRLVRKYWRAIVSFTVVGLIVAAGLTFFVITPKYQSSVQILVNRKNTNAATEYAGQQADVQMITTYKEL
IAGQVVLKPAKQQLSKRYGIERSLNTLKSEVSVTSTTNSQVFSIAVTDADAKASATIANQIARSFKNQVQKIIKVNNVTI
VAPAETPNGAVSPKKPLNMLIGLVVGLLLGIVYAAIRMLTDRRVHDADFLTDELGLTSLGLVNHQHHHSMKKQALNLNGG
YHTHNDRTSSQAMKRV
>gnl|bykdb|F9UQ55 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=252 residues).
MEQVITFDFIVKLIRQYWKVLLSLMILGGTIATVVTLWVIQPEYQANVQILVNRKHSSAGADLTGQQADVQMITTYKELI
TKPVVLKPARQTLMAETDIRRSLESLKQTVSVTSTANSQVFSIGVRDKNAKASAMIANQIAATFKDQVQHIIKVNNVTIV
APAETPDQSVAPKKIINILIGFVGGLILGLVYASVRILSNRRVQTLEYLADELMLTSLGIINHQQPVTATHDQPAIEPQP
VTSVVKAAVKRV
>gnl|bykdb|F9VC43 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus garvieae] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDAFQKQVTAANQTNSQVITLTVKYSNPYIAQKIADETAKIFSSDAPKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEALGLTVLGVTTYAQMSDFNKIANKNGTQSGT
KSSSPSDHGVNRTSKRNKR
>gnl|bykdb|G0LYN8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus IG1] (length=256 residues).
MMDQTVSFGFFIRLVRKYWLTIVSFTVAGLIVAAGLTFFVITPKYQSSVQILVNRKNTNAATEYAGQQADIQMVTTYKEL
IAGQVVLKPAKQQLSKRYGIERSLSTLKSEVSVTSTANSQVFSISVTDTNAKASATIANQIARSFKNQVQKIIKVNNVTI
VAPAETPNGAVSPKKPLNMLVGLVAGLLLGFVYASLRMLTDRRVRVMDFLTDDLGLASLGLVNHQNQYSIKKQVSNLTVA
HSTHDSQITSQTMKRV
>gnl|bykdb|G0M0G0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus IG1] (length=251 residues).
MEQIITFDFMVKLVRHYWKVLLSLTLLGGLVATVVTLWVVKPQYQANVQILVNRKHSSAGTDLTGQQADVQMITTYKELI
TNSVVLKPARQDLMDEHGLRRSVNTLKQAVSVTSTANSQVFSIVVRDHNASASAVIANQIATTFKSQVKQIIKVNNVTIV
APAETPDAPVSPKKMINILLGLVMGLLLGLVYASVRILTNRRVQTLEFLTDDLQLTSLGLVNHQPVVATKADNLAAKQRP
QTAAKPAIKRV
>gnl|bykdb|G0M1Y0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosus IG1] (length=256 residues).
MMDQAVSFDFFIRLVRKYWRAIIGFTVAGLIVAAGLTFFVITPKYQSSVQILVNRKNTNAATEYAGQQADVQMITTYKEL
IAGQVVLKPAKQQLSKRFGIERSLNTLKSEVSVTSTTNSQVFSIAVTDADAKASATIANQIARSFKNQVKKIIKVNNVTI
VAPAETPKSSVSPKKPLNLLIGLVAGLLLGIVYAAVRMLTDRRVHDVDFLTDDLGLTSLGLVNHQHQHSMKKQVLNLNGG
YHPHNDRTNSQAMKRV
>gnl|bykdb|G0V448 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Caloramator australicus RC3] (length=227 residues).
MEQEMTLDLRDLLEIIKKRWKMIFSVTTICILISALLSFFVLPPIYEAKVSIIIGKEDTSQEKRIDYNDIMMYQKLVKTY
ASIAKSRTVVEKTIQKLSKQVTYDEFISSITVTPQPDTQIMDIKVQSKDPKDAMITANTLSQIFLEESMRIYPTGSIQII
DNAVFPDKPVKPKKLLNIAIAFFLGIMISLGATFMLEYMDNTLKTESDVEKYLELPVIGIIPKEIDE
>gnl|bykdb|G0VNK5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Megasphaera elsdenii DSM 20460] (length=485 residues).
MEEITIDLKDLFQVVMDHKKKIAAITAAFMIAGGAYLCIASPVYQSTSLLRIKQDKGLGDSIMSQVSGGNTLDDKQRMMT
DAEILKSRNVVLPVIEKTEERNDDGELPDYESYVKKHIVTKPYKDTEILEVDVTGKSPEQAQQANNLIVQGFMNRLTELS
HDEQKRTREFLEQRLGASKDELSQAEDKLQQYQAANKMYSTDDQMKQLTDKLNIVDKAKAENQLNLETAQAGLNSVNEQL
SSAGVSIADSPAIQQYKTQLAQLEATKASYVGKYTDEHPKMQEINNQINSTRDSLNQEISKIVSQQAPSSNSVQQGLLAD
KFKNEAAIAVAQSKKTALDQMDAQNDAIISSLPEKEQGFVRVKRDADVSNEIYVMLAKRLEEAKVAEVMVPNEVQVIDAA
TLPEKPIKPRKVLIMAIMTLLGLIVGMGTVIVQSLMYRKIRTAEDVEKELGLPVLGMIPDTSTLQVETGSSDGLWSKIRR
KLWRK
>gnl|bykdb|G1WUK1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Dorea formicigenerans 4_6_53AFAA] (length=249 residues).
MGKNYDNDEMEIDLLELFYVLKSKILAILGVGLLFGCIACAYAGFLVKPLYTSSSMMLVLTKETTLSSLADLQMGSQLTK
DYSILITSRPVLTDVIDQLDLDMDYKQLKDMITVANQDDTRILQLSVEYSDAKQAKEIVDKLSEVASEYIGDKMEVTPPK
IIEKGEVPTSRSNTGVAKMAVMGVLAGMILCAGVIVVRTIMDDTIKSEEDIEKYLGLSTLSVIPDRKDYINGSGKKKSKR
NDAGKRKAS
>gnl|bykdb|G2FM60 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. OT] (length=232 residues).
MEEEMELRQYWDVLRKRWMIVVVIPLIAALTSGMISFFVMKPVYQASTTLIVGKKAAETGKDPTQILDNSVLLANQQLAK
TYATIAQSRTVEQNVLKDLNLPLTVDELNSLIAINPVKTTEILEIQVTNTNSELAALIANTMAQEFTKAVIEIKKVDSVS
IVDTAVIPDKPIKPKKTLNVLIAFVVGLMASVGLVFLLEYMDNTVKTLSDVEKLLGIPVLGIIPDYEMGKQG
>gnl|bykdb|G2FWT7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. OT] (length=232 residues).
MEEEIELRQYWDMLRKRWMIVVVLPLIAALTSGIISFFVIKPVYQASTTLIVGKKAAEAGQAATQMLDNSVLLANQQLAK
TYATIAQSRTVEQSVLNDLNLALTVGELDKLISINPVKTTEILEIQVSNTDPKLAASIANTMAQEFSKAVIEIKKVDSVS
IVDTAVTPDKPVKPNKTLNILIAFVVGLMAAVGLAFLLEYLDNTIKTSEDVEKLLGIPVLGVIPNYQIGKQG
>gnl|bykdb|G2FWX3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. OT] (length=234 residues).
MEEEIDLRQYWEVLKKRWKIIAMLPLIAALVSGIVSFYCIQPVFQTSTTLIVGKKSLDIGQPLEHMLDYNVLLANQQLTK
TYAAIAKSRTVEQNVINGLELPLTVEGLDKLISVNPVKDTEILEITVSNTTPELAASIANEVAQEFSKAVIEIKKVDSVS
IVDKAMTPINPVKPNKKLNVLIAFVVGLMAAVGLVFVLEYLKNTVKTSSEKSVDVEQLLGIPVLGIIPNYQIGK
>gnl|bykdb|G2KUP2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus sanfranciscensis] (length=239 residues).
MSFSFLGLIIKRHLKLILSSIVFFVAISSFITYGVMRPKYTSTTDLLVNQKLSKSQAAIQSQQVQADVQRVYTYKDIITS
PVIQNTVKKDLAGEPGMTKKTNISVFSQQNSQVFSVSATANNPYTASDIANETAKVFQNKIKKMMDINSVTIVSKATPVL
KPTSPHYMLNILAGLLIGLLIGLGASLLSEFNDKSVKNVDYLEDLGLNNLGLIYEIDKSDMKIATNKHGRRIDNHERRV
>gnl|bykdb|G2MWC1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter wiegelii Rt8.B1] (length=227 residues).
MAEEEIDLREIFLIMRKRAKVIVIITLLAMIVSGIFSYFIATPVYKASTSLIVSRTQSSVLTNSQIQVQDIQTSRMLAAT
YSEIVKSRRVLQPVIERLRLPLTVDQLKNSVDVAAKDNTEIIEISVENSDPSKAAEMANAIADSFMENIVKIMKIDNVQV
IDKAIPPTSKISPKTSLNIAVAAILGLMVSIFVVFLLEYMDRTIKSPEDIKKYLDLPVLGVIPEIKN
>gnl|bykdb|G2TR26 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus coagulans 36D1] (length=245 residues).
MEDTISLKELMQVLRKRLSMIALITLGAMIVTAIVTYFVMTPVYESSTQILVNKASDDQTMYTTNAVQTNVQLVNTYNVI
IKSPSILDKVIDELKLNMTTDELNSKIEVSTEQNSQVFTLTVKDTNPYMATKIANKIGEVFKKEVKNIMKVDNVTVISKA
QVPGGPVSPKPLLNIAIALVVGLMAGVGIAFLLEYLDNTIKDEQDVEQILQLPVLGVIGQIDDQELNGLHRAGKKTKGKV
ETVGA
>gnl|bykdb|G2Z8Q4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Listeria ivanovii] (length=237 residues).
MEKTLDIKYIGQFFKKYWYIIVAACVVGMIAIAFYTSYFVTPIYQVSTDVLVNQKKNEQVTVSDVQSNQQFVNTYSVILT
SSRILDQVKDNLNLPQSVKQLKQQITIENVANSQVITIKVTDSSAEKATLIANKVTTVFKDNIKNIMDQQNVSILSEAKA
DDNNIPIKPNKKSALVMGAFGGLVIGILFSFSLQLLNTTIKSEKDIEALTDIPILGSIQKERKKRRRHAKRTFKTTH
>gnl|bykdb|G3G7C0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEMNTIEIDILLLLKTIWRKKFFILLMGLLGAGLAFAYSSFLVTPQYKSTTRIYVVGQHAEAGAGLTNQDLQAGSYL
AKDYKEIILSQDVLTQIATELNLNENLKEKVSVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSEVTT
LEEAVPAEEPSTPNTKRNIILGLLAGGILATALVLVMEILDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G3G7G5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFLVTPQYDATTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYKEIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNILLGLLAGGILATGIILAMEVLDDRVKRPQDVEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G3G7I7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEMNTIEIDILLLLKTIWRKKFLIIITALFGAGIAFVYSSFLVTPPYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYREIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKVVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNILLGLLAGGILATGIILAMEVLDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G3G7J3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEMNTIEIDILLLLKTIWRKKFLIIITALFGAGIAFVYSSFLVTPQFDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYKEIILSQDVLSRVKTELGLTEDISNKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSDVTT
LEEAVPAEEPTTPNIKRNILLGLLAGGILATGIILAMEVLDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G3G7J8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEMNTIEIDILLLLKTIWRKKFFILLMGPLGAGLAFAYSSFLVTPQYKSTTRIYVVGQHAEAGAGLTNQDLQAGSYL
VKDYKEIILSQDVLTQIATELNLNENLKEKVSVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSEVTT
LEEAVPAEEPSTPNTKRNIILGLLAGGILATALVLVMEILDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G4EQF2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. subtilis str. SC-8] (length=248 residues).
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERKEVQFNDVQTNLQLINTYNVI
IKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNISVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKA
EVSEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEK
TGSGHFGA
>gnl|bykdb|G4EQZ6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. subtilis str. SC-8] (length=234 residues).
MNENMSFKELYAIVRHRFVLILLITIGVTLIMGFVQFKVISPTYQASTQVLVHESDGEENSNLSDIQRNLQYSSTFQSIM
KSTALMEEVKAELHLSESASSLKGKVVTSSENESEIINVAVQDHDPAKAAEIANTLVNKFEKEVDERMNVQGVHILSEAK
ASESPMIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVHKGRNRGIKHFGE
>gnl|bykdb|G4L593 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Tetragenococcus halophilus] (length=266 residues).
MEETISLSEIFDVLKKYWTTILTSLFAGLALAAVVTFFIMTPQYNSRAQMIVALPQDENSDESLNTVNYNLQMLNTYKDI
IEEGDALAASMQDRLASDYGLDMTIREIKDSMEVEQSEESQMFSIVATGESAADAEHIANTAAEVFQDTVQDVLTNVDKI
TIVSRASASAKPASPNNMLNLAIGLILGLLVGIGLSFLMEVLDRTVKDSRYITDTLGMTVLGTVPKMSQKEIEETTKKLT
KARQNNDDNDQGNDGDDVGRRSRTRV
>gnl|bykdb|G4P115 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=234 residues).
MNENMSFKELYAIVRHRFVLILLITIGVTVMTGFVQFKVISPTYQASTQVLVHESDGEENSNLSDIQRNLQYSSTFQSIM
KSTALMEEVKAELHLSESASSLKGKVITSSENESEIITVAVQDHDPAKAAEIANTLVNKFEKEVDERMNVQGVHILSEAK
ASESPMIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVQKGRNRGIKHFGE
>gnl|bykdb|G4P1M8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. spizizenii] (length=248 residues).
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNNQKEVQFNDVQTNLQLINTYNVI
IKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNISVKDENAETAAHIANTIASVFKTKITSIMNVDNVSILSKA
EVSDHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKSLHGIQSEK
AGSGHFGA
>gnl|bykdb|G5F9B0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. 7_3_54FAA] (length=274 residues).
MEKMYTEDKEEIEIDLRELLFELKKRLWLILVALFLGIGIAGAGSAFLITPQYKSEAKLYILSKETTLTSLADLQIGSQL
TQDYKVLVSSRPVMEGVIKHLKLDYSYKELAGKLTVENPQNTRILSLTVRDENPYMAKQIVDDIANTASDYIGEIMEMVP
PKMIEDGVVASEPYSPSIKRNALLGGILAVFLICALIAVRVVFSDTVKSEEDVERYLSIPVLAVIPKKREKGKKKEKHKS
PKEPGKGETRKEENGKEEIRKEVKGPKEEEQING
>gnl|bykdb|G5F9E3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. 7_3_54FAA] (length=293 residues).
MEKITHQHLDDDEIVIDFRELFYEFKRRIWWILLAAVLGTGAAGAYSYYLLTPQYISEAKIYVLSKETTLTSLADLQMGT
QLTQDYKELIGSRPVMQEVINTLNLDITYRQLAEKLKLENPKDTRILYLTVTDPNPYMAKAIVDEIANAASDYIGEIMEM
TPPKLIEDGMVATVQTSPNVKKNAAVGGLVMLVLACGVITLSVIMNDTIRSEEDVFKYLELPVLAVVPERKDSKVERSSS
SGRFFGRKKKVSVKRGSRKKAEITRKTPEETRQPEKTDQELPAAALKDKTENS
>gnl|bykdb|G5F9H3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. 7_3_54FAA] (length=273 residues).
MEKVYQDDDEIEIDLRELLFEMKKKIWFIIAGLLIGAAITGAYSKFLITPQYKSEAKLYVLSKETTLTSLADLQIGSQLT
QDYKVLVGSRPVLQGVVDHMKLDMTYRELEKKLTIDNPNNTRILTLTIKDPNPYLAKSIVDEVANTASDYIGEIMEMVPP
KLIEDGEVASEKASPNVLKNTIIGGILGLLLVCGFIVVRVILNDTVKSEEDVSKYLDLPVLAVIPKKDGNEDRKKGQGKQ
KKSRSTGRGAKAPEKGAGTRQKSGADRKGRGEN
>gnl|bykdb|G5GFW1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Johnsonella ignava ATCC 51276] (length=258 residues).
