BYKdb

Dataset for cluster tadcd of phylum all

[Download (right click)] [Alignment] [Repertoires]

11608 sequence(s)

>gnl|bykdb|A0A2S8SNV1 [Bacteria] Bacterial tyrosine kinase [Abditibacteriota][Abditibacterium utsteinense] (length=753 residues).
MNQQPDIPANGAPPLSPGSSRAISAFPEERVSASLPDNSAVYAHDADEESFDWQRLLGIVRRRRKIIGFTLAGVLSLAGI
YLVLSPKIYKASADLLINTEQKSSSQGLGSLPAITDLLGATGTRSQDTEVEILRSAVVQDAATALVPNAMRPAVKKNIRV
DIQPKRSTDIITVNVQSRDPKLAITYSNAICEAYRLQNQQNNSAQYRETADYVGGQLAMVRKKLDQKRDELRKFKEGSGI
VDLPTESQARVARLNELQTAFQGAEADRTAGEAQLKTLRAQAAQMAPAEIAPSTIVVRPVVQQLKQQLTTLETQRAATSQ
EFMPGAIEVKTLDDQITALRRRLQTEASTEVGTYTRNINPVRQAVMQSISSTLAGVWSAQARAEALRANIVRAQQTVQQL
PQREYRLSQLQGDLATYQQTFQSLSDKYQTLLISQKTPIANARVITPADEALKVSPRVASTLVLAVVGGLLLAMVIAVAV
DGLDNKIYTEEDAVQATGLPVLTHVPMLGAQSGQQLLIDKADSSILLESFRMLRTQLSFISSYGHLKTLVLTSSQPGEGK
STVSANLAIALALNGKRVVLVDADLRRPRVHTLFGIEKTKGFTSVVANVCSLEEALHQTETEGLQVLPSGPTPPNPSELL
DSRAAREIIEQLKATADYVIIDAPPALMLADAQIISSVADGVLLVVSCQEAKRGAVERTCELMGQTGVKIVGMVLNKFTD
EQGGYYGYYGYKYGGYSAYLEDKALSKHDNLPS
>gnl|bykdb|A0A2S8SSE1 [Bacteria] Bacterial tyrosine kinase [Abditibacteriota][Abditibacterium utsteinense] (length=795 residues).
MKGFYATTPNPQHWLITEFTLNKSSLPDPQNNQIHNGSSNGSTPHGSAPETSLSIVDGRKELEAASFSNSGSQAYSNSPL
YTSPEAEGFDFHRLMAVMLRRWPAMLGVFLSAMLIGLATAFFSKPIYEAQATVELTAIQRNGAMADIPGLEVFQNAGQSG
SIDTQIETLRGAPLHNRAMQTLKADTQQPLRSFAPVTVTQVGTTNLISVAVQSYNPDAATKLSNAICKQYIVASLEKNRS
NSSGAVKYVQNQLDLVHKRSVEAQTKLKKFKQENRIFSISDEASALGSKLAGLQQAVAAADSERAATQAKLKGLQTLLSR
LPANRVVPSGIQRNPVVAGLQAQLTQLELERSTALREYTPKSYKVVSIDSQIKALKDQLASEAKTMVSGWQPDPSRAPLA
SDAASTQTQMWSMDARNVALKQQVQQAREAMDQLPEQEFRYTQLATDTQVLQDAYQTLSQRLQSLKIGEQAKVADARLVF
AADVPTAPIAPNKKKLILYATVLGLLGAVAMALVLDMLDNRIYSDEEAQRITGLPVLSHVPFARHQEEISLMPAPGKQAS
KTSPLLESFRMLRANIAFSAVDKPIRALVVTSSVPHEGKSNSAFNLAAAAAIDGERVILVDLDLRRPTAHSICGLPNKLG
FSSVATNRCTLEEALQDTSIPGLRVLTAGPVPPNSFKLLNTQNARTIVNQLAEQADFVVIDTPPMLGMADARLIASWVDG
TLLVVSCRDVARREVARAADLLMQGGTEVFGLVLTKITTGNNGSYGYNYYGYRQYGEYLDIAETPNELEEKTLKS
>gnl|bykdb|A0A0B6WWQ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Pyrinomonas methylaliphatogenes] (length=789 residues).
MMKGDPEKEPQSLIRLDASAPYPKLYADYDHRWEREERTQQIVAGYWRAVRRYLWLVIGLVALAAAATAIYMARQPDLYL
ARARVEIGSEEDSALSLSPTGGPVVINRSSDPTYFSTQLQILTGSQLLRRVVRTLDLEHNPEFLRPRAVRDLSPWLNLRR
MLMLGTGQEKSAGQRGTRGQMPLPSEIAPATESQDDFDVAMRLDPYVRTIASSLKVDPVKEVRLPVKETRLIDISFRHPD
PYVAATVVNTIAETYKLSNLEKRTSARATTSQFLQRRIAELQAQIRAGEAQLLAYSKSHQILSLDPSQNTVVERLAGLNR
QLLDAENERKLAEAAYLASLEPGAAEAMVEKEDGISVAALNKLTELRQRRAQLLVEATEEMPEVKEVNEQIAELERQINE
ARARAKDVMLTNLRTRYRQALAREEALRQAFDEQRGETLTQNEAAINYRIIQQEIETNKSLLDNLLQRAKENGMAMAGVA
NNIHIVEYAFPPNRPIGPARLQAVGLAIVLGLAVGIGLAIFLDYLDDSLQSAEEVERELHLPALAAIPTVSSRRSLSKAV
ALQTDGTAHPELLVGDGGESGLAETYRQLRTSVLLSTPGHAPKTLLVASSAEAEGKSTVAVNVALILAQTGAQVLLIDAD
MRRPKLHELFGLKNERGLSTLLSSEIRNGDAFKCIHDSARGVQVLTSGPLAPHPAELLGSDQMRALLEELRARFDYIIVD
SPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKILHDVGARIFGVVFNHAGMPSDAAYYRYNR
>gnl|bykdb|A0A0B6WXT1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Pyrinomonas methylaliphatogenes] (length=786 residues).
MQDNRLLPLSQTEQQLDRPLHDLTLGQPATFIEQAHLREYWAIVYKRRWLILSLALAVTSLVAIYMYRQPNVYEAMVTID
IEPRRSVLQTKGDVQVVSVPNDPNYWSTQIKLLQNPQLARQVALTLDLPNNPAFLSGQAGPSLTSSLRRILSRRKKEENE
QGKLQVVTDSEVDAENLTPEQLAKLEPYEEAILAGITVEPVEKTNLVNIKFQHSDPEMAAKVANTIADVFIYNNLERETQ
GAQRASVLLAKQIAELQLKIRQGEEARINYLRSHNLPLGQAKGQNLTLERLATLSGQLLEAENERKNLQSAYEAAQRETD
IWSVPEVQSDQRIQKLRDRIGELEEKRAALLVQYTPEWPEVKKVDEQIKRLKQDLDKAPYEVIKAMRSRYEAALARENKL
KQAYYQEAAAANEQNQAEIELSRITQELETNKQFYNTLFQRQKELEITSNDRANNITVATPARVPREPVGPKRLRNILIA
LLVALGAGIGLAFLLDYLDDTLKSAEDVERYLHLPTLALIPAPRTERLLLKGKASEPEGVAEKTALALISDVRSPITEAY
RHLRTQLLLSTAGQPPRTVLLTSSQPSEGKTTTAVNMAMMLAQMGAEVLLLDCDLRRPRVHVHFNLANAKGVANYLAGER
NLDALMQTYAPLPNLKIMTSGPVPPSPAELLSSEEMRRLIDEASARFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGG
HSSRAIVRRAKKLLQDVGAHIIGVVLNNVKLDAHDYQYYANYYAAYYDEEEDERDLPEGAAERGAH
>gnl|bykdb|A0A136JPP4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium OLB17] (length=847 residues).
MDQDQRLTPLPKGLELNQPAGDLTTSYAAYYDHESQSGKRTLRQYVRVVTKRLPMIGAIAVVVTAAAAFYSFRQPSIYSA
STEMLIEPRKAAPTAKDAININFGLDETTYYNTQLQLLQNPDLMKKAVVALGLQREPDLFGSSNRGFFASIKSLFVSPKS
PETPKGALPVLTGTENADPAAVQLSPEEAARAGQYAGILSGGLHVEQTERTSLFTLTINSTNPQIAANVANKVGEVFIEE
DAKRELETTQSAYDELTKSIADLKVTIADQENKLTEYMRSSNLPLQEKGSDLAASRLQTLSEQWLSAADDRRKLEARYNG
AVQASSRGEGRNIPDLYENKVYQDTVRLNTERKAKLQDQIREIEKQIKDAETEKAELLVKYTPEYVKVKQVEEKIASLKT
TKQQTETEVSQIIDRDQKKIEKDAVSGALVSLRSQVDAARRREDQLLNAYEVEAERANVQGQAATTLTTLKRALETNRGL
LDTYTQRQKEQELALASGKPNNIKISERAEAPTYPVGPNRARNIFIALLASLGAGIGLAFLLDYLDDSIRTSDDISRALG
LPTLAMIPHHGINEKKRRSRRGLGSETNAKAASNTALITLEERHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEG
KTMTAINTAITLAQADADVVLIDCDLRRPRMHSHFGLSNSQGLTNYLSGEKSTENLIKAAPGLPHLKIITSGPIPPNPAE
LLSSNEMRNLLQFLRGRFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQTRTRISALGARIYGVVLNGI
TSESVEYDYYGTGYYTYYKNRPDDTTPIMDDADVVGQYGNSADSFKP
>gnl|bykdb|A0A136KC10 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium OLB17] (length=810 residues).
MEMERPADPTIAATGRYPGYPQTGQAEGFQLIDYWRAIRKRLWLVAGIAVVMTTLATIYIARKPNVYRAKAVVQVDNEQV
NPDLVTNDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANPEFQALARTDSTSTFGRILRSVGLASGETQKSEQ
LAAIDPNSTLASADEIAEAVRLTPFVEVIRRSLSVDPVRESRATVKDTRLIEISFNSTDPALAAFVANAIAETFVNQNQE
KRTGTSRKTNDFLQERIASLQSDIRRDEEKLVEMTQNAGILKTSDDSTIVMDRLSGLNKSMLEAENARKNAEANYFEVAK
SPERLAAMAEAEMARFITEQQNNIRAFQSDTLKKISDLRQARALKLQEYQEGAPEIKEIDAQITSYQNSIDNAVQKFQGD
LEKYREATKKTLLYNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLALLKQTIDTNKGFLENLQKQVSSNDVAAQ
GSDNNISVTEPAVPSNIPVSPRRLATVLGALFLSTLFGMGLALFLEYLDDTVHSTEEVESLLHLPALAAIPTIQSMPKRR
LQLVGEGGETPEDRPGSELLIHADPRSSLAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKTTTATNTAISLAQTGAQ
VLIIDADMRRPRLHSVFGIGNADGLSTILANELSEAEILNLITQDPSSKLHLLPSGPIPPNPAELIGSEQMAKLLKTLEG
HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQLLNDIGAKILGVVLNNVNLRAQDNYYYYQSYYT
RDNYRSGDDA
>gnl|bykdb|A0A192WQ77 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium Mor1] (length=714 residues).