MNFRKGETAVSTGSSFYIPLEMVNNINEEEIQLDIFEVLYALKKRFFLLLFSTILGFGIFGAYSYFILSPQYTSTAMLYV
FSKETTLTSLADLQIGSQLTKDYKIIISSRPVLQKVINTLDLKIDYKELKKKLTVDNPNDTRILSLSIVDEDPAMAKKIV
DEVANTASDYIGDLMEMVPPKLIEDGEVPIHKTSPHTVLNAVIGAVLAVVIVVGVTVLQVIFDESIKTEDDIARYLDITV
LAVLPDTDEDEKLNRRKT
>gnl|bykdb|G5HG46 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-17108] (length=260 residues).
MEKNFDDDEIEIDLLELLREFRRRIWIILGVIVLFGGVAGAFSKFVLTPQFKSTAMVYILSKETTLTSLADLQIGSQLTK
DYKIIVTSRRVLNQVIDEMELGLTYKDLKEKVTIDNPQDTRILSISVEDPDPNMAKMIADKIATVSSDYIGDIMEMVPPK
LIEEGEVPVLKSSPSNAKNALIGGLLGAVLICGLITVQVVMNDTIRTEEDVTKYLGLSVLASVPEREGEKPEDKEAMISG
KSKPKTGTGKSRKKKGGRAS
>gnl|bykdb|G5HNC6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-17108] (length=262 residues).
MENKLYEDRDENEIEIDVMELLYVFKKKAWIIILAAIAGCMAAGLYSVMILNPVYTSTSMVYVLSKETTLTSLADLQIGS
QLTKDYSVMITSRPVLEQVIEKQGLDLTYDQLKEKITITNPTDTRILNMTVSDEDPVRARAIVDEVARASSDYIGDIMEM
IPPKIIEGGVVPDKPASPNVTRNAALGGMALAVISCAIITLQVIMNDTIRSEDDVSKYLGISVLAAIPDNGEAEKEQPIK
FRGRKESRKKQKPGQKKKGRED
>gnl|bykdb|G5HTB1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-17108] (length=258 residues).
MENNIYEDRNENEIEIDVLELLFVFKKKAWVIILAALAGCLGSGIYSKMILKPVYTSTSMVYVLSKETTLTSLADLQIGS
QLTKDYSVMITSRPVLEQVIENQGLNLSYTQLKNMIRISNPADTRILNMSVSDTDPVRAKAIVDAVAKASSDYIGDIMEM
IPPKIIENGVVPSVPTSPNIKKNAALGGLAMIVAACGIISLQVIMNDTIRSEEDVSRYLGISVLAAIPENGETENNPLVQ
KNKRKKSRKKQKPISKKG
>gnl|bykdb|G5IFS2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi WAL-18680] (length=441 residues).
MGTNQDDEIEIDLKELFFVMRRKLWVLILTGMLGAAVSGIFTATMMKPVYTSSTMLYIVNKTTTLTSLTDLQLGSQLTKD
YKVLVTSRPVTSKVIENLDLNLDHEQLLRKLTVANPQDTRILTISVEDNDPYMAKAIADEMASVAASRMAEIMDTAPPNI
VEEGYVPTRQTSPSLVKNTAIGGMAGLFLAAVIVLAVFVMNDTIKTPEDVEKYLQLNVLGTIPVFEVDDGKKGRKGKKKS
RKERKAERLREETEDRIQREIAQEMAERRREADEDEEDIMPHQVFGKRKNRNAARDLKERKQEADFQDVPIDEDEEEVDE
RAAHGKSARRNARQIKKADRETYVKRVNDPDDEAEDSEDDMPGQLDMRAIMDMEHDLPEESLKSSGGQEQRSMAVKRQTA
SASSLEDELTGDDLDEFVQRIMEQALEGAEAPKEDIDDGTD
>gnl|bykdb|G5IRQ5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus saccharolyticus 30_1] (length=259 residues).
MEETISLKEIFEVLRKHLASIIIAMFAGLALAGIATFFVITPKYSSQAQLIVTLPQSETANVNDVNTNLQMINTYKDMIV
SDLVLNEVKDRLESESNVKMTAGEIKDAIAVNQSQNSQMFSIQATNPNAVTAQKIANTTALVFQENAKDVMNVDKISIIS
SAVASTSPVSPNNKLNLAIGLVLGLMVGVGLAFLFELLDRTVKDDKFVTDTIGYTILGTVPQMSQKELNATIQKKPTRPT
LKKPTNDKTTESRRSRSRV
>gnl|bykdb|G5JTD6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus criceti HS-6] (length=229 residues).
MTSAENASFEIDVFALLKKLWNRKFLIIFVALLFGFVTLFVSVFIIPKTYTAGTRIYVVNNSTSDSINYQDIQAGTDLVN
DYKEIIQSQDVLDDVVKKEKLDISSDELAKKVSVQVPTDTRLITIAVQDRSPQEASRLANAVREVAIQKIKDVTRVDDVT
TAETAKVPTSPTSPRIKRNLVLGTAAGGFIAVVTLIIFEALDDRIKTSEDIEKALDRTLLGVVPDINSL
>gnl|bykdb|G5KAJ3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pseudoporcinus LQ 940-04] (length=229 residues).
MNNTEQSSIEIDVLSLLKKLWNKKFLILFMGLFVGTLALMASLFLIKPSYTSTTRLYVINRQQSDNLTATDLQAGGYLVN
DYKEIITSRDVMQDVIASDGLSLTPEQLSKMIAVTVPADTRVISISVTNHHPQEAKDLANSIREAASEKIKKVTKVQDVT
PLEKAQLPTSPSSPNIQRNTLIGFFLGALLTIIVIVVGEVLDDRIKRPEDIEEVLGMTLLGTVPNTDKL
>gnl|bykdb|G5KD12 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus urinalis 2285-97] (length=229 residues).
MNTNETPSIAIDVLSLLKKLWMKKTLILFMAIFVGVLTLLVSAFLIKPSYTSSTRIYVINQQNSDNLTALDLQAGGYLVN
DYKEIITSRDVMKDVIANNNVTLTPEQLSKMITVTIPADTRVISISVTNHDPQQAKTLANSVREVASEKIKSVTKVQDVT
PLENAELPTSPSSPNIKRNTLIGVLIGGLMTIVVIILKEVLDDRVKRPEDVEEVLGMTLLGIVPNTDKM
>gnl|bykdb|G6A746 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus intermedius F0395] (length=232 residues).
MKNQDNQTVEIDVLSLVKSLWRRKFLIVVTAFVMAIITLGYNTFIIKPNYTSSTRIYVVNRQPSDNSTLTNQDLQAGSYL
VKDYKEIILSQDVLAKVISDLKLNMQPSALAKKITVTVPTDTRIVSIAVSDGDAKEAARVANSLRQVAAEKIIAVTKVAD
VTTLEEAEVPNSPSSPNIKRNTLIGFLTGGALISMVIIIVEVLDDRVKKPEDVEEALGITLLGVVPNMDKLK
>gnl|bykdb|G6C7Z0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 058 str. F0407] (length=231 residues).
MMKEQNTIEIDVFQLLKTLWKRKLIILLVALVTGAGAFAYSTFIVNPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLV
KDYREIILSQDVLEKVATNLKLDMPVKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDV
TTLEEARPATTPSSPNVQRNTLFGFLGGVVVTVITVLLIELLDTRVKRPEDVEDVLQIPLLGVVPDLDKMK
>gnl|bykdb|G6ERT2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus CNCM I-1630] (length=232 residues).
MNQDNTKTKSVEIDILALLHKLWTKKLLILFIAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTY
LVNDYKEIITSNDVLSEVIKDEKLNLSEAELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVRKVASEKIKKVTKVE
DVTTLEEAKLPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVRRPEDVEDVLGMTLLGIIPDTDKI
>gnl|bykdb|G6F8H0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus CNCM I-1519] (length=294 residues).
MSAEQQNNEEVTIDLRRLFILIKKHIISILIWMIGLGLIAYGVSEYVLVPKYTSSTQLLVNRKTTDANQAYTNQQADINA
VTTYKDIITSNVILKGASKYLANPVTLVKKATPAKKAVYKTNDGTRTLVKKAVKAKPAVYKRESKSYSVSANELASAVSV
TTTTSSQVFTLSATAETPAKAQAIANAVAKEFKEQIPKIMDVNNVTIVAEAAKGTKSYPNVKMITMVGVLAGLVISLLII
IIKDLSDTTVREDSFMTNELGLTNLGEIAHITMPKDWTFTAKTAEKRGSSRRRV
>gnl|bykdb|G6FD41 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis CNCM I-1631] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDSFQKQVTAGNQTNSQVITLTVKYSNPYVAQKIADETAKIFSSDAAKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIVGLVLGLAIALLKELFDNKINKEEDIEALGLTVLGVTTYAQMSDFNKNTNKNGMQSGT
KSSPPSEHEVNRSSKRNKR
>gnl|bykdb|G6J8A3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae GA47502] (length=230 residues).
MKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVK
DYREIILSQDVLEKVATNLKLDIPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDVT
TLEEARPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|G6LKG4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae GA44500] (length=230 residues).
MKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVK
DYREIILSQDVLEKVATNLKLDIPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDVT
TLEEARPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|G7M0Q2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=230 residues).
MNEDVIRVQDLLKTLKKRWKLICIITIITVIISAALSFLVISPKYETSTKVFIGKEGSVIKDLPDQNYNGNDVEMYQKLL
KTYAEIIKTNDLIEKAVDVENLDVKPNDVLKNLTVTPTVDTQILEIKYVNQDKVIAKNILDSITNQFIVESKQLIPNGNI
KIIESVKIPEDPVSPNKKINIAISFILGLMVSIGLSFLLEFMDNTFNNKEEMEKELGLPVLGTIPDFLNE
>gnl|bykdb|G7M1R8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=233 residues).
MNSEEIIKNEESIRIEEIIDILMKRWKMIVSITLTATILAGLVSFFVIAPKYESNTKVFIGKENTNSKDQSYNSSDVQMY
QQLLKTYAEVVKTNDLVEKAIEKTGADINSQDVLDNLTVTPTANTQILEIKYVSKNKNQSEEILQAISDQFIKTATELIP
NGNVKVVEQVKLPEQPVSPNKKLNIAIAFLLGLMVSVGLAFLLEFMDNTFKTKEQLEQILEVPVIGAIPDDLD
>gnl|bykdb|G7M565 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=228 residues).
MNKDVIKIEDIVNILIKRWKMILGITLIATALSAIISIFIISPKYEASTKVFIGKELNAQGQEQSYDTNDVQMYQKLLKT
YVEIIKTNDLIDRAINFSNLNLSSDKILSTLSVTPRSDTQILEISYISPHKSEAGDVVKTVTDEFMRSSKELIPNGNVKT
IESVKVTDNPVSPNKKLNIGLAFAAGVIIGLGLSFLIEFMDNTFKTREEMEEILGVPVLGTIPDKFKS
>gnl|bykdb|G7SG35 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis D12] (length=229 residues).
MNNQESNTIEIDVLSLLKTIWRKKFFILVTAVLGAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYKEIILSQDVLTQVATELNLNENLKEKVSVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNIILGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G7SNU7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis ST1] (length=229 residues).
MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFLVTPQYESTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYREIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKVAEVTKGSDVTT
LEEAVPAEAPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLILLGIVPDSKKLK
>gnl|bykdb|G7W774 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus orientis] (length=232 residues).
MEEEIDLRQYWEILRKRWIIVVVLPLIAALTSGIISYFIIKPVYQASTTLIVGKKASEEGQAAVQMLDNNVLLANQQLAK
TYAAIAQSRTVEQSVIDDLDLSLTVSELDKLITINPVKTTEILEIQVLNTDPQLATAIANTMASEFSKAVIEIKKVDSVS
IVDTAVVPDEPVKPNKKLNILIAFAVGLMVSVGLVILLEYLDNTIKTSDDVESVLGIPVLGVIPTYEAGKRV
>gnl|bykdb|G7WJV2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus orientis] (length=246 residues).
MEEKLDLKQYWDMLRRRWIIVVALPLIAALTSGVISFFVLKPVYQASTTLIVGKKAAEPGQEAAKILDNNVLLANQQLAK
TYALIAQSRTVEEKVIKELNLELTVEGLDPMISINPVKATEILEIRVRNTSPEQAAAIANTMAQEFSKAVIDIKKVDSVS
VVDTAVVPAKPVKPNQLLNILIAFVAGLIASFGLVFLLEYLDNTVKTSGDVEKLLGIPVLGIIPDYGVKKIRARGDGLIG
LFVNHL
>gnl|bykdb|G8DTY9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQESNTIEIDVLSLLKTIWRKKFFILVTAVLGAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQDLQAGSYL
VKDYKEIILSQDVLTQVATELNLNENLKEKVSVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNIILGLLAGGILATALVLVMEVLDDSVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G8DU06 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQESNTIEIDVLSLLKTIWRKKFFILVTAVLGAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYKEIILSQDVLTQVATELNLNENLKEKVSVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNIILGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G8DU30 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFLVTPQYESTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYREIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKVAEVTKGSDVTT
LEEAVPAEAPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLILLGIVPDSKKLK
>gnl|bykdb|G8DUA9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQESNTIEIDVLSLLKTIWRKKFFILVTAVLGAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
VKDYKEIILSQDVLTQVATELNLNENLKEKVSVSIPVDTRIVSISVRDADPNEAARIANSLRTFAAQKIVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNIILGLLAGGVLATALVLVMEVLDDRVKRPQDIEEVMGLTLLGVVPDSKKLK
>gnl|bykdb|G8MZ94 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Geobacillus thermoleovorans CCB_US3_UF5] (length=247 residues).
MEETISLRELFDTLRKRLWLIVLITALATVVSGVVSYFILTPIYEASTQILVNQAKSEQQLYNFNEIQTNVQLINTYSVI
IKSPTILEKVKDELHLDRTLDELNEQIQVSSEKDSQVFSVTVQDPDPAMAAKIANKTAEVFKNEIVKIMNIDNVTILSKA
EVKEHQAPVKPKPLLNMAIAFVVGLMTGVGLAFLLEYLDNTIKTEEDVEKHLGLPVLGAVSLITAEGGQKARRESAIPQT
RGETIGS
>gnl|bykdb|G8P3D6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris A76] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQTNSQVITLTVKYSNPYIAQKIADETAKIFSSDAAKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEAFGLTVLGVTTYAQMSDFNRNTSKNDTQMGT
KASSPSDHEVNRSSKRNKR
>gnl|bykdb|G8PE07 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Pediococcus claussenii] (length=259 residues).
METEQQISIGQVLSTLRRHIGLIAASTVIVTLLSVLVTFFIMTPKYSATTEILVNRKLPAEMQGAQFQQVQADVQMISTY
KDIIMSPAVLRDVDSSLAGQAGYPGENGMKKAISISSQQNSQVFSITAKSTNPEMAAKIANKTASVFKNKIGKIMSVNNV
SMVSKAQADDQPVSPRTKLNLVAGLILGLLIGFGLAFLRELSDRTVTSEEFLTDELGLNSLGVVNEIAVKDLKKRVVPNN
SDDAKSHDSKDTSRTRRRV
>gnl|bykdb|G9M881 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][uncultured Firmicutes bacterium] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQTNSQVITLTVKYSNPYIAQKIADETAKIFSSDAAKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIVGLVLGLAIALLKELFDNKINKEEDIEALGLTVLGVTTYAQMSDFNKNTNKNGTQSGT
KSSPPSDHKVNRSSKRNKR
>gnl|bykdb|G9QCG2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7_6_55CFAA_CT2] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGTAIQLGEIQSNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALTGKINVANEKDSQVISVTAEDKDPKLARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPAPMLNVAIAFIVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|G9QKR5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus smithii 7_3_47FAA] (length=248 residues).