MVDTTKAAGSGNASPDQTAHFREYWRVIWNGRYTIAAVFVVVVALAAVKTFLATPVYRAVAVIEVQPKSSSITPGQDVSG
LGSAGYGWFAENKYHNTQVEIMRSHDIAERVVDTLGLRSDPFFEAAHNPVQTFRSMIRVDPRRETGLIEVSIEGKDPEQI
TAWVNEVARAYVERNLEVAQESVSFAVDQLTGQVKIMEQKLIEAEEARREAQSEAGISDLDGSLAIVRDRQSQYSKELTG
IEIELGKLDKSLTRLKELQDSGGDPMTLPELASDSELKELNRQRIRVERDIASADVSYRPGHPKYEEKVAELATVDRKIA
ARIDEVVSGLRSEYGLKRDQERYLRGQLRSVQDRSEQLGEATSRLETKRIESETRKQVFDSMSKVTNQISLAAGLLTNNV
RVLDEAIIPDTPIRPRKKVALMIGGLVGMFLGIGLVFFLDYLDNTFRTPKDIEQHLGLSVLSVIPKHSEKKLASGVIKEA
YQSLRTSLIFSSKNRTRKVVLVTSSGPQEGKSTTISRLGRALATGGEKVVIIDCDLRRPTQQVHNEVPRSPGLTNFLAAP
ESDKDWRPFAKETDTATLQIIPAGPTPPSPPDMLTSDRFLWLVNELQKEYDWVLIDSPPAAALSDAPLLATLAHMVVMVV
RHNHTDRDVAIRAMTQVKNVNEHLIGAVLNNVDIDKSFSKDLYYTGYYYYSSDDGERKKKRKKSDKDLKVGAGA
>gnl|bykdb|A0A1E3Y9R6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium SCN 69-37] (length=749 residues).
MAHLPNAGGRQASAKGGGWHPTDYLRVLYKRRWVAIPGFLLVFVSGAIGSIRTVPVYEARTQIIIEKDARRNTSINTVLE
ERESWYQDDFYPTQYRVLQSRTLAQRTARVLAREPAERVPAASTWSFSPSAVVGTTIAAVRHWFGPAPVLPAASDGADPA
PGAVSPQEAALTSRVQAGVSVVPVRNSRLVDLRFRSPDPEFAARVVNQHAAQYIEQSLEFRLAATTQTNAWLTSQLEEQR
RLVEESERRLQDYKEQNNATSVDDKQNIIVQKLNALNEQFVQARIARMNAEVQVNAMAERRARGESLESFPPVLASPVVQ
KLRADIVAKESERARLGTQYGPAYPAMRDLASQIEAANRDLDLEIDKVAAALQAEFQTARAREAALQQSLAGQQRESLGL
DRQMLDYSALEREAQSNRQLYENLLARAKETGAAGEYRGTAIQVLDPATVPSAPVLPRTPRDLLLAALAGGLLALGLAFG
FEYFDSRIKLPEEIKTHLNLPFLGMIPVFPDAGRDGEAPLLQPDAPAAFSEAIRAVRTAVLFSSAEDGARSVVVTSTGPH
EGKTVVSSSLAITLAQAGQRTIVVDADMRRPRMHEALDRSQEPGLSNVLVGEASLADAARTTAVPNLTLLAAGHIPPNPA
ELLSSPRYAELIAELKRRYDWVVIDAPPVMPVTDAAVVAHGSSGVLFVVGAEMTPRQTAIAAVEQLRSANARFIGAVLNR
VNIQRHAYYYSPYYRKEYGKYYQRSPNRA
>gnl|bykdb|A0A1F2Q9F5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPHIGHO2_02_FULL_67_57] (length=772 residues).
MSDEKSVERYEPAARTLERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVVPAAAPLWHLVSGNGEGSTKLGEAFRS
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
>gnl|bykdb|A0A1F2Q9L4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RBG_13_68_16] (length=766 residues).
MVARRPAAPDKIGFEVEPESEFHISQWLGVVRRRRLLLILVAGLVAAISIVLYFMTPRQYRATTVLQIERRPTSAAAMQQ
PMQIDDWFDAQSFYPTQYRLLQSRGLAERVVKNLRLADDPVFNPGRSRLPGGSGGAVTASDDAATLAGLAYGVLGGLEVN
PIRNTRLVEVSYVATTPELAARIANGVADTYIDWGVETRFATVGKASTFLTSQIEALKQEIQDKEAQLQAYSRRSDIVAL
DPSSNVTLQRLEGLNKDYVGAMSERIGKEAHYKELANTPDDMVADTVSGGLVTQLRGEQLKLERDYATKLNTYKPEWPAM
QELKAQIDKGRQHLGNVTKEMVGKARDSARAEYQGALRREEALVAELTRQKSDAMQLNSAAVEYNNLKVEVSTRRTLLDE
LVRKQSETEVASRLQGTHDSNIVVVDRALVPGGPYRPSLRRNLGLGLVLGLALGLGFVFFLEYLDRSVKTAEDVDRILSL
PVLAVIPDVARSRNGYGYGGSYGYGYGQRRGKGQPGRPTLAGQRPGGDSGAGQIELVSHFKPRLAVSEAYRSLRTALLLS
TTNRLKSVVVTSAIPGEGKTSTAVNLAVVLAQLGRQVLLVDADLRKPRLHEIFGVSNRLGLVNFLTGSADETGIFLRTSV
PNLYLTPTGPVPPNPSELLSSERMMDLVAVAYQRFENVVFDSPPILPVTDATLLGAMSDGVVLCVGSGMVLREDARTCRQ
RLQLSEVRILGAALNRFREHHGRYGKRYRAYQKYVDDAAVGASPRA
>gnl|bykdb|A0A1F2QQH9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPHIGHO2_01_FULL_67_28] (length=772 residues).
MSDEKSVERYEPAARTLERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVLPAAAPLWHLVSGNGEGSTKLGEAFRS
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
>gnl|bykdb|A0A1F2QXK7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPHIGHO2_12_FULL_67_30] (length=772 residues).
MSDEKSVERYEPAARALERRRPGVPAPLQTLEMEPAADLLSYWRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL
LEIEREGPNILTVQELFQIESASDTYLETQYRILESESLARRVVDQLRLDQLAEFSRPGFRLRGGKRETPASPQTFAVGA
AGVARDPVAYQNALETFSRRLAVAPIKRSRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLLE
IKANLEKSEEQLQAYARQNGLLFLENEAGQPENIVNERLLQLQAELTRAQAERIAKESLYRLTQAGEYGALPGIFENKLM
QDLTVQLAELRRQHAQAATTFSPDYPTVKQLQNQIDEIERLLAQERARAAERLANDYQAAMRRETLLRRAFADQQAQAGR
VAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGMSAGMKASHVRVVDPAQPPDKPAKPSLALNLLLALVLGLGLGLAAVF
LQEHFDNSLKTSEDVERFLHLPVLALIPSLESLNGRRRAYGLPTPKRLASRSVVPAAAPLWHLVSGNGEGSTKLGEAFRS
LRTSVLLSTPEQAPRLLLTSSAQPGEGKTTVTLNLAISLAQLGERVLLVDADLRRPCIHKAFKMAGGRGLVSYLTGQQEW
EAVVHPSPVENLDLVICGPIPPNPAELLSSERLRAFLRQALQRYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTP
RELVQRAYVYARDVGANVIGAVLNNLDIRSDDYYYGRYYRYDYYGTGEHPPK
>gnl|bykdb|A0A1F2RFI7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10] (length=781 residues).
MSEEMSLEKIPPLKGEVPATTTVAAYTISQEEEAATPSFLDYWRVLRKRRWTVLGLLLLVVVTVMIGTLKQKPVYRAKAV
LQIDKESSNIFSFKDFVADIDPFDESYLETAYKVLQSRTLARRVIDKLQLDKLPEYDEKPSWFAKLLSKSRSESQQLPAE
DLALDPKYYNVLDNFQDRLTVNPVRRSRLVEISFDSYDPALSARTANALAANFIDQNLEAKWDATQKASDWLSQQLVGLK
GRLEKSEEDMQRYAKDNAILFLDEKQSLTTEKLKQLQEEATRAQADLFQKESLYNQVRTGDLSSVPGILENKLYQDLSIK
LADLRREYSELTATFTPEYPRVKRLKNQIEEIERTVQRERGAFAKRVTDDYRAALNRKRLLDQAVEQQTKEINQIAEKSI
PYNILKREADTNKQLYEGLLQRLKEASVSAGLRASNIRVVDQAEVPEMPAKPQKLVNLALALIFGLGLGVGMAFFQEYLD
NTLKTPEDVQRFLHLPTLGIIPAASANGRAGLSYGYGYGYGYGSRKSLPEDTSAPDGEKKLHPELIAGDGTNPLSEAYRS
LRTSVLLSTSGRPPRVILVTSGQPGEGKTTTVVNLAIALVQLGGRVLVVDSDMRRPRVGNLLELPATPAGLSTYLTGQFG
LDDVVTPTQIPNLFAIPCGPIPPNPAELLSSELMRQFLEQARQKFDYVILDSPPVLHVSDARILAARVEAVILVAHGAAT
PREAVNHAKQHLHQVNGNLIGVVLNNVDFSAVGYDYYYRYYRKGYGYGYGGYGSGCEEKQA
>gnl|bykdb|A0A1F2RZS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20] (length=783 residues).
MEENNSLERVSRGQIDAPASVPVSSYPVEVLEEQDSFPLLEYWRVLQKRRWTILSILLLVVVTVMIGTLKQRPIYEAKTV
IQIDRESPNILSFQGFVAEMNPYDDSYLETAYKVLQSRSLAYRVINKLNLAHSPEFAKEQESSPSWLGTLWPGGAEQPEG
PLSPEEQLDPKYSAVIDNFLGRLQIVPIRRSQLVEITYESYEPSQSARVTNTIAANYIDMNLEAKWDATQKASEWLSQQL
VGLKGKLEKSEEDLQRYAKENSILFLDEKQSMNAQKLQQLQEEATRAQSDLIQKESLYNQIRDGDFSSVPGILENKLYQD
LSLKLNDLRREYSDLSATFTEEYPRVQRLKSQIDQTAAALDRERQAFAQRVANDYKAAANRKRLLDQAVAQQTSDFNAMA
EKSIQYNILKREADTNKQLYDGLLQRLKEASVSAGLRASNVRVVDPAEVPTLPSKPRKLMNLALALMVGLSLGIGMAFFQ
EYLDNTLKTPEDVQRYLRLPTLGVIPAANAASRKKLAYGYGYSSRQTLAEVTSEAANGKPLSLELIGANGNAALSEVYRS
LRTSVLLSTSGRPPRVMLITSGQPGEGKTTTTVNLAIALVQLGGRVLVVDSDMRRPRIGTLLKLPTTPAGLSTYLTGQFP
LEDVLVGTHVPNLYAVSCGPVPPNPAELLSSKLMRQFLEQAAQKFDYVLLDSPPVLHVSDARILASQVEAVVLVAHGAVT
PREAVKHAKEQLQQAGANLIGVTLNNVDFSAVGYDYYYRYSRGYGYGYGEHPYARPEANKQDI
>gnl|bykdb|A0A1F2S1W5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18] (length=842 residues).
MSVPSQFERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIHYLQVLYRRRYVAATAFLVV
VLSVALYTFTAVRIYEGTVRILIERDDPNVVSFQEVLEQNEVTDDYYETQYRLLQGRGLARRTIDALNLWSHPQFTQPAR
PTVRSVIMMPVNAVARWFEPPRPVEPPDAAETRVQSRVINRFLAALDVSAVRYSRLVDVSFRSNDPALAARVSNALADQY
IKQSVELRSNTTKEASEFLVQQLAEQRNKVEASEQALQAYRERTGSVSFEERQNVVVQRLADLNAAVTKANTVRIQKEAT
YNQVKAVLENPAAIDTVPAILSNAFVQQQKTELAQLLRQRAQLSEKLGPNHPDMIKVNTAIQLAETRLQAEVAQVLQAMR
NDYEAALTEERTLANELNRQKIEAQQLNRTSIDYSALQRDAAANRQMFEALLKRTQETGVSEELKTGNIRVVDLAENPTG
PISPNIFNSLLMALLGGLTLAVGLAFGLEYADDRIKNPDEMKKHLGLPFLGMVPALFDKGAHTPLIGRGVSALFTESFRS
IRTNVLFSSTEEGGRLVVITSSAPGEGKTMVVTNLAVALAQAGHRVLLMDADMRKPRVHEVFGVPSSPGLSNLMVANATA
SEVIQESSTPGLWVLSAGTHPPNPSELLGSKRFKEFAAFLMQYFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTS
RRVAQRAVEQLELGQAKFLGTVLNRVDLEHNSYYYSRYYRPEYGGYYGPGAPGGTQTGTGAGPPAANSGGVGTRAARVAA
ATAAKAASVAATVGSRLVRRTAESASGTLQPGLRTRGDIRHL
>gnl|bykdb|A0A1F2SVH2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_10] (length=755 residues).
MSEESPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLDYVKVLYKRRWTALTAFLIVVLSVSVYTFTATPVFEARVQIL
IEKEATNVVTFKEAYEQNQVTDDYYQTQYKILQSRALARRTLDALKLWDHPQFNPKPDDSLTMRKIALAPVVLVAGWFKP
AQPLEPPLPDESKVQSNTIDRFLRALTVAPVRNSRLVDVRFDSPDAAFSATVANALARAYIEQHLEFKFLSSKEASDWLG
ERLAEQRKQVEASEQAVQRYREQTDSVSLEEKQNIVVQKLSELNAAVTRAKTERIEKEAAYNQIRTVQNDRATLDTIPAI
LSNGFIQQQKNVLADLQRQQAQLSDKLGPNHPDMVRLSSAVREAESKIQGEIAKVVQAMRNDYRQTVAQEQSLMSALEQQ
KSEALSLNRKGIEYGVLARNAASNRQIFESLMQRTKETGISGELKTSNIRVVDAAETPRGPVRPNTRNNLLLALFGGATL
AVGLAFFFEYLDNRIKSPDEIKQHLGLPFLGMVPALFDKALENPLISDGVPSNFSESFRNIRTNLLFSSADEGGRSVLIT
STGPSEGKTVVATNLAVALAQAGQRVLLMDADMRKSRVHIVFDRSQGPGLSNVLVGNAKASEAVHKTAVPGLWVMPAGPH
PPNPAELLGSKRFKDFMASLVEHFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSRHAAQRALEQLEQARAKSIG
AVLNRVDLQHNSYYYSQYYRREYSDYYQNEGSART
>gnl|bykdb|A0A1F2T595 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21] (length=846 residues).
MSTQIPPEFSQKAPASQGSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDSELTLVHYLQILYRRRYAAIT
VFLATVVTVALFTFTATRVYEGSVRILIERDDPNVLSFQQVFEQSDGADDYYETQYRILQGRGLARRTIDALDLWRHPSL
NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAETRTQTVVINRFLANLGVSAVRYSRLVDVSFRSADPGLAAKVANE
HSKQYIEQSLEFRTTTTREASDFLTQQLAEQRKKVEASERALQEYRERTDSVSLEERQNIVVQKLQELNAAVTRANTARI
QKEAVYNQVRTVLEDPAAMDTVPAILSNTFVQQQKAALADLQRQRAQMSEKLGPNHPEMVKINVALRGAETRLQNEIAQI
AQAIRSEYEAALAEERSLSASLNQQKIEAQSLNRAGIEYGALERDATANRQMFEALLKRTQETGVTEELRTGNIRVVDPA
EMPTGPVSPNIINNLLLALFGGMVLAVGLAFTLEYADDRIKNPDELKKLLGLPFLGMIPALSGNRASPPLISEGVPGVFS
ECFRSIRTNVLFSSTDEGGRMIAVTSSAPGEGKTVVSTNLSIALAEAGHRVLLLDADMRKPRVHEIFSRRVDPGLSNLLV
GNATASESIFESEIPGLWLMPAGTHPPNPAELIGSRRFRDFTAFLLQHFDWIIVDTPPVMVVTDATIAANFAHGVLFVVG
AEMVSRRVAQRAVEQLELGQAKFVGAVLNRVDLEHNAYYYSRYYRPDYGGYYGPPGGGGGGGTVAEPVVARPAAASILGG
AGAGARAARVAASAGTSFTRRTLASVFRSVQSGVRSAQNFRIERHL
>gnl|bykdb|A0A1F2TCR2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21] (length=762 residues).
MFDTHDLQQAPAIAIEAPPQLPMPPVAQSQQPLHVLDRLSAVFKHRRVAGAAFVIVVMAMMVQTYSTIPLYLATARVMIE
DERSIAVANLNANDPMFWQDSTQYYNTQYSILKSRVLGQRVVRRLHLQDNPAFNGQAPPRRGPLIAVRNARASLGKAIRR
LITRPIQTPAVEPAAPDENAAEAGIISQFIGSINIIPEQTTRLVSIQYRSPDPRFAALAANTIAEEYATQNLDLHLDNVL
GKLAWLDDELKKQQQKVTDSEAAMMQYREQKDALSLDSSQNTVLPRLNSLNDSVTRARLARLQKGQVYEQVRAVKPDSDE
ADNLSIIATSPGVVTAKSRLADLNSQRLTLSSRYMDTHPDIQKLDAQIAIAKKDLIAQRQRVIETAKTDYEAAVAEERSF
ASSLEDQKRVAMDLDRKSTDYSMLQRQADGDRKMYDTLLQEQKSLQVISNSRSNNVQLMDRAEVPAAPFTPNPRKDWFTA
IMAGLLVGVGLAFGIEYLDDTVKTPEDITKVLGLPLLGLVPAIRGERVPLLSEQVPHDFGEAFRSLRTSLVFTGKSEGPR
VIAVTSSQPLEGKTTTACNLAMVLALGGSRVLLIDADMRRPGLHKIVGIPNSVGLSHLLVGQVRVREAVQRTSEANLFVM
TAGRTPPNPSELLASERMKGFLTNLAGGPFDWVIIDTPPVLAVTDAVIVSRLVSNVVFVVGSEMTRRGHAERALQTLLSG
RPQSIGAVLNRVDFDRNKYYYARYYGYQYKSYYGQTNTTPAA
>gnl|bykdb|A0A1F2TPT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21] (length=778 residues).
MSDEPRSNPPAEATPPDDIRLSMEGTAEPALRRYENDALWQGLEGEDRHFQYYLAVLYKRRWIAITALLVVLTFAINRNF
TAVPVYEASVRVLLDAERLNLVNVEDVIDQRRPLDTELAILRSRWLAAKTVASLGLIQNEPVAGRGAGNGVGKRDGQAGK
SGPDGWWSAASLFVSRAFGGFPPPPRAAEPLAGERPAEAPQISAFLGGLSLAPTANGVLDIKYRSSDPVLAARFANAHAQ
EYINENLEMRVAAVREVTGWLTARLAEQKEKLDASEQALEHFREQNQLITAEGSPIVMARLNELSASITRAQTGLFDKEA
SYNRALALRANPDKLDQLPQMLNNAALQQLRLELERLRRDRATAARTLRAQHPSMLKLEETIQATQAKLDVERSRVLEAM
REDLGVSRAAEANLGKELESLKIEATAQNRKNVELSILTREVASNRQIYDMFMQRARETGVAKDINPSRIRILDAATVPS
SPVGPDKGRSILGAVFAGLGLALVLAFGFEYLDNRIKLPEEIGQRLGLPVLGFLPEIKLKSGVTGPLATNGVPPEFSEEL
RRIRTNLVFSFAGDATRSVVITSASPTEGKTVVGSNLAVALAQAGERVLLMDADLRRPMIHTHFAFPQEPGLSNVLVSGA
KAGEVVRRSAVANLWVLPAGRCPPNPSELLGSYQFRKFLAALGQHFDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGADM
VSRRTARRAVEQLMMANAKVIGGVLSRVDPGRFGQYYSSYYRGNSRKYRDYYKGAASA
>gnl|bykdb|A0A1F2U158 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29] (length=751 residues).
MSESSPAHPTPASAPTSSGAPRAPQPLTYAVDKDVHILDRLAVVYRYKRIALSVFLLTALALMIQGYSGEQVFQAKAQVL
IEDERSTAMPGIAAADYYQDPIPYYNTQYRILRGRDLARRVVKRIDLQNVAEFNGTAKPAETPVTKARDAGDRLLRFLAR
TPTPIAEVPKPDETADESALVSRFLGRVQVVPVAESKLVDVYFTSADPQFAATAANALADEYVASNLEVKMQGTQSMLDW
LEKEVATQQSKVEQSERDLAEYRDRENAMSLDEKNNIVLSRLNALNDAVLRARTTRIEKESVNNQIKSLGTTPVDSIPAI
AQNAQVQLHKAQLSELQRQKAQLSERYGEKHPDIINVNARLGDEQRQLDLETAKALQTVRNEYERAVLEERTFAANLEEA
KKDVQDLGRKSVSYNVLEREARSNRTVYESLLQRENELRVSSNSRANNVRVVERAEVPAGPLTPTGRRTWLLSFAVGLVA
AISVAYGLDYMNDTIKTPEDVTRMLKMTFLGLIPSVRGDKHPVLASSHAPHDFSEAFRSLRTSIASRYPGEGAKTMIVTS
AQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRSLRLTNDRGLSQILTGQARVRDVIQRTVDPNLLAITAGRTP
ANPSELLSSERMKTLITNLRHGPFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRRRLAERALETILASHPKMVG
VVLNKVDFARNKYYYSRYYGHQYKSYYARVG
>gnl|bykdb|A0A1F2USE2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22] (length=808 residues).
MGEEIPDSKREVPDGRIERYEPSPPMLARPEPPVPVAYETVETEEAPDLLAYWRVVQKRRWTILTIFFVFLTLVLLWTLK
QKPIYGATVLLEIEKENPGLATVQELFELDAVSDTYLETQYKILGSESLARRVINQLRLDQRAEFNPPQPWWSWGGKETA
AAAPTLVVGTSEPEQDPAAYQGVLRRFQDRLAVAPVKYSRLVEVHFESEDPALAAQATNTLAANYIEQNLEARWEASQKA
SEWLSQQLTGLKAKLEQSEEELQTYAHEQGLLFLQNQRGENENIVNQRLRQLQEQLTQAEADRYQKEALYQLLAQGDYAS
LPGIHDNTVMETLTVKLAELQREHAQLTTTFTAKYPRVEQLENQIQEVQGLLGQEQDKAAERIRKEYGAAQQRQEFLRQA
FQKQEEQANLIAEKSVQYSILQREVETNQQLYEGLLQRLKEAGVSAGLKASNIRIVDSARPPEKPAKPKVLLHLAMGFLL
GLGLGVGAAFLQEYLDNTLKTPEDVERFLHIPALALIPSVESLSGRRGRAYGYGYGLYGQTRQLESGAEGTTEKGLARGG
TPHGWYRIDELDPQRSTLAEAFRSLRTSVLLSTAERPPRILLVTSAQPGEGKTTITLNLAISLAQLGQRVLLIDGDMRRP
CLHKVFQLYESGGLSSYLTGQAEWRRYALSTGVPHLDLMACGPIPPNPAELLSSERMRTFLQEALGEYSFLVIDSPPVLH
VTDARILARLAEGTVLVVKGAATPRELARRAQLHCRDVGATVVGVVLNNLDVRSGDYYYYYYRYYRYGYGYGYGSQENHP
PEDHAEQS
>gnl|bykdb|A0A1F2V330 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium RIFCSPLOWO2_12_FULL_60_22] (length=728 residues).