MEETISLRDLMETLKKRLRLIVLITVLAALISGLVSFFILTPIYQASTQLLVNQSKNDQQMYDFNQVQANLQLVNTYSVI
IKSPAVLEKVIKELKLDMTTDTLNQKITVDSEQNSQVLNVSVQDPDPDKAVLIANKIAEVFKQEIVKIMNVDNVSILSKA
DLGKDMTPVKPKPLLNIAIAVVVGLMAGVGLAFLLEYLDNTIKNEQDIEKRLELPILGMVTTISEEDIKLATQRSSHRKQ
VRGETFGS
>gnl|bykdb|G9RSY8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Subdoligranulum sp. 4_3_54A2FAA] (length=74 residues).
MKEEYETIDLLEILRLLKKNLLVILAVTILLAVAGYLVSSFAMTPQYEASATLIVNSREDQAAAQAPITNDQLT
>gnl|bykdb|G9WIR0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Oenococcus kitaharae DSM 17330] (length=233 residues).
MDTTISYQRLWELFKKNFFLLIISALVLAAVAYAGSRFLIHPKYQSTAALLVNRSNNTDPNAALGNQQADIQIIYTYRDL
ATRPVILDQVARNLRGRYPDISSSSLASMVTVSSVQNSQIFSISARSNDPVESRDIANMTADVFKTKAVQVMGKSISNVS
IVSRGLRQDTPVSPNVRLFTLAGFLLGVFIVVLFVLIKEMSDNTYRDLSFLEQLKLNNLGTVNYASFHKGRAK
>gnl|bykdb|H1BJT0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Eubacterium sp. 3_1_31] (length=245 residues).
MDEKEIKLRLNDLIGIFKKHYKVILFCTLLCMVFLMVVSLCILPKKYASDSNIYLKPKTTSEGIIDNQTVITNRNLVKDY
EKILQGTTVLSQVDKKLHLVDGTCSKAIQTNVEDNSNIITIRANSEDPYLSQNIVKETIAVFTQEMMKISEIDNITVIDK
ATLQTHYISPNIKLNSIAGGIFGFALSYIYFILVFLLDNRIKSSDQAEEYFGYPVLGSIPFVDELNQENHPRKSIKRRVK
AYVKK
>gnl|bykdb|H1LCW2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus kisonensis F0435] (length=285 residues).
MENYLDLRQILGIIRKHIIFIMISFILCLIIAVGLEKFVITPQFTSTAQILVNQKKDTSVPRAAFQDQQADVQMISTYKD
IITNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASRPAVVKSTGTPYDVSVKQLQGAISVTNQQNSQVFAL
NVKSDDPQKSAAIANTVAKVFKQKIRRIMSINNVTIVSEATPVKQKSFPKTSIVLLAGAVIGLLVGLGYAFIRELTDTTI
KDDEFLTNELRLTNLGHIAEIRKIHGSHLANKRHGEHLKPNHRRV
>gnl|bykdb|H1WR07 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Leuconostoc citreum LBAE C10] (length=297 residues).
MNNVLELRQLWDIIRKHFFAIFFMALIGAGIGYGIAKFLIAPTYSASTSMLVNRSTDNTQSGVNLSDQQADVQIINTYKN
LVISSNVLGDVANKLKQPKTVVVQPGKPAVYDTLADGTRRLVSPEQKEITRASSQPTYDLTVDQLKKMVSISNQQNSQVF
AINVTSKDPKQAALVANTVADSFKAKIGGFMKINNVSIIDSAKIDNKPVGPKIQIFMLAGLIILGGLAFLVALVRELSDT
TIKSPDEVSQLFGFTNLGVVSHIKGMKHFDMEPTVQSMSDDGKAMHSRSRLSRLNKD
>gnl|bykdb|H1X4N3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Weissella confusa LBAE C39-2] (length=299 residues).
MNNVLELRQLWHIIQKHFFALIFMAIIGAGAGYGVAKFVIAPTYSASTSLLVNRSADDTSTATANLSDQQADVQLINTYK
NLIISSNVLGTVSDELENPAPIVVQKAKDAVYETLADGTRRLVTPAKKEITKPSNKTKHQISVDELKSMVTITSQQNSQV
FSINVKSKDPKLAADVANEVAAVFKDKIGGFMKINNVSIIDSAKANKKPVSPSTKLFTLAGLVILGGLTFLYVLIKELAD
TAIKSPDEVSQLFGMTNLGVIGHVKPIKNFSMAPSSSTAVKVNQSNGIQRSRLNRLDQE
>gnl|bykdb|H2A601 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus macedonicus] (length=229 residues).
MNSNDNASIEIDVLYLLRKLWSRKFFIIFIALVVGTVALLGSVFFLKPKYTSTTRIYVVSRSSDGSLTNQDLQAGSYLVN
DYKEVITSNEVLSSVISQENLSLSTSELSNMISVNIPTDTRVISISVEDTDAKEASDIANTIREVAAEKIKSVTKVDDVT
TLEAAEVASKPSSPNIKRNAALGVLVGGFLAIVGILVLEVLDDRVRRPEDVEEVLGMTLLGVVPDIDKL
>gnl|bykdb|H4GK02 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus gastricus PS3] (length=252 residues).
METSNTIDLRRLVKILRKNLLMLIVWTLGLGIIAAADAEFLVQPKYTASTQILVNNKENKVQAGQAYNNQQADVQLINTY
KDIITNQVILQEATKDLANPETSHANGKAYDLSVAELKDALSVSTQTNSQVFTLNAEASNPTEAKAMANTVASVFKKRVK
KIMDVNNVTIVSSATTPKKKSFPNVKLFALAGAVVGFVISFGYLLIKELFDTTVRTNEFMTDELNLVNLGQVSHMRYDRK
NKRQKSRGNRRV
>gnl|bykdb|H5XZD5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus youngiae DSM 17734] (length=230 residues).
MEEKVDLRQYWGVLRKRWIIVVALPLIAALTSGVISFFVIKPVYQASTTLIVGKKAAESGQEAVKMLDNNVLQANQQLAK
TYALIAQSRTVEEKVIEELDLELTVEGLDRLISINQVKTTEILEIQVSNTNSELAASIANTMAQEFSKAVIEIKKVDSVS
IVDTAVIPDKPIKPNKLLNILIAFIAGLMVSLGLVFLLEYMDNTVKTSSDVEKLLGIPVLGIIPDYEMGK
>gnl|bykdb|H5XZG8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus youngiae DSM 17734] (length=232 residues).
MEEEIDLRQYWEMLRKRWIIVIVLPLIAALTSGVVSFFILKPVYQASTTLIVGKKATESGQAAMQMLDNSVLLANQQLAK
TYAAIAQSRTVEQNVINNLDLPLTVAEFDKMITINPVKTTEILEIQVLNKDPELAADIANSMANEFSKAVIEIKKVDSVS
IVDTAVIPDQPVKPNKKLNVLIAFVVGLMAAMGLVFLIEFMDNTVKTSEDVENILGIPVLGVIPNYEIGKQG
>gnl|bykdb|H6LKR9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Acetobacterium woodii] (length=245 residues).
MNKTGEVDLKELFRIVLKKWWLIILLTIVGFVGAYFGTAKLITPIYEAKTVLYIGRENSGLGTIDVSLGQLEADSQLIID
YKEIALTRLVIDAVVKNTGLNINDNESKNGITGKSSMTYTDFQKNTEIEAINNSRLFTVGFKDPDPEIAKKVSDELAKQL
TIAVSQIVGVENIRILDQSTLPVKPISPNILINTIIGGLFGLLFSLFVILIMFLFNDTVKDEDDIKSLIDVSVLGSIPEF
KGEAR
>gnl|bykdb|H6NE44 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus mucilaginosus 3016] (length=245 residues).
MEVKHYLQILRRYIWLILGVTLITSLCTALVSVQYLPRVYQASVKLLINSEGKGNGVDISSINTNLKLIKTYSEILRTSA
VLEKVAAAYPEFMLTPEQMAEMLEVKQSSDSQVMTLVIRDTDYRRAAETVNAISYTFQKEIENVMKVSNITTLGVANPEK
PARPILPNTQLNVLVSVLVTLLLGVGYAFLHHMLQDTVKNEKDVEELLGLSVLAAIPTVKSKDIALQLSPSGRKVGEIPY
ATAKQ
>gnl|bykdb|H7F1R6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=240 residues).
MEETMNVKRLWGLLKKNKWLIFMSTCVCILLMSVYLYAFSVPTYQSETEVLINQSVPENTVVQSQDVQANLQLVNTYTSI
ITSPRILSAVSAILDDKYSIKELSNMINVSNASDSQVIRIQVESKNPKDAVKIANETVRVFKKEIPKIMKIDNISVLSPA
FYDSAMSPVKPHQSLMLVISGLFGLVIGIIIMFVRDLFDRSIKSKEDVEAILNLPVLSMISEIKEADIQKFKNKRRKRKG
>gnl|bykdb|H7F570 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=242 residues).
MEDNLNVKQLRNLVKKNKWILLACVSISTLLMLMYLSFFSTPIYRSSTEVLINQSVSENSQVKSQDVQANLQLVNTYASI
LKSPGLLNGVAQKINHKYSVKELSEMVDVSSTSDSQVITISVEGENAKDIVKIANDVVQTFRNEIPKIMKVDNVYILSKA
TFSDNMSPVKPSKGLLIMVSVVLGTVVGIIIMFFRHLFDNSIKTAEDVELLLNLPVLTIISEIKEESLITQNQRSNNRRK
RG
>gnl|bykdb|H7F5T7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=235 residues).
MSQKFNLIEIWTILFRHKWSLIIMGILGASLSLCIALFVITPSYQMQSQVLVVPSSKDQSGVSQSAEVQANLQMINTYKA
LIKSPKVLNQVSADLKGEYTASQLSEMIQPSTEENSQVINITATTDSPEEAAKIANITAKEFVKTTPEIMRINNVQLLNE
AYVKTNDKPVFPSPTIFTAVGLLVGLFMGVSFVILKTLFSNKITREEDFEVLDIPVLGLVGKIDKYHQNGQRMRK
>gnl|bykdb|H7F6C7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii subsp. coloradonensis] (length=239 residues).
MNEQIDLKKMLLAIRKNSWWLIGIIVVTILSMFIYLQYIATPIYQKSTQILVNQSESTKSNSVDSQTVQADLQLVNTYST
IISSPRILNEVQQDLGKQYDTAELAEMIQVKNATNSQVIDISVEHPDPKVAARIANATARTFTEEIPNIMKIDNVTTLSE
AQFLGNETPVKPQKVLMLALAAFAGILFAFAFIFIKLLFERTLTSTEEIEELLGLHVLGEVSAFQNNDPFQTKFQKGDR
>gnl|bykdb|I0BSG5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Paenibacillus mucilaginosus K02] (length=220 residues).
MCTALVSVQYLPRVYQASVKLLINSEGKGNGVDISSINTNLKLIKTYSEILRTSAVLEKVAAAYPEFMLTPEQMAEMLEV
KQSSDSQVMTLVIRDTDYRRAAETVNAISYTFQKEIENVMKVSNITTLGVANPEKPARPILPNTQLNVLVSVLVTLLLGV
GYAFLHHMLQDTVKNDKDVEELLGLSVLAAIPTVKSKDIALQLSPSGRKVGEIPYATAKQ
>gnl|bykdb|I0F9R7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus sp. JS] (length=248 residues).
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNDRKEVQFNDVQTNLQLINTYNVI
IKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNISVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKA
EVSEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKAIQGFQSEK
AGSGHFGA
>gnl|bykdb|I0GRR3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Selenomonas ruminantium subsp. lactilytica] (length=485 residues).
MDDKEVTIDLREVWDLMVTGRMKIAKITALFLVAAGAYLLITPPTYQSTSLLRIKQEKGLGDSILSSVAGNAGMTTQRMN
TNAEILKSRNVIEPVIEKTEEPNKDGKLPSYEGYIKSHVTTKPFKDTEILQVDVTGKSPEQAQEANQLIVDGFLSRLAEL
SHAEQGATRAFLEERVESSKKELSDAEDKLQKFQVENKLFSTQDQIKQITDKLSIIDKEKAANKLNLEQAQAALGTINGQ
LDNSGRGIADSAALQQYKVQLAQLAAEKAGYTGIYTEDHEKMQAVNQKIANVQASMEKEIGSIVARQAPSSSSVQQKLLA
DKFQNEAMVAVEQAKAKALAALDKENEDLISKLPEKEQGYVRVKRDTEVAQEIYVMLAKRLEEAKIAENMVPTEVQVVDS
ATLPEEPIKPKKAMTMLVALLLGLLTGSAFVTAKGILNRRMRTTEDVEHYLELPVLGIIPDANGLDKEEDIGLLEGIRNR
LLRRK
>gnl|bykdb|I0J9C8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNMIEIDVFQLVKTLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRDQGDKPGLTNQDLQAGSYLV
KDYREIILSQDVLEKVVTNLKLDMPTKTLASKVKVTVPTDTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRHNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLQIPLLGVVPDLNKMK
>gnl|bykdb|I0JRK5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Halobacillus halophilus] (length=252 residues).
MEETISLKEIFEVLKKRLLLIIGLAAGAAIISTLVTFFVLTPSYEASSQFIVNQSQSQSQDNIYEGNELQTNIDLINTYN
VIIKSPRILDQVVEELGLDMTSATLSDKIQVSNAEQSQVVNVVATDEDPQQAAAIANTTVQVFKEDIPQLMNVDNVNVLS
EAAVGSTPTQVSPKPLLNIAIALVVGLMVGVGIAFLLEYLDNTLKSEEDIESHLDLPVMGVVSTISEEDLPERRPTRKKT
EDTKVRSESIGA
>gnl|bykdb|I0QIK5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius PS4] (length=230 residues).
MTQENTKRVEIDVLALLQKLWTKKVFILFTAFYVAVFAFLGTYFFIQPTYTSSTRIYVVNQADDGKNLSAQDLQAGTFLT
KDYKEIITSNDVLSEVIKDEKLNMTEADLAKMISVNIPTDTRLISISVNAKTGQDAQSLANKVRDVAAEKIKKVTKVEDV
TTLEDAKLPDSPSSPNIKRNVALGAVLGGFLAIVGVLVREILDDRIRRPEDIEDALGLTLLGIVPDIDKI
>gnl|bykdb|I1ZPH8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis FW213] (length=231 residues).
MNNQENQAVEIDVFATLKVLWKRKFSIILVALVFAIAAFGYSAFLAKKEYQSTSRIYVVSRQNQDNNALTNSDLQAGAYL
VKDYREIILSQNVLSQAIEELKLDMTPAELSKKINVSVPTDTRILSITAKDGDPKEAARIANGLRNVAAEKITSVTKVSD
VTTLDEAEVPQSPSSPNIKRNVLLGFVAGAGLMVVLLVVVEVLDDRVKKPEDVEELMGLPLLGVVPDIKKL
>gnl|bykdb|I2CAF3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens Y2] (length=235 residues).
MNENMSFKELFDIIKHRLLLIFIMTAVVTLVTGYIQFRVISPVYQSSTQVLIHETSGEKNSNLSDVQLNLHYNNTFQTIM
KSPVVLEKVKQTLHLSETASALKAKITTSSETDSEIITVAVQDENPKQAAAIANTLMKTFKKEVRDRMNIKGVIVLSEAK
ASESPMVKPSRIRNIVMAFGAALMAGVTLAFFLHFLDETVKSERQLSEKTDLPVLGVVYDIKNQQTRSDEKHFGE
>gnl|bykdb|I2CB17 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens Y2] (length=248 residues).
MGESTSIKEIFAILRKRLLFILIITAAASAAGGLISFFALTPVYENSTQILVSQSKNNQKEVQFNDVQTNLQLINTYNVI
IKSPVILDEVIKQLHLSMTSKELESKITVSSEQDSQVVTIAVRDTDAKRAAVMANAVAAVFQDKITAIMNVDNVSILSKA
EAADSQSPAEPNRKLNIAIAFAAGLLGGIGLAFLLEHLDNTIKSEEQLESLLGIPILGTVTSISTKDSVAKNLRMAETKQ
AGGGHVDA
>gnl|bykdb|I2HVL3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus sp. 5B6] (length=235 residues).