MPSDGTGKEISVLALLDIVMRRKLFVLIPAAVLIVAVGIYTVYQPPLYRAQALLGVEPGARNYVQTMDGSVARVQDQLLT
IREVLFSRPVLEPVMRNFHLLPMPDGKISDTDLDRMRESIKITVEGSDSFHLAFEGRGRTQVMNVTNDLSERFIRRLANM
REQQVNEGAGLLNAELETLRSQLNEQEERLKIYKESAVNELPDRLATNLSLFAATQAQLRSSSGLKANDQARLAAVQQEI
TELEKEGVLDAAPPKEKTPAETNLEERRLHLKQLRSVFTEQYPEVVSTEREIKELEKAVAAAPPKPTVAEPSAARMHYVQ
IRAEKESLEQRLTSYGQEERALESEMGRLQRRVQSTPQHEIAITELTRGYEATKTRYNALLAKQQEAGLASRPERMNKTV
AFRIVEPASLPKGPSTPRRSRLLLVGLFVGLALGLAVAFVAEQMDTTFGNIVEFQTFTNLPAIAVLPSMSADLDPGVKPL
TGTIPLIPPCGGDLSPTLLAFADLHRNHIVMVTDPHSVASEQCRMLALKTRQQLSGVRSPLLAISSVVGGEGKTVTSLNL
SLALAGTVSGRVLLIDSDLRKPRVHEYLGLKPGKGFSDLLRAPEDEIGKYVSKLGDLYIMPGGSSLANPVSLLASQSVRS
VFERLRGEFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRREVLERGLESFQATKLLGAVVNDVDYQRSRYAYAY
QYQAGLPV
>gnl|bykdb|A0A1G7JVV8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus roseus] (length=751 residues).
MPPLTNQPSDRVVPETNAGFSAITAESALSEALNVLRKRKWVLIIAAILGILYGVYQAATQPIVYVATGRIQVAKPNGQA
SLGVATGNLTGSLQSEDLETEVLIISSESLMLSVAQEMNLANNPDFMGSGPYRNINDPIVRAAVIGKLSNAFKVASIPRT
QMIRITVTANKAQLAADLVNHLINAYQQRSFESRFASTQRVSQWLQGQLDDLKQQVEASQEQLMDLQKKIGVLGLGADAS
KPVTTQVTAAVEALSTAAIAAKVQRILAESRYRVLASSDPALMESNLQASGAGQESELSKLRDDAAQTKAQIAQSSVSLG
PKNPQILALQAHLREVDREIKTEETRMVTEAKQALVAAQANEAQTEGALEDQKNQSYRLRDDLVEYTLRQRDYETNRALY
EALLAKLRSASVQAGLDALEIDVVDPAFKPIGPTMTPRSSILSRDLILSLVFGIMLAFALESLDTGIRSVSEVEHITQLP
SLSIIPRVRRMQSDGSGSATVAQTNIGVLATSKSQFSEAFRSLRTALLLATTGHPPKFILITSSTPSEGKTTVSTNLAAI
LAQRETRVLLIDADLRRPNVHHRFGLNGRVGLSTVLSGGATLEEAVKNVPEVPNLDVLCSGPVPPFPTEMLSSESMKNLL
QECGELYTHVVIDSPPILSVTDAVILAHYADAIVMVVRHGKSSRNVVRRARDLMVRSGAPVTGVVLNSVDINAPEYHGYY
GYSGYSYSNIDSESWESNGRENERNNKGGQA
>gnl|bykdb|A0A1H4T6W9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus roseus] (length=765 residues).
MNQPVTHDPANPAGFTSTAADSALSEALAVIRKRRWILIACAIVGILYGYYLASTQPIIFTATGRIQVHEANSTATQMMG
SSLSQETNLENELGIIMSDSLLLNVARNMNLVNNPDFMGGKAARFRDINDPVVRTEVLRRLGGAVVATVIPRTAMVRITC
TASKPQLAADIVNQVINAYQQRSFETRFESTKRISQWLSGQLDDLRQQVETSQEQLIDLQKRLGVLGLGFDATKPPTTQL
AVSVDALSTASVGAKVQRILAESRYRVLANSDPDLLESNLDVAGGQSELSKLRSDAAETQASIAELSITLGPKNPKIVAL
QAHQREIQRELRSEENRLLTEAKQALVAAKANEDQTSSALEEQKQESYRLRDDLVEYTLRQRDYEANRTLYESLLSKLRA
ASVQAGLDSLEIDIVDQALKPAAPSITPRSTILLRTLLISLVAGLMIAFTMESLDTGIRSVAEVEQITQLPSLSVIPRVR
RLSSDTGTMSVAQNNIGVLATSKSQFSEAFRSLRTSLLLATTGHPPKVILISSSTPGEGKTTVATNLAAILAQRDTKVIL
IDGDLRRPNVHHRFGLNGRVGLSTVLSGGSTLEDAVKNVPEVPNLDVLCSGPVPPFPTEMLSSEAMHDLLLYCCSIYTHI
VIDTPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDLLVRSGANITGVLLNSVDINAPEYHGYYGYSGYSYSNI
DSESWEAGSNATPGGGQGKARDGGNRSSGPGEPSGAEGHDGEDRA
>gnl|bykdb|A0A1H5SQF5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Bryocella elongata] (length=771 residues).
MPYDPLQDVTSRSASTHRRSAFRREMHLSDALVILRKKLWLIVGCVVVGVGLAVLLTSLMQRRFSSTVTIEVHKEGGTSL
SLEDLSGAGQQLIGGDQLSVDLLTQQAVIGNENIAMKVLEDLGLTNSQPFLALRPANATASGQSLLETDPTYRDSAVNLF
QSRLKITLVKGTRLVNVTYTDADPKQAARVANAVVEAYLISSTQQRYDATSKTSAWLTNQLSDLKNKVAESQRRVDDFRQ
KVGIIGAPTMSSAGSPQVGSDLGSVELARLNDLNAQLTAAETVRIAAEAAYRMTQSRDADVVLGIDSSQLNGAPGALASL
DTVRLHQLRTQTGQLEVQISAETQKYGPRNPAILSLKSELAELQRQTNEEISRVGNQAARNLDLARKTEDGLLQSVDREK
LRLGHMTTSADQLLLLEQEETSNRTLYQDLYGKLEAANILAGAKSSNVTIVNPARVPSGPSRPQPVQNIALGFLAGLATG
LFLAFATAYHNDVLSTPEEVASLTSLPLLGLVPQAGKRRRWAYAYPYAPTKKADAAAESEGKFAWVLKAPRSVVAEACRQ
IRTAILLSRAEQPRTLLFTSSFSGEGKSTLTSNMAFAFGLQGSRVLLMDADMRRPTLHTKLGLTNGSGLSQCLTSDIDPA
SVIQVHPDMDKVHVMTSGPVPPAPSELLGSPRFVKLLEQMKKEYDYVFIDSPPVLLVTDAVLTSTLVDGVILVVRSGVTR
RTPLRRALEQLAPSRNRLLGLILNAADIESSEFGGGYKYYGDSTYYEDSDA
>gnl|bykdb|A0A1H5Z7N3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Bryocella elongata] (length=772 residues).
MIPVRAQTSQASESEVVMPQAMQDRASGDTTLSDAWLTIRKRKYWILAAALIGILLALYQSATQPRLFEAYGNIEIRSGA
SNEYKIGAATGGSGIESSSAHLPTQVSILKSDTLLLTVARDLDLANNPWFLGTQKSKQAQPHRNIDDPVVRQMVLYTLRA
DVNVSVIAKTDLIHISCQTFSADLSAEIVNKLIREYIFRSLESSAEAQKRVSDFLSTQLGDLKQQVETSQEQMIDLQKKI
GILGFDPTHNEITTSLEDLNRAVGQAQISRIMAEVRYHTLSGMDPNQIDDSVASTQVGSSGNLTSGAPGAGDQQLATLRT
QMETTKADLAKLNVAMGDRNPQIRALRAQVDTLNQEIRAEQDRILAQARQNYIASRTNEQQTRGALEAEKSTAYQLRDQM
VQYTLRQREYETNRQLYDGLLQRLRSAAVEAGLESTEIEIVDNAVPPVYPTLKPRSTILMIDLVVALIVGLIVAFVLDSL
DTGLRDVMEIERITGLPSLAVIPKTRRTSAEQNATGLVARNIGVLAAPKSQFAESFRGLRTSLLLATAGKEPKVVLVTSS
TPSEGKTTVSTNLATVLAQRDVKTLLIDADLRRPTVHHRFGLNGKIGLSSVLTGSATLEQALQRVPELPNLDVLVSGPVP
PFPTEMLSSQVMRNLVEQCRGIYTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRHGKSGKQAVRRARDLLIRSGAPLAGI
ALNAVDLNSPEYYSYYGYYGYSGYGSQGVEHDGWASKSDKRKSKSKEERGGE
>gnl|bykdb|A0A1I6MH75 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella pectinivorans] (length=753 residues).
MDRQTTETTSPTGVPHTPGGGFAAATAATETTLSDALMTLRKRKWVLVACVLLGMVYGSYDAITQPRLYESHSRIQVRSG
ASNEYRVSAVPGMGQDTQTKMNTEIAIMQSDTLLLTVARELNLPNNSDFLEIKGKAPHASLDSPAVQAGTIRRLNGHLKV
SLIPKTEIIAISYTSLNAKLSADIANKVVSDYIQRSFETRFQSQQRVSAWLQNQLDGLKQEVETSQEQMMDLQKRLGTLG
FDPKDNQTTSTLEDLSKASGAAHIARILAESRYRMLSGMDPGTIDGTIDMNPGTMPVQFAQLRSQIALAKANYAQLMTTL
GPNNPKALELSNEIKELDAQLAAEQKRLLIQTREAYLATKANEQQTSAALEQQKTDAYKLRDDLVEYTLKAREYETTRTL
YDGLVSRLRTASVQAGLESTEIDVVDLAMIPASPRLQPYSSVVLTACIFALLVGIILAFTLESLDTGLRSIAEIESVIEL
PSLAIIPKARRTAAEQVGSLTTAQRNINVLTQPKSQFSESFRALRTSLLLSSTGHPPKFVLFTSATPSEGKTTTACNLAC
ILAQRDTRVLLIDADLRRPNVHHRFGLSGKVGLSTLLTGTTGLEESLQRVPEVPNLDIMASGPVPPFPTEMLSSAAMTSL
LERCATLYTHVVIDSPPILSVTDGVILARQADAVVLVVRHGKSSKQIVRRARDLLIRSGAPITGLVLNAVDLNSPEYYGY
YGYSGYSYTSIDSDSWESQKRAGENPVEGKNGQ
>gnl|bykdb|A0A1Q3QQB6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriales bacterium 59-55] (length=750 residues).