MNENMSFKELFDIIKHRLLLIFIMTAVVTLVTGYIQFRVISPVYQSSTQVLIHETSGEKNSNLSDVQLNLHYNNTFQTIM
KSPVVLEKVKQTLHLSETASALKAKITTSSETDSEIITVAVQDENPKQAAAIANTLMKTFKKEVRDRMNIKGVIVLSEAK
ASESPMVKPSRIRNIMMAFGAALMAGVTLAFFLHFLDETVKSERQLSEKTDLPVLGVVYDIKNQQTRSDEKHFGE
>gnl|bykdb|I2HW54 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus sp. 5B6] (length=248 residues).
MGESTSIKEIFAILRKRLLFILIITAAASAAGGLISFFALTPVYENSTQILVSQSKNNQKEVQFNDVQTNLQLINTYNVI
IKSPVILDEVIKQLHLSMTSKELESKITVSSEQDSQVVTIAVRDTDAKRAAVMANAVAAVFQDKITAIMNVDNVSILSKA
EAADSQSPAEPNRKLNIAIAFAAGLLGGIGLAFLLEHLDNTIKSEEQLESLLGIPILGTVTSISTKDSVAKNLRMAETKQ
AGGGHVDA
>gnl|bykdb|I3EBB4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus methanolicus] (length=246 residues).
MEETISLRELFMTLRKRLSLILIVTLMSVMVSGVVSYFFLTPIYEASTQLLVNQAKNEQALYNYNEVQTNLQLINTYNVI
IKSPAILDLVIKELHLDMTTEELNEKINVQSEKDSQVVNISVQDPDPYQAAKIANKTAEVFKREIVKIMNVDNVSILAKA
TVTDNQAPVKPKPLLNIAIALVVGLMTGVGLAFLLEYLDNTIKTEQDIEKLLELPVLGVIATIDEQNDSSIRSERKARYR
GETVGS
>gnl|bykdb|I4DBG9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Desulfosporosinus acidiphilus] (length=232 residues).
MEEEIDLRQYLEVLGKRWLIIVAIPLIAAITSGVISFFILKPSYEASTTLIVGKKATEEGQAAAQMLDNNVLLANQQLAK
TYATIAQSRTVEEQVIKDLDLPLTVEALDKLITVDQVKTTEILEIKVSNNDPKLAASIANTMAKEFSKAVIEIKKVDSVS
IVDKAETPDAPVKPNKKLNILIGFVVGLMAAVGLAFLLEYLDNTIKTSNDVETLLGIPVLGVIPNYEIGKQA
>gnl|bykdb|I5ASF9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Eubacterium] cellulosolvens 6] (length=256 residues).
MEERAAVIQNLNLQDDGGEMELDLVELLYEIRKKIWYVILFALIGASIAAGITKFVMTPMYTSSSMMIVLTKETTIASIA
DLQMGSQLTNDYKVLILSRPVLEKTIKKTGLDMDYKELKKYLTITNENDTRILQLSVEQPNPKLAKKVVDTLAAVSSAYI
ADKMEVQAPKIVEVGEVPIRPTSPSLMKNVVIGFLLGALLMIAFITVQVMMNDSVVSDEDVEKYLQLTTLASIPLKSAED
SKAKKSRANKRKGRCA
>gnl|bykdb|I5AV00 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][[Eubacterium] cellulosolvens 6] (length=249 residues).
MDNRKNAQIEIDLGAIMHLLFTKLPVIVITSAIFLLANLLYVNAKYAPYYTSSTKLYVMPKSSTGNLNSDLQAGATLTKD
YVELIQSREVTEAVSARLSMKNTVGGYISPSAIRGMIRVSVADNTRVITIYITDFDPFRACDIANCVREEAAKHITNVMD
AEAVNVVDEASIPMAKSGPNPKRNAILGGIFGAFLAIAAVIIFNLADDTIKNAGDIQKYLEISALGVIPLAEGVKRNKKH
RFLNIGRRR
>gnl|bykdb|O06029 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGEVTGNIQMANT
INQVIVSPVILDKVRSNLNLSDDSFQKQVTAANQTNSQVIMLTVKYSNPYIAKKIADETAKIFSSDAAKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEALGLTVLGVTSYDQMSDFNKNTNKNGTQSGT
KSSPPSDHEVNRSSKRNKR
>gnl|bykdb|O87930 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=232 residues).
MNQDNTKTKSVEIDILALLHKLWTKKLLILFIAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTY
LVNDYKEIITSNDVLSEVIKDEKLNLSEAELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVRKVASEKIKKVTKVE
DVTTLEEAKLPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVRRPEDVEDVLGMTLLGIIPDTDKI
>gnl|bykdb|P0C0T8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=230 residues).
MNKIANTEVEINIFNLLKKLWKKKFLITFVAIAFATAGLFYSLFIVTPQYTSSTRIYVINPNTPNNSITAQDLQAGSFLA
NDYKEIITSTDVLEKVISSEKLNYPSSQLLQKITVSILKDTRVISISVEDANPKMSQKLANSVREAAVSKIKAVTQVEDI
TTLEKGNLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVNTEEDIEKVLGLTSLGIVPDLNKL
>gnl|bykdb|P39850 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=221 residues).
MESTIDLSELLGRVRKNMKLLIILPLLGLLISAIISFFFLDVKYQASTQILVNQKGNDSQIMAQEVQSNIQLVNTYSEIV
KSPRILDKVSKELDDKYSRSEISSMLTVTNQAESQVLNIDVESKSGSNSEKIANKIAEVFSDEVPDIMNVDNVSVLSTAD
NTGKQVAPKPMVNLVVGLVIGLVIALLIIFIKEVFDKRIKTEEEVENELVIPVLGSIQKFD
>gnl|bykdb|P71050 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=234 residues).
MNENMSFKELYAIVRHRFVLILLITIGVTLIMGFVQFKVISPTYQASTQVLVHESDGEENSNLSDIQRNLQYSSTFQSIM
KSTALMEEVKAELHLSESASSLKGKVVTSSENESEIINVAVQDHDPAKAAEIANTLVNKFEKEVDERMNVQGVHILSEAK
ASESPMIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCKSARQLSERTGLPCLGSVPDVHKGRNRGIKHFGE
>gnl|bykdb|P72511 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLSRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVK
DYREIILSQYVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVKRPEDIENTLQMTLLGVVPNLSKLK
>gnl|bykdb|P95695 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=222 residues).
MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNPQFMAQEVQSNIQLVNTYKEI
VKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKA
DGTAVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
>gnl|bykdb|P96474 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQGEKPGLTNQDLQAGAYLVK
DYREIVLSQDVLEEVISDLKLDLMPKGLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVKRPEDIENALQMTLLGVVPNLGKLK
>gnl|bykdb|P96715 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=248 residues).
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERKEVQFNDVQTNLQLINTYNVI
IKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNISVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKA
EVSEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEK
TGSGHFGA
>gnl|bykdb|Q03GL9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Pediococcus pentosaceus] (length=261 residues).
MESVESQQISIGQILSILRKHIGLIFASTFIVTLLAAFMTFFVMTPKYSATTQILVNRKLSDDMAGAQLQQTQADVQMIS
TYKDIITSPTVLKTVNTKLQGQPGYEKGDVDSLKGSLSVNSQQNSQVFSITAKSTNPNTAAKMANETATTFKNKVVKIMS
INNVSIVSKATADDQPVSPRTKLNIAAGLAVGLLLGMGLAFLREFSDRTVTSEEFLTDELGLKGLGIISEINESDIRRKI
TPKLRAPMSDDDDQSRMRRRV
>gnl|bykdb|Q03W94 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Leuconostoc mesenteroides subsp. mesenteroides] (length=297 residues).
MNNVLELRQLWQIIRKHFFSIVVMAIIGAAAGFGIAKFVIAPTYSASTSMLVNRSADDTSTATANLSDQQADVQLINTYK
NLIISSNVLGTVSKELKNPAPIVVQEAQDAEYKTLADGTQRLVTPAKKRITKPSTKTKYNLSVEELKSMISISNQTNSQV
FSINVKAKDSKLAADVANEVADAFKDKIGGFMKINNVSIVDAAKANKQPVAPNVKLFTLAGLVVLGGLTFLYMLVKELSD
TTIKSPDEISEAFGMTNLGIIGHVKPIKHFSMSPKVEIAKPENSKTPRSRLSRLDRD
>gnl|bykdb|Q04662 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae serotype III] (length=230 residues).
MNKIANTEVEINIFNLLKKLWKKKFLITFVAIAFATAGLFYSLFIVTPQYTSSTRIYVINPNTPNNSITAQDLQAGSFLA
NDYKEIITSTDVLEKVISSEKLNYPSSQLLQKITVSILKDTRVISISVEDANPKMSQKLANSVREAAVSKIKAVTQVEDI
TTLEKGNLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVNTEEDIEKVLGLTSLGIVSDLNKL
>gnl|bykdb|Q04DV7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Oenococcus oeni] (length=233 residues).
MDTAISYQRLWELFKKNFFFMLFSALFFTAIAFATCKFVIAPKYQSTAALLVNRSQDDTAATALNDQQADVGLIYTYKDL
ITRPVILNKVAKELKSTYPTLTSTALAKMITVSSTTNSQIFSIAVRSTSSQEAKDIANETASVFKNEAVKLMGKTISNVT
IVSSGLKNNTPVFPNTKLFSLAGFLIGGFLAVAYVLIKEISDNTYRETEYIGQLGFNNLGTVNYAAFHKRRNN
>gnl|bykdb|Q0SVR9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=232 residues).
MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQYEAKTKLFIGKQETSQNAANYDNNDIMMYQKLMKTY
AELAKTSDLVTKAVKNAKLDYNQNEIKGVLNNLNVTPSADTQILDLSFKGKNPKEVLKVTEAITDEFISESKELIPNGNV
QVIQKPQLPENPVSPNKKLNILIAFVLGLMIGVGIVLLLEYLDNTFKSREELEKTLDLPIIGAIPDYDSIEK
>gnl|bykdb|Q1G8E3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=279 residues).
MSAEQQNNEEVTIDLRRLFILIKKHIISILIWMIGLGLIAYGVSEYVLVPKYTASTQLLVNRKTADANQAYANQQADINA
ITTYKDIITSNVILKGASKYLANPVTLVKKATPAKKAVKAKPAVYKRESKSYSVSASELASAVSVTTTDSSQVFTLSATA
ETPAKAQAIANAVAKEFKEQIPKIMNVNNVTIVAEASKGTKSFPKVSMFTAIGVLAGLVISLLIIIIKDLSDTTVREDSF
MTNELGLTNLGEIAHITMPKDWTFTAKTAEKRGSSRRRV
>gnl|bykdb|Q1WCR2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSVEIDVLALLHKLWTKELLILFTAFYFAVFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTFLV
KDYKEIITSNDVLSEVIKDEKLNMTEAELAKMISVDIPTDTRLISISVKAKTGQDAQVLANKVREVASKKIKNVTKVDDV
TTLGEAKLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRIRRPEDVEDVLGMTLLGIIPDTDKI
>gnl|bykdb|Q1WTC7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius] (length=247 residues).
MDNIKKEYRELDLFEIFQMLLRHWWIILLSGLLCGLAAFTYSKFAVVPQYTSVTKIYLSNKLTENQTNPTPSTELIKDYE
EMVKSRAVLENIIEKHDLRYSYGELSKKVNAENKDETQIISISVTDPNPVVAQRLANSIRDESIKHVTKVMKVISVGVVD
KANYPQSQSYPITIKWIEYGFLIGFVLSIGVLLIRFILDDTIKTSEDVEKYLGLSTLAVIPKISDSNNKKKYYGNYGKGK
SKRRKRV
>gnl|bykdb|Q2BFS6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus sp. NRRL B-14911] (length=246 residues).
MEETISLKELFQTLRKRLGLILSIAFVAVATSGLISYFYLTPIYQSSTQLLVNQAKSDQPVYNPGEIQTNLQLINTYNVI
IKSPAILDLVKEELDLDITTSQLDSKITVGSQKDSQVLAITVQDPDPNMAADIANTTANVFKREIVEIMNIDNVKILAKA
ELTDNPAPIKPNKLLNMAIALVVGLMAGVGLAFLLEYMDNTVKTEQDIEKLLDLPVLGTIAIINEETGAMEEKAARKQRG
GERDAV
>gnl|bykdb|Q2FUV1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=220 residues).
MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSDLAFQNVQSSLQSVNTYTEII
KSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVSVTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAH
DNAVKVSPIVSVNLVISIIVGIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
>gnl|bykdb|Q2G1K8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=222 residues).
MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNPQFMAQEVQSNIQLVNTYKEI
VKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKA
DGTAVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
>gnl|bykdb|Q2KM75 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus iniae] (length=229 residues).
MNTSENTSIEIDILSLLKRIWQKKVVILFVTLLAGFLALVASMFLIKPSYTSTTRLYVINRQQSDNLTATDLQAGGYLVN
DYKEIITSRDVMHDVIAKENVSMSPEELSQMITVTVPADTRVISISVNNHEPQKAKDLANAVREVASEKIKDVTKVQDVT
ALEKAQLPTKPSSPNSKRNAVMGLLVGAVLSIFAVILKEVLDDRVKSPEDVEDVLGMTLLGMVPNTNKM
>gnl|bykdb|Q38VG4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus sakei subsp. sakei] (length=246 residues).
MEQTINIEQIFGILRKYSRLIILSTVIFTLLAGILTFFVITPQYSASTEVLVNRKQNTDANAQYNQVQTDVQMINTYKDL
ITKPVIMDSVTKKINDGKTNKLSNDEIADMLSITNNQNSQVFSVTAKADNAYTAADIANMTATTFQKKVPKIMSGTDNVS
IISEAKPNLVPVSPKNGLNLLIGFILGLIIGITIAFIRELMDKTIKDESFLTEELGLTSLGIINNIAPKDLIKKAIMKTS
TLSRRG
>gnl|bykdb|Q3EV65 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar israelensis ATCC 35646] (length=251 residues).
MEELMEETISLKELFHIFKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMFQAGEIQTNIQLTNT
YKVIIKSPVILEQVNEKLNLNMTAQELTKKVNVANEKDSQVIAVTAEDKDPKIARDIANATADVFKGEVAKIMNVDNVTV
ISKAEVAENQSPIKPAPMLNIAIAFIVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETLNVKSHAPS
SRKVRGQTIGS
>gnl|bykdb|Q3K0S9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae serotype Ia] (length=230 residues).
MNKIANTEVEINIFNLLKKLWKKKFLITFVAIAFATAGLFYSLFIVTPQYTSSTRIYVINPNTPNNSITAQDLQAGSFLA
NDYKEIITSTDVLEKVISSEKLNYPSSQLLQKITVSILKDTRVISISVEDANPKMSQKLANSVREAAVSKIKAVTQVEDI
TTLEKGNLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVNTEEDIEKALGLTSLGIVPDLNKL
>gnl|bykdb|Q3XYS7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Enterococcus faecium DO] (length=259 residues).
MEETINFKEIFETLRKHLLTIIISMFAGLAISGIVTFFILTPKYSSQAQLIVTLPQSDTANVNEVNTNLQMINTYKDMIV
SDLVLNEVKNRLETEDNVKMTAGQIKDAISVNQSENSQMFSIQAISTNAVTAQQIANTTSQVFQENAKDVMNVDKISIIS
GAVANTTPVSPNNKLNLVIGLMLGMMVGVGLASLFELLDRTVKDEKYVTDTLGFPILGTVPEMSAKELNAGIRKQGPAPT
RPKATNDKTFPSRRSRSRV
>gnl|bykdb|Q3ZK51 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus lactis] (length=259 residues).
MQETQEQTIDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQTNSQVITLTVKYSNPYIAQKIADETAKIFSSDAAKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEALGLTVLGVTTYAQMSDFNKNTNKNGTQSGT
KSSPPSDHEVNRSSKRNKR
>gnl|bykdb|Q4A121 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus saprophyticus subsp. saprophyticus] (length=222 residues).