MGLQNTQPSADGDTSELNSPRFGSAVTDTALSDAILTLKKRRKILILAILLGLGYGIYKAQTQPKLYEAVGRIQVRSGSS
NEYRLSAVQALGGTDTASKMLTEIAILRSDSLMLTVARDMNLANNPDFIGKDAPHGNIDDPAVRQATVHALQSGLRIVLV
PKTEIINISYSSLNPKLAADIVNKVISAYIQRSYETRFASTQRVSRWLSSQLDDLKQQVETSQEQMMDLQRKLGIVGFDP
NHNQISSSLEDLSKAAGEAKIARIIAESRYRVLSGMDPDSVESSIDAAPGAAPQELTQLRTQLATARASYAQMQATLGPN
HPQAKALRAQIDELSKEVTKEQNRLLLQAKENFVVARANEVQTKAALEQQKTDAYKLRDDLIEYTLRQREFESNRTLYEG
LLQRLRTAGVEAGLESLEIDVVDQALPPAKPTLKRRSTVVLTGMVFGLLGGIIIAFIVESLDTGLSSVAEIESLIELPSL
AVIPKARRLSVEQSSTLTPTQKNLSVLSQPKSQFTESFRALRTSLLLATTGHPPKFILLTSATPSEGKTTLSTNLACILA
QGDARVLLIDADLRRPSVHHRFGMSGKTGVTTVLTGAAPLEEAVQTVPEVPNLDILPAGPMPPFPTEMLGSEAMDQLLRQ
CGDLYAYVVIDTPPILSVTDGVILARHADAVVMVVRHGKSSKHVVRRARDLLLRSGAPITGIVLNAVDTNSPEYYGYYGY
SGYSYSSGDSGSWEPQSDSRSKDRRTGETD
>gnl|bykdb|A0A1Q6Y9F5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_57_17] (length=777 residues).
MADENKLVPRENGSNGAVELVSLQSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATAR
IEIDRENANILPFQGAESYEYMMDLENYIETQSKILTSETLALLTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLGELKIRVQKSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLFKKRSDAASQYTDA
LAQYGPNFPKVQRLQAQIKEFDQTIEKEKQNILNVLESDYHEAQQREALLTRALDQQKADTNQMAGKLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNIALAFLVGLVGGIGLALMREYLDNTVKSPDDVET
LSRLPSLAVVPQFASSNGRSKRHGFFQGLSSNGHDARIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAAGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLADAIAELRAKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLSSVKCRILGV
VLNAVDASAPDYYYSYRYYPYSYGYGPQEALDAPHENESDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A1Q6YR79 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_57_17] (length=799 residues).
MDDQNQVELYSRGHRLDRRGPGALDGRVLELPDSYEILEPGEALDLRSYGRILRKRLPTILVVFFILFTGILIATLKQKP
VYRAQVLLEIQKENPDIPTIKEMYELDAVSDAYLRTQYSILASESLARRVIDQLQLETLPEFNSPKWWQFWPRNKKSPAP
QTFAIGPVPETRDRELSQRVLERFQDRLTIDPVNRSRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDDLQSYARRNGLVFLETDKGASQNVANERLQQLQEQLTRAQSERYEKEALYRLVQTGEFGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQVDEIESSLREERQRAADRIANDYSAAVRREDLVHQAVDG
QQKQVSLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPFKPRTLLNLSVAVFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVPASNGDHLGIHRFLPRDKSLSLAGNGNGSGKDRRPSWHLIDRD
GTQHAALGEAFRSLRTSVLLSTPDRPPSSLLITSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRT
LGLVSYLTGQQDWRAAVHPSGSRGLDLLVSGPVPPNPSELLSSQSMGALIRSASAEYGFVILDSSPMLALADSRILAPLV
NGVLLVVRSGATPREQLLHAQAGIRGVGGNLIGVVLNSVDIRTNGYYSYGPYGPNAGSPPQETFVPANFQMPPQQKASD
>gnl|bykdb|A0A1Q7CB82 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_2_20CM_2_57_6] (length=777 residues).
MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR
VEIDRENANILPFQGTDSYDYMMDLENYIETQSKILTSETLALQTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLGELKIRVQRSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLLKKRSDAASQYNDA
LAQYGPNFPKVQRLQAQLKEFDQTIEKEKQKILDVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNVALAFLVGLVGGMGLALMREYLDNTVKSPDDVET
LSGLPSLAVVPQFAGSNGNGKRHGLLQGLSSNGHDKRIELVAQHLPKSQMSEAFRALRTSILLSQAGHPPQVILVTSALP
REGKTTAAGNLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAGGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLVDAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLNSVKCRILGV
VLNAVDSGAPDYYYSYRYYPYSYGYGPQEAVEAPHEEDSDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A1Q7N5R7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_65_5] (length=800 residues).
MPDHTSLRRTPPPPLTAADLSRAGTAVEKFSPNGDEGPDWHRYLTVVWRYRWWILAATALGTIGGAAASRFLPPRYVAQA
TIWIQTSGGNGPERGPIGANQLLVASAWTDLLKSYVVLDAVARERRLYLQARPRDMAVMATFAVADQYRPGRYHLKVDRT
GQHFSLQDEDGTELERGDVGAAIGRTDSLGFRWTPAAADLAPGAEIVFGVTTLRDASRGLSDGLRVSPDLSGNFLRIALT
GPSATGVTGVVNAVADRFVAVATDLKRAKLTELGRLLREQLQAAEAGMHRAESALEAFRVRTITLPGDPGVAAAGAPPRG
SPLGEFFSLRIEQDQMRRDADALEHVLISMRDPGALADALAPIGAVQRSADLTQALHELTTKRAEQRALAYRYTPDHPTL
QRVTSEIETLERTTIPALAKALATELESREAVLGTQITAGGRELRGIPQRAIEEARLRRDATIAENLFTSVQQRYSEARL
AEASSTADVRVLDAAVAPRRPVKDSASRLIALGFLAGLGFGVVGAVLVDRLDRRVRYPDQVTNGMGLRILGALPHVKNRK
AGPDDEQVLQVIETMRSVRLSLLHAYGTAGPMVITITSPAVGDGKSFVSTNLALACAQAGQRTMLVDGDTRRGALHRVLG
GVRKPGLTDFLAGRVPLEAVKQALPYPLLHFIGAGSRLRESPELLGSPAMVDLLVRLRADYQVILVDSPPLGAGVDPYTL
GTLTGAMMLVLRTGTTNLELARTRLAMLEHLPIRLLGVLLNDVQPGEMYGYYSYTYAGGYAAVDEDNSTRVARRRMQGVL
>gnl|bykdb|A0A1Q7NJH5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_3_55_6] (length=806 residues).
MKEPTELIEKSNGSRDVGGPWDRSLAPYTRYDSYADDSNGYSRLRDYWRSIRKHVWLVIGIVVVVTGLTAVYMARQPDVY
ESASRVQVDSETANNPAIGALKGNPIFLNYPSQDPTYFNTQIQILTSAGLLGRVAKTLDLEHNQAFLHPQSAQNLSFWES
LKGLIGFKKSQSKTKEQEEYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKPLSDTRIIEIRFKHQDSEIAGKINNAI
ADTFVVSNLERKNETTNNAGDFLQRRIADLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENDRKA
AEAAYRAVLAPGALEAQAEATSNKSSAATEAKLAELKQRRAQLLLEYTEKYPEVKDVEQQIAMLEKQVDQVRTHTESVVK
TNLETSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYRIIQQQVETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAA
IPKTPIGPKRMQAIVLAALFALIAGIALAHYLDYMDDSVRTSEDVENFLRLPALTVIPTIGNSARRRLLSAMPGSKRNGH
QVGPELLLNSSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRL
HSIFNVDNDKGLSGILASKMSEREMLGWVQQHEESSLYLLPSGRLPPNPAELLGSDQIRTLMSVLGNTFTHIVIDSPPVA
SFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYRDYYHSAADTQPAEIS
PSTVDS
>gnl|bykdb|A0A1Q7RBU1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_60_7] (length=742 residues).
MSKYFELMNQLGRDSAAVQLTRAAPNLPNRYPQRLIDAPEQMSTAGLWRIIRNRKWTIAVFALVVVAIVVTASLLMKPQY
EAVGRVVFHRENDSGVLGFKSVHPSLLEDPEDRAAIDTQIGILQTDALAMQVINDLHLDKNPKFAGRAEQPVNEDRLVES
FHKNLTISKVKGTRLIEIQFRNTDPRLAADVVNELARAYVDQYYKSLFQVSTQISEFLANQLKELQAKVEESQQKLVDYQ
KENGIFGLDDKQNIVTAKLDDLNRELTAAEAERVQKEVNYRLASSGRPELIAKLEPDNLITKLRAQQADLENQMAQASVQ
LGPAHPKMGELSNQLAQAQRSVDAEVRRIGEHITYEYKSAVGRERMLRSALEAQKQAADKLNANAIQNNILKHEFETNRK
LYEDLLQKQKEMAISASLKSSNIWIVDPARPPKLPAEPKILRNLALSLLFGIFGGVLLAFGLTKMNEKISTLEQALALSP
LPSLGVVPLLEAKSKSRARAQLNGVNGDLKPEMVSFLQPLSLAAESYRALLTSILLSQSTPPAVILVTSALPREGKTTVS
TNLAIAIARLRKRVLLVDADLRRPSIHRAMGLKTTNAGLGALLRKSTAFEEAVMGCTDVPNLFILPAGPVNLPDDTELLV
SGFKDLVERWRDQFDHIIIDTPPVLPMTDAVHMSVEADSVILVIRSGQIARDEFLCAQDLLLKVNAHLLGFVLNGAGLSS
SDFQYYYGYYGQDQSKRLGKGT
>gnl|bykdb|A0A1Q7RLS4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_40CM_2_68_5] (length=711 residues).
MEEKREIHLLDYWRTIWRGRWTILSIFVVVFTLVAIGTFTQKPVYRASVTVEITPQSRKVSPVAEVAETGMAQYGWYAEE
RYFNTQYEIIKSRDVARRVFDRLDLYNHPLFKKSVDSIGAFSEMIVVAPVKETGIVEISMEGLNPEEVASWVNTISEVYV
ERNLDQVVEATSKAVKALLSEIAPLKEKLEDTQRTSFEFAEKANLYVPENQQKITNDRLSTLQSELTEAQVKKGEIEGLL
KQIDANRQNGGAYENIPQISGDTVVRDLYREKAGLEREYERLLVTYKDKHVRVLEKQKEIEETTQKIASEVDRIINGLRS
QYDLLKDREAKLIKATDETRTESLQVNRKASGYEMVRGEATETKRIYDLISARVKEIDLSSSLLSNNLRILDKAPVPKVP
VRPRTVLNLAIGMLLGILLGVGAIFFLDYMDNTVRTSDDVEQYLRLNLLAIVPKEADGTHSAFKEAYQTLRTSLLFSRKS
RGANTVLITSAGPQEGKSCTTVNVARTLATAGEKVIIVDCDLRRPAIHTRLNLGRDGGVTNYILSSEGDDWRSYIKNTDM
PNLYAMTCGPIPPNPADVFGHERFLSLLKELRAEFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIRRCVT
NVRRINPNVIGAVLNSVDLERSHYKDYYYVGYYYYGESSSSKKGRKRRSSSIAAVTTPDTEDQDRVTRIVG
>gnl|bykdb|A0A1Q7VA32 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_4_57_11] (length=799 residues).