MEETIDLNKLFAILKKNMKYLIILPIVFLVLSMMMTFLFITPKYSSSTQVLVNQKETDSQMMAQQVQSDLQLVNTYSEII
KSPRILDKVSKNLKGKYSSEEIAGMLTVSNQAESQILNIAVENESREAAGKVANEIANVFSKDVNKIMNVDNVSILSKAD
YYGSKDSPKPLINAVVGVFLGLIVALIIIFLKEILDKRIKTEEDVEELLDLPVLGVIQRFDY
>gnl|bykdb|Q4JYH6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSISVNDRVSEEASRIANSLREVAGQKIISITRVSDVT
TLEEARPTISPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTRVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4JYK9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNMIEIDVFQLFKILWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKLGLTNQDLQAGSYLV
KDYREIILSQDSLEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLQIPLLGLVPDLDKMK
>gnl|bykdb|Q4JYU0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKENKEITIDVFQLFKVLWKKKTSIILTAIVAAVLAFAVSSFVLTPEYSSTTRIYVVNRNQSEKAGLTNQDLQAGTYLVK
DYKEIILSQDVLEKVISNLKLEKTVKELSKKIQVTVPVDTRIVSITVKNAQPEEASRIANALREVAAEKIISVTRVSDVT
TLEEARAALSPSSPNIRRNTLLAFLAGGAVMVVSVLLLELLDDRVKRPEDVEEVMQIALLGVVLDLNKLK
>gnl|bykdb|Q4JYY0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLVKILWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQEDKPGLTNQDLQAGTYLV
KDYREITLSHDVLEKVATNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVTVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDFEDVLQIPLLGLVPDLDKMK
>gnl|bykdb|Q4JZ19 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MQDQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGTYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVIVPIDTRIVSVSVNDRVPEEASRIANSLREVAAKKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGGLGTSVIVLLLELLDTRVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4JZ56 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=226 residues).
MNNRIVDISLFDLLNVLWLRKWIIVFVSFVFGCISFLYYQFFVPKTYTSDTRIYVVSKGDNKNLSNADLQAGSALTKDYK
EIILSDEVLEETISDLKLESTLESLASKIKISIPAETRIISISVTNTNSDEAARIANGIRKVAALKIKEVTQVTDVTTLQ
TARPPQTPSGPHVRKSTTAGLVLGAFLTVFLVVAKEILDDRIKRFEELEKLGIPILGSIPLSKNIK
>gnl|bykdb|Q4JZ85 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRILWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSLPNIKRNTLIGFLAGGIGTSVIVFLLELLDTHVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4JZG8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTTEIDVFQLVKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLV
KDYREIVLSQDVLEKVVTNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANFLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLKIPLLGLVPDFNKIK
>gnl|bykdb|Q4JZK2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNMIEIDVFQLFKTLWKRKLIILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRDQGDKPGLTNQDLQAGSYLV
KDYREIILSQDVLEKVATNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIEVLDTRVKRPEDVEDVLKIPLLGLVPDFDKIK
>gnl|bykdb|Q4JZL8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLV
KDYREIILSQDALEKVATNLKLDIPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIEVLDTRVKRPEDVEDVLKIPLLGLVPDFDKIK
>gnl|bykdb|Q4JZS4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSAFIVKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLV
KDYREIILSQDVLEKVATNLKLDMPAKTLTRKVQVTVPVDTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDIRVKRPEDVEDVLQIPLLGVVPDFDKMK
>gnl|bykdb|Q4JZW8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRDQGDKSGLTNQDLQAGTYLV
KDYREITLSQDVLEKVATNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPVTTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELIDTRVKRPEDVEDVLQIPLLGVVPDLDKMK
>gnl|bykdb|Q4JZY2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKENKEITIDVFQLFKVLWKKKTSIILTAIVAAVLAFAVSSFVLTPEYSSTTRIYVVNRNQSEKAGLTNQDLQAGTYLVK
DYKEIIISQDVLEEVISNLKLEKTVKELSKKIQVTVPVDTRIVSITVKNAQPEEASRIANALREVAAEKIISVTRVSDVT
TLEEARPALSPSSPNIRRNTLLAFLVGGAVMVVSVLLLELLDDHVKRPEDVEEVMQIALLGIIPDLNKLK
>gnl|bykdb|Q4K006 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNMIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDNPGLTNQDLQAGSYLV
KDYREIILSQDVLEKVATNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLQIPLLGVVPDLNKMK
>gnl|bykdb|Q4K046 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTTEIDVFQLVKTLWKRKLMILLVALVTGAGAFVYSTFIVRPEYTSVTRIYIVNRNQGDKAGLTNQDLQAGTYLV
KDYREIILSQDVLEKVAANLKLDMPAKTLTSKVQVTVPADTRVVSISVKDKQPEEASRIANSLREVATEKIVAVTRVSDV
TTLEEARPATTPSSPDVRRNSMFGFLGGAAVTAIAVFLIELLDTRVKRPEDVEDVLQIPLLGIIPDLDKMK
>gnl|bykdb|Q4K0A1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MQDQNTLEIDVFQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPATSPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTHVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4K0E2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MQDQNTLEIDVFQLFRALWKRKLVILLVAIITSSVAFAYSTFIIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSISVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVKRPEDIENTLQMTLLGVVPNLNKLK
>gnl|bykdb|Q4K0I3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSIFIVKPEYTSTTRIYVVNRNQENKPGLTNQDLQAGTYLVK
DYHEIILSQDVLEKVATNLKLDIPVKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSIREVAAEKIIAVTRVSDVT
TLEEARPATTPSSPNVRRNTLVGFLGAAAVTVITVLLIELFDTRVKRPEEVEDVLQMPLLGVVPDFNKMK
>gnl|bykdb|Q4K0K3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFTYSTFVIKPEFTSTTRIYVVNRNQGEKSGLTNQDLQAGTYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNILIGFLAGVIGTSVIVLLLELLDTRVKRPEDIEDTLQMTLLGVVPNLNKLK
>gnl|bykdb|Q4K0M4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRDQGDKPGLTNQDLQAGSYLV
KDYREIILSQNVLEKVATNLKLDMPTKTLASKVKVTVPTDTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLQIPLLGVVPDLNKMK
>gnl|bykdb|Q4K0R8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLLKTLWKRRLMILLVALVTGAGAFAYSTFVVKPEYTSTTRIYVVNRNQEDKPGLTNQDLQAGTYLV
KDYREIILSHDVLEKVATNLKLDMPARALASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFSFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLRIPLLGLVPDLDKMK
>gnl|bykdb|Q4K0T6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRTLWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGGIGTSVIVFLLELLDTHVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4K0V3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSMTRIYVVNRNQGEKSGLTNQDLQAGSSLVK
DYREIILSQDVLEEVVSDLKLDLTPKDLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPATSPSSPNIKRSTLIVFLAGVIGTSVIVLILELLDTRVKRPKDIEDTLHMTLLGIVPNLNKLK
>gnl|bykdb|Q4K0X6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTRVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4K0Z7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRSLWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGTYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPATSPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTHVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4K196 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDGLQLFRALWKRKLVILLVAIITSSVAFTYSTFVIKPEFTSTTRIYVVNRNQEEKPGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSGLKLDLTPKGLANKIEVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGGIGTSVIVFLLELLDTRVKRPEDIEDTLQMTLLGVVPNLNKLK
>gnl|bykdb|Q4K1B8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLLKTLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLV
KDYREIILSQDALEKVATNLKLDMPAKTLASKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLKIPLLGLVPDFDKIK
>gnl|bykdb|Q4K1G0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRVLWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLASKIKVTVPADTRIVSVSVNDRVPEEASRIANSLREVAAKKIISITRVSDVT
TLEEARPAISPSSPNLKRNTLIGFLAGVIGTSVIVLLLELLDTRVKRPEDIEDTLQMTLLGVVPNLNKLK
>gnl|bykdb|Q4K1K7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MEEQNTLEIDVLQLFRSLWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGTYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDVT
TLEEARPATTPSSPNVRRNTLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLQIPLLGLVPDLDKMK
>gnl|bykdb|Q4K1M5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEHNTLEIDILQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNQEEKSGLTNQDLQAGTYLVK
DYREIILSQDVLEEVISDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNILIGFLAGGVGTGVIVLLLELLDTHVKRPEDIEDTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4K1S8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLSRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVKRPEDIENTLQMTLLGVVPNLSKLK
>gnl|bykdb|Q4K238 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTIEIDVFQSLKTLWKYKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLVK
DYREIILSQDVLEKVATNLKLDIPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDVT
TLEEARPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|Q4K255 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQSLKTLWKHKLIILLVALVTGAVAFAYSTFIVKPEYMSTTRIYVVNRNQGDKPGLTNQDLQAGAYLV
KDYREIILSQDVLEKVATNLKLDMPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDV
TTLEEARPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|Q4K2A9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLV
KDYREIILSQDVLEKVAINLKLDMPAKALTSKVQVIVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDV
TTLEEARPATTPSSPNVRLNTLVAFLGGTVVTVITVLLIELLDTRVKRPEEIEDVLQMPLLGVVPDLDKMK
>gnl|bykdb|Q4K2E2 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTMEIDVIQLLNTLWKRKLIIALVAIVTGAIAFAYSSFIIKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLV
KDYREIILSQDVLEKVVTDLQLDMPTKNLASKIQVTVPVDTRIVSISVKDKQPEEASRIANSLRKIAAKKIISVTRVSDV
TTLEEARPATSPSSPNIRRNTLIGFLGGLGVVVMVVLLLELLDVRVKRPEDIEDVMQIPLLGVIPNLDKLK
>gnl|bykdb|Q4K2F8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTMEIDVFQLLNTLWKRKLIIALVAIVTGAIAFSYSSFIIKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLV
KDYREIILSQDVLEKVVTDLQLDMPTKNLASKIQVTVPVDTRIVSISVKDKQPEEASRIANSLRKIAAKKIISVTRVSDV
TTLEEARPATSPSSPNIRRNTLIGFLGGLGVVVMVVLLVELLDVRVKRPEDIEDDMQIPLLGVIPNLDKLK
>gnl|bykdb|Q4K2Q8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFVYSTFVIKPEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVKRPEDIEDTLQMTLLVVVPNLSKLK
>gnl|bykdb|Q4L9H8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Staphylococcus haemolyticus] (length=220 residues).
MENKLDLSNIFKIIKKNWGIWLFIPIIFLLISLIITFLFMTPKYEATTQILINQKEKNKELMAQEVQSNIQLVNTYSQIL
KSPRILDEVAKKDNKYSSDEINNMLSIDAESDSQILNVNVESKNKKDSEKIANEIAKVVSDEMPKIMSVDNVTILSKATG
TAHKVSPKVPVNIAVAIILGLLVAILIIILKELLDKRIKTEEDVERELNIPVLGSIQKLK
>gnl|bykdb|Q54519 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSMTRIYVVNRDQGEKSGLTNQDLQAGSSLVK
DYREIILSQDVLEEVVSDLKLDLTPKDLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVT
TLEEARPATSPSSPNIKRSTLIGFLAGVIGTSVIVLILELLDTRVKRPKDIEDTLQMTLLGIVPNLNKLK
>gnl|bykdb|Q55204 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=230 residues).
MNQDNTKSDEIDVLALLHKLWTKKLLILFTAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTYLV
NDYKEIITSNDVLSEVIKDEKLNMTEAELAKMISVNIPTDTRLISISVNAKTGQDAQTPANKVREVASEKIKKVTKVEDV
TTLEEAKLPESPSSPNIKLNVLLGAVLGAFLAVVGVLVREILDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q58Z11 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=304 residues).
MNEQIDLARLWNVFKHSFIVMILLGLLGMFIAYFGAKTFIAPKYSASTSMLVNRKQDNNPNMQLNAQQADIQIINTYKDI
ITRPVILREVADDLTSPRRVKVKKAQKAVYGTRYNAATGVRERYVVKEEQPAKYKLKPAKYANISEDDLDKMISVSNAQN
SQVFTVNVRDTDPVRAKDVANEIAKVFKAKIASIMSVSNVSIVSRATADPTPVTPNLKIASLIGLILGMVLAFTVGLIRE
LTDQTIKSIDFITNDLGLVNLGLVNYVQRMNDMDEAIARSKNKIIDSEAEPETTGFPQRSRRRV
>gnl|bykdb|Q5FIC6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactobacillus acidophilus] (length=291 residues).
MEQKQEQENTIDLTQLLRICRKHIWALILWSVGLALVGWGVSEFVISPKYTSTAQLLVNQKSRNNDPNAAYATQQANMQM
VTTYKDIVTSNKILTEASNRLANPTVVVKKAQKAVYRTDENGRRRLVRKAQPAVIERSGKSYSVSASELAKSISVGTQQQ
SQVFSISAEADTPAKAKAEVNAVAETFRKEIPTIMSVNNVTIVANGTNGVQSSPNVKLFTLAGFVVGLVLSFAVVIIREM
SNTTVRDDEFLTRELGLTNLGQIAHFHLSSSFTIKKSANMTNRGQAKRRRV
>gnl|bykdb|Q5KUM4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Geobacillus kaustophilus] (length=247 residues).
MEETISLRELFDTLRKRLWLIVLITALATVVSGVVSYFLLTPIYQSSTQILVNQAKSEQQLYNFNEIQTNVQLINTYSVI
IKSPTILEKVKDELHLDRTLDELNEQIQVSSEKDSQVFSVTVQDPDPAMAAKIANKTAEVFKNEIVKIMNIDNVTILSKA
EVKEHQAPVKPKPLLNMAIAFVVGLMTGVGLAFLLEYLDNTIKTEEDVEKHLGLPVLGAVSLITAEGGQKARRESAIPQT
RGETIGS
>gnl|bykdb|Q5WBB3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus clausii] (length=233 residues).
MEETISLKEIFQTLKQRWRLLVAIPFFAMLVSAIISSFVLTPMYERSTQLLVNQAVPEGQLNQQVVRNNLELIDTYSEII
KSPRILNEVIEAEGLDMTYGDLEAAVSVGSQSNSQVVTITVESESPADATLLTNSIATVFQEQIPDIMSIDNVSILSEAE
IGEDPTPVSPKPLLNIAIAFVVGLMAAVGLAFLLEYLDTTIKTEKDIENIIDLPVLGAVSNMDSVDAAAKKTS
>gnl|bykdb|Q67AY5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=230 residues).
MNKIANTEVEINIFNLLKKLWKKKFLITFVAIAFATAGLFYSLFIVTPQYTSSTRIYVINPNTPNNSITAQDLQAGSFLA
NDYKEIITSTDVLEKVISSEKLNYPSSQLLQKITVSILKDTRVISISVEDANPKMSQKLANSVREAAVSKIKAVTQVEDI
TTLEKGNLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVNTEEDIEKVLGLTSLGIVPDLNKL
>gnl|bykdb|Q6HB08 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. konkukian] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAMIQAGEVQTNIQLTNTYKVI
IKSPVILEQVNEKLNLNMTAQALTKKINVANEKDSQVISVTADDKDPKVARDIANATADVFKGEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFFVGLMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|Q6L5R1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=230 residues).
MKEQNMMEIDVFQLLKILWKRKVLIALVAIVTGVVAFAYSSFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLDLPSKGLASKIKVTVPADTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTMIGFLAGAVVMIVAVLLIELLDTRVKRPEDVEDVMQIALLGVVPNLDKLK
>gnl|bykdb|Q6L5T1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MKEQNMMEIDVFHLLKILWKRKLLIALVAFVTGTVAFAYSSFIVKPEFTSTTRIYVVNRNQGDKPGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATDLKLELPPKGLASKIKVTVPVDTRIVSISVTDRAPEEASRIANSLREVAAQKIISVTRVSDVT
TLEEARPATSPSSPNIRRNTLVGFLAGAVVMVVTVLLVELLDTRVKRPEDIEDVMQIALLGVVPNLDKLK
>gnl|bykdb|Q72XH7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGVAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQYNEVQTNVQLTNTYKVI
IKSPVILEQVKEMQGLNITIQELNKKIEVVNEKDSQVVTLMAQDQDPRLARDIANTTAEVFKGEIAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFVVGVMAAVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETTNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|Q7WVX1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MEKQNTLEIDVLQLFRSLWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVSRDQGEKSGLTNQDLQAGSYLTK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVAVPVDTRIVSISVNDQVPEGASRIANSLREVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKLNTLIGFLVGLIVINVTVLLLELLDTRVKRPEDIEDALQMTLLGVVPNLDKLK
>gnl|bykdb|Q7X550 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=205 residues).
LILFTAFYVAVFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGAFLVKDYKEIITSNDVLSEVIKDEKLNMT
EAELAKMISVDIPTDTRLISISVKAKTGQDAQVLANKVREVASKKIKNVTKVEDVTTLGEAKLPESPSSPKIKLNVLLGA
VLGAFLAVVGVLVREILDDRVRRPEDVEDVLGMTLLGIIPDTDKI
>gnl|bykdb|Q7X552 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=205 residues).
LILFTAFYFAVFSFLGTYFFIQPTYTSTTRIYVVNQATDNKNLSAQDLQAGTYLANDYKEIITSNDVLSEVIKDEKLNLS
EAELSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASKKIKKVTKVENVTTLEEAKLPESPSSPNIKLNVLLGA
VLGGFLAVVGVLVREILDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q7X554 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=205 residues).
LVLFIAFYFVAFSFLGTYFFIQPTYTSPTRIYVANQATDDNNLSAQDLQAGTYLVNDYYEIITSDDVLSEVIKDEKLNLS
EAQLAKMISVNIPTDTRLISISANAKTGQDAQTLANKVRKVASEKIKNVTKVEDVTTLEEEQIPESPSSPNIKRNVLLGA
ILGGFVAIVAVLVREVLDDRVRRPEDVEDVLGMTLLGIIPDTDKI
>gnl|bykdb|Q7X556 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=205 residues).
LVLFTAFYVAAFSFLLTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTYLVNDYNEIITSNDVLSEVIKDEKLNLS
EAKLSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASKKIKKVTKVEDVTTLEEAKLPVSPSSPNIKLNVLLGA
VLGGFLAVVGVLVREILDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q7X558 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=205 residues).
LILFTAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTYLANDYKEIITSNDVLSEVIKDEKLNLS
EAELSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASKKIKKVTKVEDVTTLDEAKLPESPSSPNIKLNVLLGA
VLGGFLAVGGVLVREILDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q7X560 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=204 residues).
ILFTAFYVAAFSFLVTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTYLANDYKEIITSNDVLSEVIKDEKLNMTE
AELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVREVASEKIKKVTKVEDVTTLEEAKLPESPSSPNIKRNVLLGAV
LGGFLAVVGVLVREILDDRVRRPEDVEDALGMTLLGIVPDKDKI
>gnl|bykdb|Q7X562 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=205 residues).
LVLFTAFYFAAFSFLVTYFFIQPTYTSTTRIYVVNQATDNKNLSAEDLQAGTYLVNDYKEIITSNDVLSEVIKDEKLNMT
EAELDKMISVDIPTDTRLISISVNAKTGQDAQTLANKVREVALEKIKNVTKVEDVTTLEEAKLPVSPSSPNIKLNVLLGA
VLGGFLAVVGVLVREILDDRIRRPEDVEDALGMALLGIVPDTDKI
>gnl|bykdb|Q814Y9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=247 residues).
MEETISLKELFHILKKRLAMILVIAFGAAIVSAIISFFFMTPIYQSSTQILVNQKKQEGAAIQLGEIQSNIQLTNTYKVI
IKSPVILDRVNEKLNLNMTAQALTKKINIANEKDSQVISVTAEDKDPKLARDIANATADVFKDEVAKIMNVDNVTVLSKA
EVAENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVKKEEDVENLLGLPVLGIVARMDEETMNVKSHAPSSRKV
RGQTIGS
>gnl|bykdb|Q83VG0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=259 residues).
MQETQEQTIDLRVIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNSAAYAGQVTGNIQMANT
INQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQTNSQVITLTVKYSNPYIAQKIADETAKIFSSDAEKLLNVTNVNILS
KAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEALGLTVLGVTSYAQMSDFNKNTNKNGTQSGT
KSSPPSDHEVNRSSKRNKR
>gnl|bykdb|Q83YR6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=230 residues).
MNKENQLVEIDVLSLIKTVWKRKFIILLTALVAAVLALGYSLFIAKPSYQSTTRIYVVNRQQTDNNTLTNQDLQAGSYLV
KDYKEIILSQDVLSTVISELKLPGTTAELSKSVSVSVPTDTRIVSITVKNSDPNQASRIANTLREVAAEKIIAVTKVSDV
TTLEEAEVPKSPSSPNIRRNVILGFLAGAMVMIVIVLIVEILDDRVKKPEDIEDVMGATLLGVIPNLKKL
>gnl|bykdb|Q8EME7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Oceanobacillus iheyensis] (length=255 residues).
MEETISLKEIFEVIKKRLLLIFTFILVAALAAAIISYFVMTPKYENSSQFIVNQSNQEQANQFTQTDIRTNVEIINTYNV
IIKSPAILDTVATELQLDLTSSQLSEKISVASEENSQVVTVTATDPDPLLATDIANTTVQVFQDEIPDIMNVDNVSVLSQ
AELAEEPSPVAPNPILNIAIAMVLGAMVGVGIAFLLEYLDNTIKTEQDIEKQLNIPVLGVISHMDEKDVRNEQFGRASSV
NKSVRSGFDGAKKTV
>gnl|bykdb|Q8GMA6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSDEIDVLALLHKLWTKKLLILFTAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTYLA
NDYKEIITSNDVLSEVIKDEKLNLSEAELSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASKKIKKVTKVEDV
TMLEEAKLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRVRRPEDVEDALGMALLGIVPDTDKI
>gnl|bykdb|Q8GP55 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSDEIDVLALLHKLWTKKLLILFTAFYFAVFSFLGTYFFIQPTYTSTTRIYVVNKATDNNNLSAQDLQAGTYLA
NDYKEIITSNDVLSEVIKDEKLNLSETELSKMVSVNIPTDTRLISISVKAKTGQDAQVLANKVREVASKKIKNVTKVDDI
TTLGEAKLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q8GP93 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSDEIDVLALLHKLWTKKLLILFTAFCFAAFSFLGTYFFIQPTYTSSTRIYVVNQANDSKNLSAQDLQADTFLT
KDYKEIITLNDVLSEVIKDEKLNMTEAELAKMISVDIPTDTRLISISVNAKTGQDAQTLANKVREAASEKIKNVIKDEDV
TTLEEAKLPESPSSPNIKRNVLLGAVFGGFLAVVGVLVREILDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q8GPA9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSDEIDVLALLHKLWTKKLLILFTAFYFAAFSFLVTYFFIQPTYTSTTRIYVVNQATDNKNLSAEDLQAGTYLV
NDYKEIITSNDVLSEVIKDEKLNMTEAELDKMISVDIPTDTRLISISVNAKTGQDAQTLANKVREVALEKIKNVTKVEDV
TTLEEAKLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRIRRPEDVEDALGMALLGIVPDTDKI
>gnl|bykdb|Q8GPC4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSVEIDVLALLQKLWTKKVFILFTAFYVAAFSFLVTYFFIQPTYTSTTRIYVVNQATDNNNLSAQDLQAGTYLA
NDYKEIITSNDVLSEVIKDEKLNMTEAELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVREVASEKIKKVTKVEDV
TTLEEAKLPESPSSPNIKLNVLLGAVLGAFLAVVGVLVREILDDRVRRPEDVEDALGMTLLGIVPDTDKI
>gnl|bykdb|Q8GPF7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=230 residues).
MNQDNTKSDEIDVLALLHKLWTKKLLILFTAFCFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNKSLSAQDLQAGTYLV
NDYKEIITSNDVLSEVIKDEKLNLSETELSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASEKIKNVIKDEDV
TTLEEAKLPESPSSPNIKRNVLLGAVFGGFLAVVGVLGREILDDRIRRPEDIEDTLGMTLLGIVPDTDKI
>gnl|bykdb|Q8KWQ1 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MKEQNTIEIDVFQLFKTLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNHNQGNKLGLTNQDLQAGSYLVK
DYREIILSQDVLEKVATNLKLDMPAKTLASKVQVTVPDDTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDVT
TLEEARPATTPSSPNVRRNSLFGFLGGVVVTVIAVLFIELLDTRVKRPEDVEDVLQIPLLGLVPDLNKMK
>gnl|bykdb|Q8RBS6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Caldanaerobacter subterraneus subsp. tengcongensis] (length=227 residues).
MMEEELDLREVFLILRKRIKIILLITVLAMLVSGLISYYVLSPVYKASTSLIISRTQNITINDQIQLQDIQTSRMLAATY
SEIVKSRRVLQPVVTKLNLPMSVEDLKGKIDVTSKDNTEIIEISVRDNNPERAAEIANAIASSFMDNIVKIMKIDNVQVI
DRAVPPTSKVSPKTSLNVVIAGVLGLMISIFLVFLLEYMDRTVKTPDDIKKYLNLPVLGIIPEVKNK
>gnl|bykdb|Q8VU32 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQVLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQEGKSGLTNQDLQAGTYLV
KDYREIILSQDVLEKVATNLKLDMPAKALTSKVQVTVPTDTRIVSISVKDKEPEEASRIANSLREVAAGKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNTLVGFLGGAVVTVITVLLIELLDTRVKRPEEVEEVLQVPLLGVVPDLDKMK
>gnl|bykdb|Q8XN47 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=232 residues).
MEENTISLQEIAYALKKRWKLIALITIAATLVSAILSFFVIKPQYEAKTKLFIGKQETTQENASYNNNDVMMYQKLMKTY
AELVKTSDLVTKAVKSANLDYNQKEIKGILNNLNVTPSADTQILDLSYKGGNPKDVLKVTEAITSEFISESKELIPNGNI
QVIQKAQLPEHPVSPNKKLNILIAFVLGLMIGVGVVLLLEYLDNTFKSREELEKTLELPIIGTIPDYDNVGK
>gnl|bykdb|Q8XN77 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=220 residues).
MEEKTLDIQEILYALKKRYKLIIIIMLLPILFSAYKAYKMKPSYQSRVKFFIGKEGIKGTYSVGELEEYKKMIGAYVEIF
NNEDVVSKLLKKANIDLPTNYVRSGLSFIPGNGSIPTLEISYRSYNKEEVDQIIKVMTDEFESIVGEYIVNSNIEILDYP
KSRTIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIKNKKELEKILPIPVIGEIPIHD
>gnl|bykdb|Q97EP7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium acetobutylicum] (length=227 residues).
MEQGNDIDFTGFIDVLNKEKAMIALVTIFFVLFSAILSFFIIKPTYQGHVTVIIGRNDSKSSTNEQYNDVMMSQNLTKTY
AQIAESRSVASKTVSKLSNGTTIDQVSKVVSVTPETGTQIIDITANAKSPEEAADLANDFSDSFVAVSKEVYTAGDARII
DRATAPKSPIKPKKLINIVVAFVLGLFVSIGIAFIKEYMDKTIKTQDDIKRHLDLPVLGVIPSYEEE
>gnl|bykdb|Q97ER4 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Clostridium acetobutylicum] (length=227 residues).
MEQENDIDFTGIFEVLNKEKAMIAAVTIFFVLFSAILSFFIIKPTYQGHVTVIIGKNDSKSSTNEQYNDVMMSQNLTKTY
AQIAQSKQVADKTVSKLADGTTADQVLGLVSVTPQTGTQIIDITANGKSPDKAADLANDFSDSFVEVSKAVYTAGDARII
DRATAPKSPIKPKKMINIAIAFILGLFISVGIAFIKEYMDKTIKTQEDIKKHLDLPVLGVIPNYEEE
>gnl|bykdb|Q9AH96 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=230 residues).
MQDQNALEIDVFQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSTTRIYVVNRNKEEKSGLTNQDLQAGSYLVK
DYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSISVNDRVPEEASRIANSLRKVAAQKIISITRVSDVT
TLEEARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVKRPEDIENTLQMTLLGVVPNLGKLK
>gnl|bykdb|Q9AHA5 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLV
KDYREIILSQDALEKVATNLKLDMPAKTLASKVQVTVPTDTRIVSISVKDKQPEEASRIANSLREVAVERIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELFDTRVKRPEDVEDVLQIPLLGLVPDLDKMK
>gnl|bykdb|Q9AHB8 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWQRKLMILLVALVTSAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLV
KDYREIILSQDALEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDIEDVLKIPLLGLVPDFDKMK
>gnl|bykdb|Q9AHD3 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLVKSLWKRKLMILIVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLV
KDYREIILSQDVLEEVVSDLKLDLTPKGLANKIKVTVPVDTRIVSISVNDRVPEEASRIANSLREVAAQKIISITRVSDV
TTLEEARPAISPSSPNIKRNTLIGFLAGVIGTSVIVLHLELLDTRVKRPEDIENTLQMTLLGVVPNLGKLK
>gnl|bykdb|Q9K6Q9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Bacillus halodurans] (length=232 residues).
MEETISLKEMFQTIMRRLKLIIALPVLAVCLAGFVSFFLLTPIYQSSTQILVNHSNDNQSFNSQDIRTNIDLINTYSVII
KSPAILDKVIDNLQLEDTYSQLNERLQINSENNSQVVNITVKHEKPAMAVAIANEIALVFQNEIVEIMNVDNVSILSTAE
LGESPSPVSPNPMLNMAIAFVVGLMGAVGIAFLLDYLDTTIKDEKEVEDVLELPVLGVIPNFEKSEEKKLIV
>gnl|bykdb|Q9X4U6 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=229 residues).
MNNQEVNAIEIDVLFLLKTIWRKKFLILLTAVLTAGLAFVYSSFLVTPQYDSTTRIYVVSQNVEAGAGLTNQELQAGTYL
AKDYREIILSQDVLTQVATELNLKESLKEKISVSIPVDTRIVSISVRDADPNEAARIANSLRTFAVQKVVEVTKVSDVTT
LEEAVPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVKRPQDIEEVMGLTLLGIVPDSKKLK
>gnl|bykdb|Q9X9A0 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLV
KDYREIILSQDALEKVATNLKLDMPAKTLASKVQVTVPTDTRIVSISVKDKQPEEASRIANSLREVAVEKIVAVTRVSDV
TTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPEDVEDVLQIPLLGLVPDLDKMK
>gnl|bykdb|Q9ZFT9 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=231 residues).
MMKEQNTIEIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKPGLTNQDLQAGTYLV
KDYREIILSQDVLEKVATNLKLDMPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRVSDV
TTLEEARPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVEDVLQMPLLGVVPDFDKMK
>gnl|bykdb|Q9ZII7 [Bacteria] Adaptator of bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae serotype 2] (length=230 residues).
MKEQNTIEIDVFQLFKTLWKRKLMILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKSGLTNQDLQAGSYLVK
DYREIILSQDALEKVATNLKLDMPAKTLASKVQVTVPTDTRIVSISVKDKQPEEASRIANSLREVAVEKIVAVTRVSDVT
TLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELFDTRVKRPEDIEDVLQIPLLGLVPDLDKMK
>gnl|bykdb|C3WFM8 [Bacteria] Adaptator of bacterial tyrosine kinase [Fusobacteria][Fusobacterium mortiferum ATCC 9817] (length=248 residues).
MSRKKKYEDYDEEFENDEDEIDLADLIFTLIRRWKLIVLTAIPVVILGVIFAITRPTVYQAETTLIVSNNMSSVSLDSSD
ISLSQRLVITYSEIAKNKSILNKVINKYDLKETTEQLAKLVTITPVDSTELISLTYKNSDPQLAAMVTNEIANEFMDKVV
QVMRVRNVNIVEKAQVPVQPLPKKRALILLASVVLGLAAGTGMAFVMEFLHKKLRKPSEIQAILGVSMIGMIPDLENVIA
EKDEDSNE
>gnl|bykdb|E3H7M4 [Bacteria] Adaptator of bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=252 residues).
MQDNNKKEREKNEIRKEIDMVELFMIVKQNWKVLFRTIFIMVALGFTYSYYKADTYKAEVILMVSGSNLISPDRLENSQV
SLNQKLVSTYTEIAQSSSIMRDVVQKLDLKNSPESLARKVEVAPVGMTELIKISYEDENPQKAALIVNHVSEEFMIKIKS
VMRFDNLKIIESSRVPVNPESKKTKLIIAISMIIGILLGIFEVMWGEYYQNKIKNPEDIERLLDCQVLANVPDYSTVKLD
KKSNELKKVKKR
>gnl|bykdb|E3HB17 [Bacteria] Adaptator of bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=247 residues).
MFKKSRYEEDINTHWMEEDDEIELMDLLFILIRRWKMIIAIAVPVIIIGLTYAVLKPAMYKAETTLMVSSGQIYSVEKLD
SSEISKNQKLVSSYTEVARSKSIMKNVIKRLGLEAEPEEIAKLVKVTPVDETEFIKISYTDINARKATLMVNEVSKEFML
KIRDLMNFENLKIVEKAEIPTKPESRKRVLIVAISGVLGIMLGVFGAFLVEFLHSNIRKPEDLQNIMGCKIIANVPDFEK
IEAEVKR
>gnl|bykdb|E6PYQ4 [unclassified sequences] Adaptator of bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=517 residues).
MTKFPSSNTNQFADNPIRVADVARLIRKYGIYVLGSTMLGAILFAMWAHFQPSLYDATAMIHLDQHSSISLGPSGATGDE
YGLKIQTQIIGLRNPDVAISTMKKLKLSQNPIFNPSLQQDLDNPASRDRLVNVFLGSLKIARVPQTELISVTFRSRNPVL
SAIVVNTLVDEYFEESFEQRYKSTQDISRYLTTRLESLESKIQNEQNELMTSGLKLGIIDIGSGSSSTSGTSSIGTSTLV
VETSGLLDQRVKAQADLYLAEAEYQNLLVHPDAVPPIDVPGSLEMSSLVTSLSTANGQLASIEQRYGSNYPGLGQVQAQV
KSYEHDIADLHAKLLQSAKQNVDRAQSVVDSLNNRINSLKQQSEGATPEIVHYEVLKSQYMSDQTLYNVLLSTLGTGEIQ
AGMQTQVLNRFVTADVPGTRAFPRVGLTGIAGGAGGMVVSLLIISILVFSSDTVETIEQIEESLPVPILASVPEYRDELA
SRSSGEKWNCIDNTAGSTFGQRRSISSASNFDFADAC
>gnl|bykdb|A1ARV9 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pelobacter propionicus] (length=499 residues).
MSDSEFDYKKYLELIVRKKELFVKLALLIMTIAIVTSYVLPKKYEASSTVFIEKNVISELVKGITVTPSMEDTIKVLTYA
ITSRTLLSKAAENLDMNVTRKGGADMEALYLTLQKNTVVKVKDKNLFTISYTDKNPQMARDFVNTLVRLYIEENTSSKRG
ESYDATKFLGEQIDTFREKLEKAEKELNDYKRDKGGVIAVDEAKLFEEINVSQQKLYDLELRRRQLEGMRRVTRKSGDPL
QARLSALQRRLDELRVQYTDSYPEVLQIKGDMETIRAQLKTRGTTFQPLDPQELEKIDSEVAAIRASESSLRRYISTNQS
LLRSLPSAKADLERLETAKNNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPQKPVSPNRLRIMLLGFIGGL
AGSFGLLFLLDQMDGTVKDVDFLKQFGVPVLAVISRIRIQRDIELQRRRTKRLCLYAGAYFLFLLCFPLSELIGLTFMDT
LVDALRPANLVQNVKDQVR
>gnl|bykdb|A3K8W6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Sagittula stellata E-37] (length=442 residues).
MSQFQSVGEVFAALRRRAWVILGIFLVGCVISVDYALMQQKVYEATAVVQIEDARVTSTATGTAADANEASRRLQLIEQR
LMSRDNLVSLMDKYDLFAEDPALNDGERIYMMRQAARITPITRPGPTFSAAAQAPSGLMISVMLPDPEKAAVVANDLMTK
VIAESRDRSAEQASETLAFYQTEEARVDAEIVALEDRIADYKKANSAQLPAGVAALRTELTTLRETELDLSQEIITIQGD
TARKRPEDLARQVAQLEDQRALVAARATEIEGQIASAPEVERQLGQLEREMDRLKDQYSVITRGKAEAEMGQALQDRQAA
GRYEVLETALVPDDPVTSSRKKIAGMGAVASLIAGLIVALVFEIMNPAIRTQKQMERVLGIQPVVVIPVISTRRDRTWGG
LKFLAKALGIVALVGGVAAWLTKISGLGALFGGGAPRRAVRG
>gnl|bykdb|A3W0H6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Roseovarius sp. 217] (length=432 residues).
MSAIQSFPDLIRLLHRKLWLIVLVAVVGAILSIIVALNQPKVFQATAVIQIETPQVGSDLAGQTIATDANQRLQLIEQRL
MARDNLVKVIERHGLFANARDMPMAEKVHQLRISARITPITVGVPGMGPATTPSGLSVTVNLNDPVKAAEVANDFVETVI
AENRERRMALVRETFDFFSAEETRVSARIAEVEGVIADFKRANAESLPTSITPVREELRTLNETLLALDQQIITLETEAS
RQRQEVFARQIGQLTEQRALVAGRIAENEAALAAAPRVERELGALTRNLTQLQDQLSTITTSRVEAEMASVLESRQQQER
FEILETAIPPEFPVSASRKKLVIAGAVASLVAGIGFAVLLEIMNPAIRSAAQLEQELEITPVVTIPIVRLRHERRRRALK
IAGTVVMILLIVPILVRFAQERLMPLRMLSGN
>gnl|bykdb|A5G425 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter uraniireducens] (length=507 residues).
MSTTNELDYKKYLMLIDKKKKLFIITALAIMTVITIVSYFLPRKYEAKSTVFIEKSVISDLVKGIAITPSMDEKIKVLNY
AITSRTLLLKVIDDLDLNVNKQNDAQLEELVAKFQKNTVIKLKNDENFFIISFTNENPRLARDYVNTLVRRYIEENVSSK
REESYGATKFLSEQIEVYKEKMDKAEAEVNNFKIGKMGVIATDPATLQKEINDAQQKIDDMRLKRAQLESLRIQIKKNNP
LQQKMLSLQKKLDEMLVEYTESYPEVIRVKTELQAVKEQLRNRNTGFDMSPAETPDLDRVEAELKALKAAEANQYVIISS
TRSLLHNIPVAKATLEQLERDKNNQKNLYEQLVTRHGQSEVSKQMEVQDKATTFRIVDPAIMPINPVSPNRVNIILMGIG
AGLVIAFCLLMLLDYLDQSVKNVDALKSFGLPILAIIPKMQNPVELLLQKKKNVKLYVIASVYFSLILTVLLLEVLNSSL
SNTFIDSIEIKQYLPDLMSQIKYHGGN
>gnl|bykdb|B5EA80 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter bemidjiensis] (length=499 residues).
MQSPETEYKKYLQLLISNKERFVVIALLLMTVAFVVSFVLPRKYEASSTVFIEKNVISELVKGITVTPSMEDTINVLTYE
ITSRTLLTKVMDSLDLNLGKSDSETEELIKQLQLSTKVKVKDKNLFTISFTHTNPRIARDYVNTLVRLYIEGNISSKRGE
SYDATKFLSEQIDTFNAKLQKVESEVNAYKRDKGGVIAIDEGKLFQEINVAQQKLYDLELRRHQLEGMRQITRRTGDPLQ
SRLAGLQKRLDELLVEYTDSFPEVVKVKGDIETVKAQISERRGQPSQPLDPGELAKIESEISAIKITESGLRRYIDTNRA
LLQTIPSAKAGLEKLELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRVVDPALLPVKPSSPDRLKLMLLGMVGGV
AGSFALLFLVDHLNITVKEVEFVKGLGVPVLAVIPRLQDPEVEAKRRRRSRLILGCALVYFLVLMVFPGMELLGLPYMDK
VLDLLSGPEARLRIKGLLQ
>gnl|bykdb|B9M2X7 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter daltonii] (length=500 residues).
MPTTNDFDYKRYLNLVKQRKTLFLVTALAVMTITVIVSYVLPEKYEAKCTVFIEKALINELVRGFAVTPSMEDKIKGLNY
AMASRPLLQKVVSDLDLNLGKNGDTDTLISQFQKDTKVELRDKENLFTISYTGENPKRARDYVNTLVRRYIEENSSSIRA
ESYGASKFLSEQITVLKEKMDKAEAEVSRFRMEKGSVATADPAALEREISGAQQRIDEIAFRKAQLEASRNQLKKHNPAQ
MRLQTLEKKLEEMRVEYTDRYPEVMRLKSEIESVREQALASSGQARLGGAEMQELERIDAELRVLRSAESKQYANIASSR
AMLRNIPAARAELEQLERDKANQKQVYDQLVTRHGQSEFSKQMEVEDKGTTFRIVDPAVLPVKPISPNRIAIILGGIAGG
LAVAFGLVLLLDYYDESVKSLDGLKALGLPVLAVIPKMQIPAEIKLQKAHDVRLYAISACYFSLILIVLLLELLQIPLFS
SSLNSLQLKQYLSQAVGQFK
>gnl|bykdb|C0QCJ1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfobacterium autotrophicum] (length=548 residues).
MQQIQQNQLPITPAQIIDILIRRRWIIVIPLCITLTVGLYLALTSPRTYMAETSILVQAQTVPGNYVKSIVSSGISSRIS
TISQQIMSMSNLEKIIDQFGLFEEEGAKDMYLEDKIEAMRKRIKVTLSSARSGADAFTISYKGSDPDKVMRITNTLTSFF
MDENLKLREAQAIGTSEFLDAELEKTRKKLVDREEQLSSYRAKNMGGLPDELDSNLRTLDRLQLQLTDKQAMLRDAKNAI
NTLSAQIAQASKMGSQGMDDQFDFSDFGEEVGMGGEDEATLAEAEKRLDAMLLRYTRQHPDVRRLEAVIEKLRAKIEAAQ
AQEAAETLEPLETENLDVVEPGMNFAVMQQKTQLAQMNREIQALNAEIKSIQEKMVVYQKRVEDTPKKEQDLLSLKRDYA
NIQSVFNSLLDRKLEAELSVNMEKKQKGEQFRILDHARIPEKPISPDVRKMLVFSLAAGLGVAGGIIFLLEVLDFSIRRD
EDIEKLGLLVLASIPPLKNPGDRLKKRLEMIFLSLAATYALVMLAAFIVLNDKGLDRVVNFIKSFING
>gnl|bykdb|C6DZX6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=499 residues).
MQSPETEYKKYLQLLFSNKERFVVIALLLMTVAFVVSFVLPRKYQATSTVFIEKNVISELVKGITVTPSMEDTINVLTYE
ITSRTLLAKVVDNLDLDLGKNDSETEELIKQLQLNTKVKVKDKNLFTISFTHTNPSIARDYVNTLVRLYIEGNISSKRGE
SYDATKFLSEQIDTFNEKLQKAENEVNAYKRDKGGIIAIDEGKLFEEINIAQQKLYDLELRRRQLEGMRQITKRTGDPLQ
NRLAGLQKRLDELLVEYTENFPEVVKVKGDIETVKAQLSARRGQQSQSLDPAELAKIESEISAIKITESGLRRYIDTNRS
LLQTIPSAKAGLEKLELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPVKPSSPDRLKLMLLGMVGGV
AGSFALLFLIDQMNNTVKEVEFVKGLGVPVLAVIPRLQDPEVEAKRRRRSRLILGGALMYFLVLMVFPGMELLGLPYMDK
VLDLLSGPEARLRIKGLLQ
>gnl|bykdb|C7LPS4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium baculatum] (length=489 residues).
MNHELYQQFERYARILLQRKRVVVVVALLVMTLGVITSYVLPRKYEAQSTVFIEQSVISELVKGIATTPSMEAKIKVLTV
AMLSRETLFKVMRILDKDVEFASDMDREAYIKDLRERISIRLDEKRGIFFISFQDSDPRYARDFVNTITQVYIESNTASK
RDESLEATRFLSEQIESFKKRLDAVEDEINQYRAEHGLQLATDETTIRFEIADAERKLEAIRARKLELETKLQLMPSGGG
RSAHLADMERQLATLLTAYTDQHPKVVRLQGQIRAVKSSPSGGMTGNSGAAAKTLVQAEIEAATLQEKAQLATIEEKTEL
LRRIPTLRTGLNELLRKKDNETLIYSQLVTRYGQSEVSKQMEMENKSMNFRVVDPAVMPDTTVSPKRVPIMLLSALAGIG
IGMAVIMVPYLMRGSVESLADLRSLNQRVLAVLPAISKPKEERQRVRGDRIFMSGAALYFLMLVTIGVMEALGNSPLDVL
FERALGPWL
>gnl|bykdb|D0D9W1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Citreicella sp. SE45] (length=441 residues).
MNQFQSVGELWAALRRRAALIALVALIGCAISLWVAFNQTKVYETTAVVQIEEGQVPDSLAGPSAQGQDASRRVRLIEQR
LMSRDNLLRFMEEHQLFTADPTMTLNERVFQMRKAVQIEEIRAAGNSYQPMRDAPSGLLITVTLDDPQKAADLANELMET
VIRQSRDRSVDRARDTLAFFEEEAARVEASIEAQELRIAGFKQDNAAALPNGLTALREQLTTLQDNELELDREIVAMEGS
PTRQREEVQARQVALLKEQKVLVQNRIAQIEETIRNAPEVERALSGLERELTQLQEQYNVITRRKADAEMGQMLEDRQQM
ERFEVLETALVPEVPASSSRKNLAAMGAVASLIAGLVAGFVAELANPAIRSAAQMERALGIQPVVAIPPIRTSRDRRGKG
LRRLGLFALLAAALWAGLHFFGSLVPWQGLFGKWLPRAAQG
>gnl|bykdb|E7T802 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Shigella flexneri CDC 796-83] (length=186 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLHDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKMALR
>gnl|bykdb|E8WSZ4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=496 residues).
MQESEYKKYTQLIARRKEFFVVAALLIMTLVFLVSYLLPRKYESSSTVFIEKNVISELVKGLAVTPSMDDTISVLTYAIT
SRTLLNKVVESLDMNLGKDGNEELIRDLQKNLTVKVKEKNNLFTISFVHTDPRIARDLVNTLVRLYVEQSTSSKRGESYD
ATKFLSEQIQAFNRKLQSAEAEVNAYKRSKGGVISIDEGKLFEEINTAQQKLYDLELRRRQLEGMRLVTRKANDPLQAKL
ASLQKRLDDLRVQYTDSYPEVLTVKGDIETVKEQMKLRKGAASQPLDPQELARIDSEIAALRITEDGLRRHVATNRQLLQ
SIPDAKAGLAKLEVERENQKKIYDELYSRHGQSEVSKQMEVQDKSTTFRIVDPAMLPTRPASPNRLLIMLLGIFGGAAGS
LFLLVLRDQMDTTAKEVDFVKSLGGPVLAVVPRMQIPEEVARLHRKSLGVFALSAFYFLLLLVFPTMELMGLPYMDQVLD
RVSSSGITQGVKGILH
>gnl|bykdb|E9TE87 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Escherichia coli MS 117-3] (length=520 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGIQPIWRLKPSAVCVPVCTSR
>gnl|bykdb|F0G6H6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. TJI49] (length=433 residues).