MDDQNQVELYSRGHRLDRRGPGALDGRVLELPDSYEILEPGEALDLRSYGRILRKRLPTILVVFFILFTGILIATLKQKP
VYRAQVLLEIQKENPDIPTIKEMYELDAVSDAYLRTQYSILASESLARRVIDQLQLETLPEFNSPKWWQFWPRNKKSPAP
QTFAIGPVPETRDRELSQRVLERFQDRLTIDPVNRSRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDDLQSYARRNGLVFLETDKGASQNVANERLQQLQEQLTRAQSERYEKEALYRLVQTGEFGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQVDEIESSLREERQRAADRIANDYSAAVRREDLVHQAVDG
QQKQVSLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPFKPRTLLNLSVAVFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVPASNGDHLGIHRFLPRDKSLSLAGNGNGSGKDRRPSWHLIDRD
GTQHAALGEAFRSLRTSVLLSTPDRPPSSLLITSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRT
LGLVSYLTGQQDWRAAVHPSGSRGLDLLVSGPVPPNPSELLSSQSMGALIRSASAEYGFVILDSSPMLALADSRILAPLV
NGVLLVVRSGATPREQLLHAQAGIRGVGGNLIGVVLNSVDIRTNGYYSYGPYGPNAGSPPQETFVPANFQMPPQQKASD
>gnl|bykdb|A0A1Q7Y6W9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=814 residues).
MKESRELITRVKEANELEVAGETFSPSPSAYKGYDSAAEDEVHLLDYWRSIRKRLWLVISITVLMTTLAAIYMARKPDIY
TAQARVQVDLENINPALGTNRNGVNINYRISDPAYFNTQLQILNSPGLLRRVVKTLDLEHNQAFVHPQSQSNRSTWQSIL
QMIGLSRSSTQEQNQQASQDIPLTTNVASAVASEDLAEAKRLQPYVSMLQGGLKVDPVKETRLLIKETRLIDISFTHQDP
QVAAKIINALADTFVLSNQEKRNESNNTTGGYLQRRIADLQGEIRSDEERLINYANQHQILSLDPGQNTVVERLAGLNRQ
LLEAENQRKLAQAVYEASLQPGASEARAEDANKQIQQYEANLVELRRKRAELLVENTEEHPDVQQVEQQIAEIERQLKEA
KSHAANILTTNLKTNYLQAKAQEDSLRDAFNKQRSETLVQNEAAVNYNIIKQGIETNKQLLDGLLQQERTNDVVGEGTPN
NIHIVDYALVPDGPVGPNRTRVVMLALVLSFGFGIGFALFLDYLDDTVRTADDVEKVLRLPALGVIPSIEGKTRRKLLPS
VGSLQIRNGKGGINQPELIFSTDGRSSLAEAYRQLRTSVLLSTAGRAPKSLLVTSSQPAEGKTTTATNIAISLAQTGASV
LIIDADMRRPRLHTIFETENRKGLSTYLSSDMSDAELLDMIEQHGASGLHYLTSGPVPPNPAELLGSEQMRKLLSCIEKT
FTHVIIDSPPIASFTDGVLISTIVDGVLLVVHGGKSSRHVVRRARQVLQDVGAKIFGIVLNNVNISSHDHYYYQRYYQQS
YYDSENKVAPEAQG
>gnl|bykdb|A0A1Q7YFI6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=811 residues).
MEKETQLVKASVEPRVVELQANGNGAGLPYGSYAYGSSEPQEESGFSRLQAYWQSVRKHLWLIIGIVVLITMIAAVYMAR
QADIYEAKSRVQVDLEVNNPGIGAMKNTSYILEQQYQDPTYFNTQIQILSSPGLLSRVVKTLDLEHNQAFLNPQAAQSRS
TWENLKRMFGFGRPANNQQSVPQNMMPLVDSSLAPATIEGDIAEVNRLAPYVGMLQGGLSIKEITDTRLIEIHYTHPDPQ
VAAKIVNSIADTYIISNLEQKTKNTNSAADFLQRRIAEIQSEIRNGEERLINYAKNNQILSLDGSQNTVVERLAGLNRQL
LEAENERKLAEAAYRAAQAPGAAEALARENRNKQAEEQLLELRKKRAELLVENTEDWPEVKEIDRQIAILEAQVNQSHSE
DVSTLKTNLETRYHQALAREESLRQAFDQQRAQTLTQNEAAVNYRIIQQEVETNKQLLDGLLQTAKGNDVVMSGTPNNVH
VLDYAPIPKSPVGPRRMQGVALGFLFSLVIGIALARYLDYLDDTLHSAAEVDEMLRLPTLAVIPAVGNASRRFLPKMTAL
QKSDNGDHGSLLEPDTRSPMAEAYRQLRTSVLLSSAGGAPQALLVTSGVPSEGKTTTALNMAQIMAQTGATVLLIDADMR
RPMLHTLMNLDNARGLSTILSTDMSAAEMLSLIEQQAGSGLYLLSSGPVPPNPSELIGSEQMQRLLATMRTSFTHIVIDS
PPIASFTDGVLMSTMVDGVLLVVQGGKSSRIVVQRAKQYLQDVGAKIFGVVLNNVKLERQDYYHRYYYKNHYYSKHRDEE
EISSDVSTINQ
>gnl|bykdb|A0A1Q7YKQ8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_3_53_8] (length=796 residues).
MVSQDNRLLPLPQERGLDRPLSSLPHSKSYGYGAAAESTHLRDYLNVVLKRKWLILTLMLVVTSLVAIQMYRLPPIYQAE
ATIQIEPKHDSILKAGNNVVINTGGGDDAQYWNTQIKLLESQQLARQVALTLDLQNNSAFLGNQSQHGLFTALRRIFSSE
RTTNASPATRTNLPVISPERVTEQQLTPEQLTRLEPYEDALAGNLTVEPVMTTNLVMLKFTHSDPVLAQKIVNTFADTFA
YNNFERETQGTAKATELLAQKIAELQLEIRRQDEERVNYIKLKNLPPSKSPGADLAADRLAQLSKQLLEAENNRKNLQSL
YEAAAHQSNPMAVPDVADSKRIQQLREKLDQLKQKRSELLVIYTVEWPEVKRVDEQIKTIEEALTKAPGEVLATMKSKYD
AAVTTENSLRASYNQQHSEFSQQTQDQIQLTMIEQEIETNRQYLTTLLQRQRELENEQTGRMQTNNVSVSQYSREPRAPV
GPPRLRNILIAFLLSLGAGIGLAFLLDYLDDTLKSVEDVDRYLHLPALALIPSTRSEQRLRLKGGAQAEHGESTALALVA
DARSSIAEAYRHLRTSILLSSAGQPPKTILVTSSQPSEGKTTTAVNTAVMMAQTGADVLIVDCDLRRPRLHAQFNIPNAR
GVTNYLSGEAGLDELIRSYDKLPNLKLMTSGPVPPNPAELLGSDEMRKLLSELSERFTHVIIDSPPAISFTDASILSTLV
DGVILVVHGGKSSRAVIRRAKQQLLDVGAHIFGVVLNNVKLESTDYYYYAGYYSSYYNSDDEPDVEAASAGESRTS
>gnl|bykdb|A0A1Q7ZJT1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_68_7] (length=718 residues).
MPDSLNPLEEKREIHLLDYWRTIWRGRWTILSIFVVVFTLVAIGTFTQKPVYRASVTVEITPQSRKVSPVAEVAETGMAQ
YGWYAEERYFNTQYEIIKSRDVARRVFDRLDLYNHPLFKKSVDSIGEFSQMIVVAPVKETGIVEISMEGLNPEEVASWVN
TISEVYVERNLDQVVEATSRAVKALLSEIAPLKEKLEDTQRTSFEFAEKANLYVPENQQKITNDRLSTLQSELTEAQVKK
GEIEGLLKQIDANRQNGGAYENIPQISGDTVVRDLYREKAGLEREYERLLVTYKDKHVRVLEKQKEIEETTQKIASEVDR
IINGLRSQYDLLKDREAKLIKATDETRTESLQVNRKASGYEMVRGEATETKRIYDLISARVKEIDLSSSLLSNNLRILDK
APVPKVPVRPRTVLNLAIGMLLGILLGVGAIFFLDYMDNTVRTSDDVEQYLRLNLLAIVPKEADGTHSAFKEAYQTLRTS
LLFSRKSRGANTVLITSAGPQEGKSCTTVNVARTLATAGEKVIIVDCDLRRPAIHTRLNLGRDGGVTNYILSSEGDDWRS
YIKNTDMPNLYAMTCGPIPPNPADVFGHERFLSLLKELRAEFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKE
LIRRCVTNVRRINPNVIGAVLNSVDLERSHYKDYYYVGYYYYGESSSSKKGRKRRSSSIAAVTTPDTEDQDRVTRIVG
>gnl|bykdb|A0A1Q8B793 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 13_1_20CM_2_60_10] (length=780 residues).
MEENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPHEPHLYDYLLILRKHQWLILTFLLTVVTIVSIATFRMKSVYVAPA
RIEVDRENANFLPFQPADPYAYLLDQENYIETQSKILTSETLALQTIRSVGLAGHPDFSEGGKPSEAVTTGSLANQNRPP
ELAAFLGSLTVKRVPNSTLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLAGQLNELKIRVEKSEDAR
IAYERQNQIWTIDDKQSITTQRLGEINKELTEAQSDRMKKEALYQLAQSGSLDALPAVRDSELLQDIYKKRNDAYTQYTS
ALNQFGPNFPRVQRLQEQLKEFDGLIDAEKKNIVTSIENEYRAARQRELLLLKALDQQKAEANQMAERLVQYNILKREAE
ANKALYEGLLTKLKEAGISAGLRSSNIRVVDPAMIPSSPARPAKMRNISLAFLVGLVGGIGLALLREYMDNTVKTPDDVE
MLARLPSLAVVPAFIDTNGRNGRRRFLRGLAAATNGREARVELVSHHLPKSQMSEAFRALRTALLLSQADHPPQVILVTS
ALPREGKTTAAANLAVTLAQLGDKTLLIDADLRKPGVGRALSLGEGKYAGLSSYLAGVSSLDLVTVPHPAIENLAAIPTG
PLPPNPADLLSSHRITDAIAELRAKYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDLLTSVKCRL
IGVVLNAVDSTAPDYYYSYRCYPYSYGYGEPQAGELPASTEQDAISRRRPPEHEDDTQAL
>gnl|bykdb|A0A1V6HR88 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium ADurb.Bin051] (length=742 residues).
MKVFTARWRLIALTTLLAIAGGVLAYLVTPKEYRATTTILIERRLSIPVQSAVEAAWENYYSMEFYPTQYRLLQSRGLAE
RTVQNLRLDQDPAFNPARASLAGSDEGGSAAADQSALARLAGRLLGGLEVKPVGQTQMVDISYRSTDPALAARIANGVAE
TYIDWGIESRSNLAGKTSVFLGAQIETLKQEIQDKENQALAYSKRADIVTLDTGGNVVLSRLQALNADYTRAVSERIGKG
AALKELEVATPQIAAEILPDPVVAQLRGEVVEMEREYASRLATFKPEWPAMVELKGRIDQARGNLIPAAREALAKAREAA
RAEYQGAQRREAALAAEINSLKVENREVNSASIEYNNLRLEIDTRRQLLDEMLRKQSETDVSSRLQATRESNVRIVDRAL
VPGGPFRPSLRRNVTFAGGAGLVLGFGLVLLLHYMDRTLKSSEEVERLFGVPVLAVIPDVGAGGKGYGLRGRYGYGYGYG
YGYGEKPAKARARKPGKGGGNGEPTQIELLPHLRPRMPVAEAYRALRTALLLSTASELKVIVITSSIPGEGKTSTASNLA
IVLAQLGKNVLLIDGDLRKSRLHELFGMSNRAGLVSYLTGQVPPEQIVLRTDIPNLYAIPAGPSPPNPSELLSSERMRDL
VRQLRLRFDYVVIDSAPTLAVTDATILGSIADGVVLTACAGRVQRQEAKACRDRLQVAEVKVLGAVFNRFRVGGGPYRKG
YAAYQTYAGYGEERSGGEVAAR
>gnl|bykdb|A0A239HDF6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella rosea] (length=731 residues).
MPGSIPQAADASLADALLTLRKRRWVLIVAFVLGAAFGLYRAFFQPRIFEAYGRIQVRTGSADQYKLTSPVGLGQDTMTQ
MMTETAILQSDTLLLTVAKDLDLCNNPAFLGRKTAPEPRRDLNDPQVRQGTLLVLSSNLKIAMQPRTNILRLSYSSLDGK
LSAEIVNTVISEYIQRSYETRFASTQRVSKWLSKQLEDLKADVEASQEKMINLQRRLGILGFDPTHNQISTSLDDLAKAS
GQAKLARIIAESRYRMLSGMEPDAIEGSIDAGPGLPPSGLNALRTQLSTARSTYAEQEATLGPNHPQAKSTKAQIDELAR
QVAAEQNRLLLQSKENYLIAQANEEKTNAALDAQKADAYKLRDDLVEYTLRQREFESNRTLYEGLLQRLRTAGIQAGLES
LEIDIVDQAVPPASPMLRPKSTLVLTTLAVAMILGVLIAFLLDTLDTGIRSVTELEAITEMPSLAVIPRLRKPAGAAVPD
TSPLPVISQPKSQFTESFRALRTALLLSTAGREPKLLMFTSAAPGEGKTTTSINLAAILAQRGARVLLIDADLRRPAVHV
RLGLEGRLGLSTYLSGSSTLEESLQHLDELPSLDILTSGPVPPFPTELVSSTAMRELLRYAGEIYTHVVIDSPPILSVTD
GVELGGMVDAVILVLRHGKSNKHVVRRARDLLVRSNCPLKGIVLNAVDLSAPEYESYYGYSGDGYANLDNGWSASFRGKN
GRKNRTKGDQA
>gnl|bykdb|A0A239MKT6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella rosea] (length=764 residues).
MAFDNNDASIASDLNDAEQGSSDLTLESVWEFLRRRKIWIALGIVLGFLSGLAVYLHTPPLYTATAIVELNKDSSSGLGL
QELSGLSDSLSGGMELNTDMLTHQRILQNDNTALSVISSLNLMQEPPYNEIPKGKLHDVYERERSLPLKDAPYTRDRVLA
IFHKGLQVEVLKSTRLLAVSYTDTDRNRASKIANYVVQAYLQDNTENRYQATSMASTWLTTQLEDLKRKIEENHRQVAAF
QQKSGIVSEGMSAPAPSAGGGARGNIGAMAPSVDSTAFQRLSALNEELTRAEVARIQREALYHIIQTNDVDLVLNSASSL
GAGLAGGNEMRVLGTLREQASAIKIRMASESVKFGSQYPAVLELQNQLNSIDAQVHEQMVRLNSETRSSYLLAKADEDGI
RKRATDQRQQVLELGNSLTALTFLQQEENTSRGLYQDLYTRLQEASISAGVRSTDMVIVDPARPPSLNSSPNASRLLATG
TAAGLLLGLLIGIALHLRDRFLYTIEDFQAAWSAPVIGVVPHFVENGQSKNVPASPDKQEDAAWLIRAPKSKSAESYRQI
RTAILFSRIDDPPKVILFTSGISGEGKSTTAYNMAVAFALQTKRVLLIDADMRRPTIRERVNLQQGRGLSDLLSLNLELD
EVLQQHPNQDNLFIIEAGTIPPMPAELLGSKRFLAILEKARKEFDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRSGRST
KQVVRATASMLRQYSGRLLGYVVNDVESNQTAYGYGYGYDAYYQ
>gnl|bykdb|A0A257VBK0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium 37-65-4] (length=717 residues).
MADSDPPQVQAEFSAAQDVDLLHWVQILWDQRFWIAGVTAAVVILVALYTFLATPIYSATATVYVQTYSRQPMSGFNPTG
ASSWMEEQKFYNSQQQIMTSSVVMQDVVDKLKLQSHEAFKDVKDPAAMLRGMTKVDNIRDSALFRITVMAPYKADVAIWA
NAIAEAYQDRMLKDALDFIAKANEVMLAEAKKMQDQYARQQTTMTTSLAASGSYFPQNQKEILDTKIASINERLTQVGVK
ESEVAAIASQLEAWRTSGGDPLSIPAVAQDPSVQDLAKQYNELNRDLGKLQAKFTPKHPEVLKKQEEIRGLKERISQQAE
TVLGSYRNQLSALRGERANLAQEVDGARREGLQFVEGLSRGEGLNTSSAAIKKYMDLLYDKMSELNVSSSLMSSNVRMVE
PAQPPMAPVKPNKRMNLLMGLLFGLMLSVGSIVAWQYLDTSVKSVEDLETRMGVALLTMVPKFEPETQKVSAEAFQTLRT
AMVFATDNHQNNAILVTSASPKEGKTSVSANLAKTLAAGGDRVLLMDCDLRRPSIHRILKAPAGVRGLTNYLAERTAQIE
DFVVPGPQPNLFVLYSGPTPPNPPELFSMKRFRDLIERFKGEYSWVIMDSPPCLSISDAFILGGMADRTILVARYKKTRK
PLLERILVTLARAHVQVAGVVLNEVETHSSYYYDYYYYNHYYYATGTEPKRLPWILGKSGGWKDVFKGKKNRREYPE
>gnl|bykdb|A0A2G6PYV5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=757 residues).
MQDNQPFDQQADFNIFHYIGLLRKHFFLTLSLLILGLGLAYLAWLVKPPLYKSSVLIKMNHLSMDVIGFTEKLQWNPYRE
EYFKTEFRIIKSLPVAEEVARTLGVKYFREQEQEDAQPKNLLDLGTVNEPREKTQKTKEDQAKEITKIASNLIGGVEIKE
VKDTNLVRISYTDTNPERAMILANTWVKAYIAHSLNMTYDKNLEAYNFLEEKSNEYRQRIMELYSQLGEQQKNSEDLIVG
RAKSAVEEQALVKLNEEIAVANRSFIEKRNNLQALQASTPSQAIEVNQNVAIKDLSSQISRKKLEYEANLSKYKPQLPKM
VALNAEIKSMEKRLANEQKKLYNRLIQSISKDVQDRKNELAYLEAQRKKQNQKIVLADLKTKEQNASLDSKIQVLEQNSL
VIDKRKEYLELALGLKEIGRTDKVIVEHARLPHSPYAPSLKRHLFSGFIIAAGLAGLLIFLIEITDRKIHNTEVLEMVTV
LPTLATIPKVSGFNKGKITKNKVKQKAMATKLRQEIGLLTHLKPNDAFSESYRHLRTNIQLSKTTDNKVLLLSSALSGEG
KTVSSLNLAISFAQLEKKTLIIDCDLRRPKLHKIFNLPNAKGLVTSLVKGKSPIDFIQSTKIPHLFLLSSGPLPPNPAEL
VASQKMREVLTELKANFDFIIIDTAPLLAVTDASILGNIVDSLIFVTKASATSRDEVARALHMLSQNKIKPLGTLFNDYD
FTKGKKYYGYKYGYRYKYGYGYGYVPYSYNTPDDPTG
>gnl|bykdb|A0A2N9LQU7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacteres bacterium SbA2] (length=749 residues).
MQNIPEQQLARVTARGRISGPVPLPPALRNPDVSLGEIWLKIWKRRVAASLFASGIFLAVILYTFLKKPVYESVAQIRVD
SSQQGSLGLEDLVSQKLADSDSEGGRLQTELTILQCPPVSMQVIKNLDLGHREEFAGKTLMASVTAIDPVKMDPLSREKL
LLKFHDAEKLEVLPKTRVIEIRFQNVNPKLASDVVNGIVDAYLQRNFDVKYQGAVQVSEWLSKQMEELKLNAARAEQRLA
EFQKQNNILGTDENNNIVIDRLRHLNSQLADAEGDRIIKEARYRLASTGNPELVAAVVPSTTLQALRMQEADLKSQYAQL
DAKFGSGFPRVQELQAQLARLDQNIADELTNVGQRLHDEFLAAQNSESLLRDQFEHQRQEAFNLNASAVQFATLKHEVES
SQELSDTLQLKLKEAGLMAGLASADISIVSRGMVAARPAFPKKSLMLPLGFLISVFGGLVFVFVLESFDDSLRTSEEVEA
ASSIPALATIPLITRRSLRKDMRGRNHQPGLGGLGTMAVQRPASLLAESYRVLCNSLLLTAADRPPQLLVVTSAFPSEGK
SVSSCNLAITLAQRGSRVLLVDADLRRSTLLRQLGLEAGTSAGLSSMISGNDASEAVRKPFPQLPTLEVIAAGPQTPWPA
ELLASKKMGDLLEQWRTEYDHVVVDTTPLLFFADTMPLAAKADGVLLVVLAGRSRRKAMIRTLDLLARAKAHVLGMIVNG
VALEPEYVNSYVTYGYSKGYGDIDAKRSA
>gnl|bykdb|A0A2N9M9N1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacteres bacterium SbA2] (length=759 residues).
MAENDKLIPVSAVSSDRLGYSGYPVTDLDPAGSEAYSFQSYWEILRKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATARM
EVQAETPALQTLNELGPSGATDAAFLQTQVDLLQNNNLSWQTMQELGLANGNTELGVGGDLWPVSTSRSTVATPANLIRS
FKKHLHIELLTESRLVEVSFESVDSNLAARVANTLVKNYVEANFRSKYETTRQASAWMEQQLDELKAKVEKAQQALVDYE
REYSITNLGDKENVVQQRLAQLSTDLTAAQVERANKQSVYDSARHNNAEAAVLAEDALLGQLESKNAELHTEYAAATSQY
GPNFYKVKQLGNQINEVEELIDRERKRIMERIESDYRTAVRREQLLSQDVSAQRTEVEKLNQLLIKYTILKGDFETNQQL
YDELLKRLKDATVSVSLRATSVRLADAALVPATPIRPDKRVDIAVGLLVGLILGVTLAFIREGLDRTVKTAEDIENQIAI
PTLAVIPLGTRSRGRYGRYFARGALKPPGNGSPGLAIMNAPGSEMAESFRVLRTSILLSSSPQPPQVLLVTSAHPSEGKT
FASVNLALALAQRGGRVLLVDGDLRKPTVLRALGMGNGESEANGLSSYLAGGQGIDSALMSFTALPNLSVLPSGPVPANP
AELVSSPAMGRLVSELRQRFEHIVLDSPPLLLVTDGVLLSTLADGVVLVVESGSTSRGALHRVRQILDRAGAKTLGAVLN
KLDDRVDGYYTSRYKYYGYYYSQEPSASKTPDLYSAGDR
>gnl|bykdb|A0A2N9MK30 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfopaludibacter sp. SbA3] (length=740 residues).