MSHLTMPESRGGPTARPPHPFRRYWGMLYGGRRTIVASALICVAAGALYALCARPVYRSDVLFQVEQSPTDTKPASPTGD
PSSMFDLKTDAATEIEVLKSRAVMARAVDTTKLYIEARPRYVPLIGWRLVNGADGLSSPLPGGYVYGTERIDVAAFDVPK
RLYDKSFALTVGRGGAYTLQRTGLFGRKGPVWQGRIGEPLHAETPDGNIDLLVRGIDGEPGARFDLTRHGEAETTAWLQK
NVLISERGKQSNIIGATLDGSDAAHISSILNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAEGRFNAYRAS
HGSVNTSDEALALRQQSVDIETRILTLQQQRQELLTRFMNKHPAVVAVDAQLADAQRSLAAVREQIQKLPAVEQGVLQLQ
RDVTVDTALYTNLLNARQQMMLARASKTGTVRI
>gnl|bykdb|F0JCB9 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio desulfuricans ND132] (length=505 residues).
MTDNKLETPGAEASFDVMHYVQLVGNHRGLFVFIVLLAMFIAIVTSYVLPKKYEAKSIVFIEQNVISDLVKGIAVTPSMD
TKIKAIKVTMLSRNMLSKVINALDLDVDLKNEISLDSTIKSLRGRIKIGLDEKRGVFDIRFADTDPVLARDVVNTLTRVY
IEDSVSNKRKESYEATRFLADQIEVFKKRIDEAKKEIEDYKVASGKVLTTNEYAVRREIEKGEDQIKDIDIRISTLESSR
TMLLSNSPSRSRLRQQEQLLDDMLARYTENHPRVRQLENAIAETKRQIAHNSEEELSLIYSSPEYQHLKVQIRALNTQKA
NIEEEMASNKALLDQIPRAQAELQELKRKEKNEVIIYEKLVSRYGQSEVSKEMELQDKAVSFRVLDPAVIPTIPSSPNRP
LIMLAGMAIGVAFGLGVIFLMDLIDPSIKNVDDLREFGIPVLAVIPKLKNVEEERKTSRRNLRIYVIVAVGLMIFLAFLG
SEFLGLGLVDKLIAKGALVVQQWRM
>gnl|bykdb|F3CAY8 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea str. race 4] (length=88 residues).
MTVMNRPSLDFHQDSRIDLAAVLRMLFDHKALILWTVSLFFLIGLGYAILATPVYQATAMIQIEPRKIGIEGTPEVRRQA
IVSVAGDH
>gnl|bykdb|F4SM98 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Escherichia coli H736] (length=177 residues).
MPLIKNKKLDKDADEIDLGRIIGELIDHRKLIIAVTALFTFISLLYALFATPIYQADALLQVEQKQGNAILNSLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQAIAEKNYFPIFGRGWARLIGHKPENLTITRLYLPSSDKELPELNLTVKDKLH
YTVEYNGKKLTELLVFY
>gnl|bykdb|G5LQM7 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Alachua str. R6-377] (length=204 residues).
MTEKVKQSAAATGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNERVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKK
>gnl|bykdb|G5Q4J1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Montevideo str. S5-403] (length=211 residues).
MTEKVKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNERVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMQVEAIDARPDTEFTVSKPVLIQNLR
>gnl|bykdb|G5SDT9 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580] (length=214 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSTVSKFSTLGILR
>gnl|bykdb|G7EJX5 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. BSi20652] (length=118 residues).
MNQTNQNLKSDDEVIELGIYINVIKRAKWRILSFAIVVTLLAIMVTLTLVPKYTATATLLIEAEQTKAVSFEEVYGLDSN
KKEYYLTQFEVMKSDSIAREVITKLNLKTTPILLQSPQ
>gnl|bykdb|G7QCG0 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. FW1012B] (length=500 residues).
MSAFLKEFHHYKQLIYLYKELFLAVSLLIMTGAIAVGYLSPKKYEAKSTIFIEQNVITDLVKGIAISPSMQQKIQNLAVS
LTSRNLLLPVIKQLDKDITLKTAYDQEVYIKDLQRRIMVNLNERQGLIVLNFSDKDPRFARDFINTMARVYIERNTSTKR
EESTEATKFLAEQIETFKKRVDAADEAINAFRSERGMLLSSDGAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLASGKGP
AKASRASSGGNPREAELRRLLAVYTEKNPKVIKARAAAKAWRPSGGGGGESAGEGVAEGTRNAQILQYQLDSIKAMEDYQ
NKIIGENKGALRDLPRVKATLAELVNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPEVPVSPNRPVI
ILIGIVLGLGAGAGATYLADRFNHSIRSLHELRTLGLPVFAVIPRISSEKEIRRQARRDHLVMAVAGGYFALVVGVLVLE
TLRAQGVGTAWLQKIAHSIL
>gnl|bykdb|G8AU95 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense Sp245] (length=387 residues).
MNSSIGKGGTLPGHEAHASVLPDSLLQSGAAESSDVRSRQEATVFATLAVLWRRKLLLLTIILLGTATITYVMQSLKPMY
RATAMVQLDSRRVELAEFKSVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLGLLNDPEFNPSLKAPDGTDDHWLKRVTK
AGVGALPPEGNDVLRQIVQQATALFRADDGPVARDPNQARLLTIDTLLRRIEARNDDRSFTIIIEASSVDPAKAAAIANA
FGQAYLDYRTEMNRDMTERVNQWLGGRLIEAREAVRGAEEAIRSFRKENSLLELPPDGRNMVQQQMNELATQLTAAQAQK
AAAEARVRQARDQTAANNAAAIPEVLASPLIQKLREAEAMLERRLAELQQGLWRQASGHRESSPRRR
>gnl|bykdb|H8YYB8 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Thiorhodovibrio sp. 970] (length=592 residues).
MEEQLLSLDDYIAILKRRKWQLIIPAVLLSIVGMITAVVLPPTYRSTATILIEQQEIPDELVRSTVTSYAAQRVQTISQR
VMTTENLGKIIESYQLYPELMQRYGLVSAVEQMREDIELEMISADVIDPRSGRPSEATIAFSLSFESESPTVAQRVANDI
TSLFLSENLKDRQESAKETTAFLQKELAKLTDKLSLLEARLAQFKEEHGQSLPELKSLNMQLIQRSEDQLRDTEQSIRTL
VERKIYLEGQLAQIDPYSELFSADGRRVLGPADRLKALEAEYATVAARYSSQHPERMRIEREIATLRQQVGQSANARAEL
ERSLKEQQEELAGLRERYSTEHPDVKAQTGAIAITQRQLAQARQGGSANSPGVIDADNPAYIQLQAQLQAAVVELASLQE
SREEIRSKLADLEERIAKGPRIELEYQALTRDHENAMSSYSEVKQRLVAAELGEAMEAERKGERFSLIEPPRLPEQPAKP
NRLAIAFLGLVLAFGGGVGNLALQEALDKSVHNARDVELITMGPPLAVIPFIETEADVHRRTRRRLIAVLGSILGVVLAT
AAVHQFVMPLDVLWIKVLDRAGLLHTETPNPS
>gnl|bykdb|I1AYC4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Citreicella sp. 357] (length=438 residues).
MNQFQSVGEVLAALRRRVLLMIAVILLGSALSLYIATQQVKTYETTAVVQIEESQVPDTLAGSAAQSQDAARRVQLIEQR
LMSRDNLVRIMQEHQLFSDDPDMSLNERVFHMREAVRIDEIRSNPDAYAATQEAPSGLLISVTLGDPQKAADLANELMNT
VIEQSRDRSVSRARETLDFFESEEARVEAEIQAKEAEVARFKQDNGDALPAGLGSLRDQLTTLRDNALTLDREIVALEAN
SSRQREEVLGRQIGLLREQKTLVENRIIAINETIQRAPEVERALSGLERELTRLQEQYNVITRRKAEAEMGQMLQDRQHM
ARFEVLETALVPEFAASGSRKKVLAMGVVASVIAGLAATFIAELMNPAIRSAAQMERALGVQPVVSIPTIRTRGERRITG
MRLFSLLGLLFAAMWAALSSVTDWSALLGRFLPRAVRP
>gnl|bykdb|I2Q342 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. U5L] (length=507 residues).
MSAFLKEFHHYKRLIYLYKELFLAVSLLIMTGAIAVAYLSPKKYEAKSTIFIEQNVITDLVKGIAISPSMQQKIQNLAVS
LTSRNLLLPVIKQLDRDITLKTAYDQEVYIKDLQRRIMVNLNERQGLIVLNFSDKDPRFARDFINTMARVYIERNTSTKR
EESTEATKFLADQIETFKKRVDTADEAINAFRSERGMILSSDGAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLVSGKGP
ARGPAKAGRASSGGNPREAELRRLLALYTEKNPKVIKARAALRAWRPSGGGGGGGGESAGEGVAEGTRTVQILQYQLDSI
KAMEDYQTKVIGENKGALRELPRVKATLAELVNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPEVPV
SPNRPVIILIGIVLGLGAGAGATYLAERFNHSIRSLNELRTLGLPVFAVIPRISSEKEVRRQARRDHFVMAVAGGYFALV
VGVLVLETLRAQGVGTAWLQKIAHSIL
>gnl|bykdb|I5B297 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfobacter postgatei 2ac9] (length=542 residues).
MADPFQSQTQIKPDYIIDVLIRGRWFLIVPLCISLTLGLGMTLTANKTYEAGTMILVQPQRVPINYIKSVVSSSIGERIS
TISQQVLSRSNLEQIIEQFGLYENSSGMYQEEKIEALRKRIKVKIEHSRGGSEAFSISFTGSEPQRVMRIANTLASYFMD
ENLKVREAQAIGTSEFLDSELEKTKKRLEEKEQKLAAFRAKYLGGLPDELESNLRTLDRMQKQVTDKAMLLREVNNSISQ
LDSQISSMAATGGSGSGGDDFLSFDFDDSQEGDDSALQAAQEKYDALLLRYTEKHPDVKKLKRIIEKLKQNLEAAKEEEE
LPSAESEEDILPDMGMDPVAPLKAQRAQLVAEANNIQAEVSAIQEKMKIYAQRVEDTPKRELELQSLTRDYSNIQNVYNS
ILDRKLEAELSVNMEKKQKGEQFRILDHARLPEKPISPNVKLMFLLSIAGGLGLGGGILFLKELLTFSVIRRDDQIDTLL
GLPILASIPPLEKPNGRTKKKIEWAMFICCCSYSAVFLAFFAILNHKGLDRTMNFIKTTLNL
>gnl|bykdb|Q0FMP1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pelagibaca bermudensis] (length=441 residues).
MNQFQSIGEVLSALKRRALLILLVTVLGSAASVWLALNQIKVYEATAVVQIEEGQMPDSLAGASAQNQDGSRRVRLIEQR
LMSRDNLLALMEEHGLFDGDTGMSVGQRLFRMREAVSIQEIRTNSNSFAAQQEMPSGLRISVVLPDPQKAADVANEMMYQ
VINQSRDRSLSSARDTLAFFESEEARVETEIEAMEAKIATFKRENAEALPSGTGALRSQLTTLEDSQLALARDIVEMEGN
STRQREEVLARQLGLMREQQSLIEQRISEIEETLLQAPEVERELSALERDLERLKDQYSVITRRKADAEMGQMLEDRQQT
DRFEVLETALVPEFSASSGRKKIVLAGVVASVLAGVVIAFVAELLNPAIRSAAQMERVLGLQPVVSIPVVEARRDRRSRQ
LRSVTAVGLLAALMLGLYRLFTDILPWQGLLDRFLPRMARS
>gnl|bykdb|Q314L4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio alaskensis] (length=502 residues).
MNTMLDDVEAGGGLDILRYIRLLWEHALAFWLMAAVVMLAALGFAYSLPKIYQAKSTVAIEQNVINDLVRGIAITPSMGA
KIRILNVSLLSRSSLLSVMKELDMDLGLSGPALEERITSVRRKVSVGLDEKRGLFFISYESSNPVLARDFVNTLTRHYIE
QSTSDKREESFEATRFLADQIEVFRKRIEAVQAEIDSFKASRGQILNMSEPALRREIQMAQEELQALRIRKTDLLAQRGV
MLRNTPLRNRLETLEAQLAAMLVSYTEKHPAVIRTKQEIEGLRREVARKGEEERKIIYGTSEYQRIKVELTAVEQQEAQL
VSKIADNERLLREIPSVATELADLENRKRKESLIYEQLVGRYGQSEVSKQMELQDKAVSFRIIDPAVLPSVPVSPKRWLI
LLAGMAAGLGGAFGVLFLFDLLNPRVRSVEDLRRLGFHVMAVVPSISDVAEERRIFRRRAAVTACGVLLCGGVVAVAAAE
FLQLRFMENFIAGAVFTVKSWF
>gnl|bykdb|Q39U16 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter metallireducens] (length=518 residues).
MVSKTEELNKYLKMLMKRRYLFIVVSLVVMSVIAWGSFFLPKKYEASSTVFIEKSVIKDLVKGITFTPSVEDKVRILRYA
MLSRTFVTNVLKSLDADTKVKNDKEMEGLVEDFQKRTQISIKGNDLFIVSIRDKDPKLATDYVNTLVRKYVEENVSSKRQ
DSFGADRFISEQLKTFKDKLDESENKIVAFRQKRGVSVGIDEALLVNDIRQYQGELDSMRIKRNELTATRDALRRQLKSI
KPTTVALSSRENSSEVEMLERRLKQLSANYTDNYPEVIRIKSIIASLKKKQEPGHQADTGAKEEFSTANPVYQNLEQQLY
QVEAELEAVNAKQRQLHATIGGKEHELRNVPADQKTLTDLIKERDANRQLYEQLLTRQGQAQLTKEMEVEDKATTFRVVD
PAIVPMKPVSPDRVKMIIMGIIMGFVAGAASVFVMEMFDSSVKDVTSLKKLGFEVLAVIPTIFNQEEASKVAKKDRKIYL
VAGCYFALICLMLTHELLGLTLIEKVLTKLGLDQFIMS
>gnl|bykdb|Q74BQ7 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter sulfurreducens] (length=490 residues).
MQQSEFDYRHYLTLIVARKRLFVVVALAVMAAAVVYSYVLPKKYEARSTVFIEKNVISELVKGIAVTPSMEQAIKGLSEA
ITSRTLVTKVINDLDLDVTTKSNAEIEARVRAIQQNITIKLKGDNIFTISYVDKDPRVARDFVNTLVRRYVEENISSKRE
ESYGAIKFLSEQIDTFRGKLEEAEGELNRYKTEKGGVIAIDEAKLFEEINVAQQKLYDIQLRRRHLEGLRPVTRKAGDPL
QVKLVALQKQLEELRVSYTDSYPEVLRVRGEIETLKEQMKNRSPQQETVVDPQEYEKAEAELQALKVSEDGLKRYIATNQ
ALLRNIPSAKAGLEKLELEKKNRKDLYDQLMARHGQSEVSKQMEVQDKTTTFRIVDPAVTPSSPISPNRVKIMLMGIVAG
LGCALGLIVLLDRLNNSVHSVDALKETRIPVLAVIPKIRTIEAVARERSENIRVFAAAGACFMVILAFLVMELLNISPVD
RIISRLHGML
>gnl|bykdb|S9QRP2 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salipiger mucosus DSM 16094] (length=442 residues).
MTQFQSIESVFAALRRRAWIIILVTVVGCALSVWVALNQDKAYEATAVVQIEEARVPERLTGGAAQNADAARRVRLIEQR
LMSRDNLMRIMEEHDLFTDAPEMTMNERVYQMRMAARIEEIRSNSGSFQASQEVPSGLTITVRLGDPQKAADVANELMTT
VIEQSRSRSASSARDTLEFFEKEEARIGAEISEQESRLADFKRANAEALPGGITSLRSQLVTLEENELELDREIVALRTN
SARQREDVLDRQVALLQEQKALIAQRSETIRDTLRRAPDVERELNEMERQLGSLQEQYSVITRRKAEAEMGSMLEDREQT
DRFEVLETALVPEVPASQSRRKLAMAGGVASLLAGLGIAFLAELMNPAIRSAAQMERSLGIQPVIAVPVIRSRGHHRRRG
LGLLALVALLAGAVWAGLRFVGDLGPLQGLLERILPRSVQSS
© 1998-2019