MNTSLQELTIVEERGPRSLPVAAGFGPAQPASWDLEPEEQTLPLSHYLWVLRRHRWKILSFIGVSAIATLIVSARLTPMY
EATVTVDVDRKVPTAVVGQDSTQTGLNDADQFLATQIKLIQSDAVLRPVADQYHLRDLERKARAGSDQGLLIDAPVLLKQ
LKVTRPVNTYLLLISYRSPDRRLAADVANAIARSFVEHTYDIRFRSSASLSTFMEKQLEELRAKMERSDTALAQFEKELN
VINPEEKTNILSARLLQLNTDYTNAETERVKKEAAYKSVSTGSLESAQASTQGDALKTIAERLEQAQEKFAEVKTHYGPN
HPEFHKAQTQLDQVQAQFDATRGSVMRRVEVEFREGVNREEMLKKAVTETKAEFDRLNARSFEYESLKHEAEADKKLYEE
LITKIREAEINAGFQSNTVRIADNARPGLSPVFPNVPLNVGLALLFAAILAVGAAVLSDTLDNTIRNTEQVARIVKAEVI
GGLPQVKSWKSRPALVAAGGAASTPVLLRHPDDDRLLAGFGEAVRTLRNSILLSSFDRQIKSLMVTSATPGEGKSTVCVH
LAMAHAQQNHRTLLIDCDLRRPSVHRRLGLTSETGLSAVLLHGLAWRDCVMQAPGVPNLDVLPAGPTSRRASDLIGRALP
QILEEAAGDYDLVMVDSPPALGFPEPLQMATAVDGVALIALAGQTDRKALASVVSMLQRLRANVVGVALNEVTKDIGDSY
YYHGYYGKYARYYNHKTETA
>gnl|bykdb|A0A2P6WFK7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=750 residues).
MRPAACQESHMPEIEQDSLATMRESGLKRFGNDSVTERELSVTEISRTIFKHKLLILLTALTVFGIITLRTLTMTPVYES
AVRLQVDPSRSSSLGLDEMISQKLGGSDDINSVLQTEVKVIQSDTVAMRVIDSLELAKRPAFAGKYAASAKLTNPSAMPP
ADRQRLVSAFKQSLSVRVLPNTQIVEVLFRCTDPKLATDVANAVVEKYMQHTLQTRYEGTVQVSNWLSKQMDDLQTRATQ
SQQRLSEFQMKNNMIGADENDNITVDRLKLLNQQLTEAEADRIVKEARHRLAATRNPELLGTVDPNLQTLRTQEADLKAQ
LAQVSAKYGNGYPKLRELQTQLSKLNAAIADEVANVGRRMETEYQSAAKTEAALRNQFNKQKEEAFKLNEHAVQYLVLKH
DVENSRDLYDTLQLKLKMAGVTAGLSSGYISIIDRAEIPATPVEPRIKRNLALGLFGGVIAGLLLAFGVEALDDTLSNSE
ELETCLALPVLCTIPTHQQQPPATSNSREAPKAVPLAPILLGSPRSQAAEAFRGLRTSLLLSSPDHEPKIITVVSSVPAE
GKTTVSVNLASAFAQRGESVLLIDADLRRSTTHTHFGLPYSRYGTSTVLTRGMDERAIVTPLKSLPSLKLMPAGPHPPNP
AELLGSKRMIELLESLSGEYERIIIDTPPVLSVADSLALSNIADAVVLVVRSRIARKRAVLRVRNLLRRSNANLVGIVFN
GVDMLLEQYYYAKGSYYGKSMGNYYLSEDE
>gnl|bykdb|A0A2U3JZ71 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfopaludibacter sp. SbA4] (length=749 residues).
MVGDKEMVENNLTPALPAPLEALPGRNLPVPMEVYRTSNLMPEVEAAPSSVPLSHYLWILRRNWWKMLLFVSCAVAATLM
VSARLIPVYESTSTIDIDRQMPSAIIGQESTRTVANDSDQFLATQAKLIQSDSVLRPVAQQYRLLDTEAEGSDATLSRVP
GAEDAPVLLKNLKVSRPPNTYLLLISYRSTDPRLAADVANGVARSYLEHTYNIRFKSSASLSAFMEKQLEELKAKMERSS
GALVQFERELNVISPEEKTSILSARLLQLNTEYTNAQADRVRKEAAYKSVAGGSLEAAQVSTQGEALKRLSERLDEEQQK
FAEIKAHYGPNHPEYRKASLQLAELERQLQSGKENIGQRVEVEYREALNRESMLRKTVSETKAEFDALNARSFEYQSLKR
EAEADKTLYEELVRKIREASINSGFQNSAIRIADLARPAFKAVFPNIKLNVLLAFLLSTLLAIGTAICADLLNNAVRDPE
QVARTLSTEVIGTLPSVKEWHGRITAASEPGTDLIPHDPSRGTSLNSFQEAIRTLRNSILLTDFDRRIRSLMITSSGPAE
GKSTTAAHLALAHAQQGRKTLLIDGDLRRPSIHRRFEVPSTRGLSNVLTSGIPWRTVLVRPDGHPNLDILPAGPPSRRAA
DLVGAELTTLLEDACGDYDLVVLDSPPLLGFPEPLQMAASVDGVLMVALAGQTNRKALGSAVNTLKRLRANTVGVVLNDV
RADSSDNYYYYHYHPKYYKHYSVEAENEI
>gnl|bykdb|A0A2U3KC61 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Candidatus Sulfotelmatobacter kueseliae] (length=755 residues).
MPLQPKRNNSDALEALEPIDPLPVKGPQSVYPHFAQPQNSILHYWQILRKRKWAVLATFAIVFALSVIKTLRETRLYQAT
SKVAIFEENPNVLGFKDVENNLPDFDYQATLETQAAILRSDVLALKVIKAMHLDPNPQAEDAMQPDPAREAGLLGAFRGG
LSVQIIPNSRLVQISYTHPNPRLAEAIVNKLVDTFKEENTNAKYESVNETSEWLKAKLDDLRRKVQTSEEILVRYQKDHS
ILGVDEKQNIVTAKLNELNNELTVAQTDRIQKESNYNLAMAGDPAEFAKPSREGTSSMLEKLREKEADLNTQYAQATTQF
GSGYPKVVELKNQLKQVRTEIVAEETRMQHGVRDEYLAAVQRENLLTTAFNQQTQQANQLNESAIEYSVLKRDAEANRQL
YQDLLQRFSEASVSETLKSSNIRVVDFARTPTSPITPNVPRNIELGLLLGLACGIGLAFVLESLDTSIRNMEELSAISTL
PALGTIPLQLSSNGYLRKRLKTVSAETEKPESPALVAYARPKSEAAEAYRALRTSILLSSFGAPPKVILVTSAMPQEGKT
TVSANSALVLAQRGSRVLLVDADLRRPSIAKLFGFQSRGGLSTLISGSDKVEDVVIPCPEVPNLWVLPAGPIPPQPAELL
GSAVMKDHIAHWRNVFDHVIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTKAALRRACDLLLQVNARVMGIVLNALNR
HSIEEYYQYGGRYANHYYHEESPEDKPTAAASKVS
>gnl|bykdb|A0A2V2R0I6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MADEHKLVRRESGSNVPVEIVPPANRLPAWELSPREPHLYDYLLVLRKHQWLILSFMLAVVTIVAIATFRMQPVYTATAR
IEIDRENSNILPFQGPEAYDFYSDSESYIETQSKILTSETLALQTIRNSGLSARPEFSTPTGPSEAVAIGTLANQKRPPE
LGEFLGSLSVKRVPNSRLMDVSFESTDPQLGARIVNAHINNFIEQNFRSRFEATSQASSWLTDQLSELKVKVQKSEDARI
AYERQNQIWTLDDKQNIATQRLGDVNRELTQAQSERMKREALFEFAKAGNLDAVPQMQNNSFLNELIRKRNELNAEYNDA
VSQYGPNFPRVQRLQAQLKDLDATIEKEKQNILNGLEADYREARQHENLLMRELEDQKAQANAMAEKLVEYNILKREAEA
NKTLYDGLMNKLKEVGIAESLKSSNIRVVDPAMIPSYPSRPAKARNLALAFLVGLVGGVGLALLREYLDNTVKSPDDVEN
LARLPSLAVVPHFTGSNGNGKRRALLQTVAANGHEKRIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVVVDADLRKPGVGRLLNLSNNKYAGLSSYLAGASSLDLVTVPHPAIPNLAAIPTGPLP
PNPADLLSSHKLSDAIAELRTKYKFVVIDSPPVMAATDAVIVSVQTDGVLLVVRSGETPKEAFTRTRDLLSSVKCRLLGV
VLNAVDSSAPDYYYSYRYYPYSYGYGPQEAMGGPHDEDSEPPEERPFRDGDEDSQVL
>gnl|bykdb|A0A2V2R525 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGERQDQSQASLAFYVQIIRKHFLMIIALTALCTLTTAVYMARKPDVYGAA
VRVQIDVESNPASGINGKPVVINNSASAPDYFETQLEILKGSGLLRRVVKTLDLEHNKAFFRPQMGQRTTWQRLLDMVGM
GRDSGDSSQPVDDGVLMTSSVAPATDKEDLAEIKRLNPFVGAIQSGLEVEQVGKTRLVEIRYTHRDPHVAAKVVNAIADT
FVQANLEKMTETNSGAGAFLKKRIYELQEQIKNGEERLINYAKDNQIISLEPSQNTVVERLNSLNRSLLTAENDRTLAEA
AYRAALEPGAAEALAASNQSTAAAKLSDLRQRLAQLKAEYTDKWPEIKVVQEQIAEIEKQDVENKTNSKSLAVKGLETKF
REAQRREQEIRDAFEKARSETITQNSAAVNYRILQQEIQTNQELLNGLWQRYKENDVILAGTPNNIRVADYANTPERPIG
PQRTRGVGLAFAFSLAFGIGLALLRELSNNTVRTMSDVTRSIRLPTIAVVPTVKSWPASKLLPSRKLFLQPRNGNKNGRP
LIMYDDAHSRLAEVYRKLRTTVLLSRPGKTPKTLLVTSSMPAEGKTTTAVNMATILAQTGASVLIIDADMRQPTLHEIFQ
LDNSHGLSTLLAGKNNQAEMLSLIHQHEETGLYVLPAGPPPIKPAELLSSGQMRRLLEITSPSFTHVVIDSTPVVSFTDS
VLIANLVDGVILVVQGGKSPKEIVQLSRKELMDVGANIFGVVLNNVDVTAQDGYYYYRPTA
>gnl|bykdb|A0A2V7U3M2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=734 residues).
MEGTSPVTPTPPTSSESEAQETHLWEYIYIVLRRRRLVLAVFVAVTALATLRALLTRPVYEASAQILIERDTPNVLTFKE
VAQVDAARDDYYQTQYKLLQSRLLARRVIETMNLLQDPEFGGPRSPEEMEAVKAAAPGASPVMERAIDSFLRKLRVLPVK
NSRLVLVAYESYVPEMAAAAANWLSQLYIKQTLEFRYETSSEAAQWLGQQIEEQKAKVEAADLALQKVKEQEGIVNIEER
RTLLEQKLKELGTALTTLRTDRLEKEALYNQMRNAANPEELPDVMRSPLVQALRIELATLERSQAQLLERYMDQHPEVVK
VRNQIQETRKKIAAESQRVIRAAENDYKAAAAQEASVSSALEAAKAEALDLSRRSVQYDNAKREADAGKEVLNSLLSRHK
QTDVAQELKNSNIRIVDAASVPRSPVRPQKTRDIAMGVALGLFLGIGLAFFLDYLDNTIKTPEDVRKQLGAPLLAVIPEI
SVPGDIVIIQGGVESPLADGYRLLRTSLTYSWPESSPRILLVTSTSAGEGKTVTSVNLALILASLGGKVLLIDCDLRRPQ
SNTLLHAKRSPGLSDLLVGRARPSEAIQRPAGTTLSLLAAGTRAPSPADLMTLQTMRDFLEGLRGFYDWIVLDTPPVGPV
AEALILAPLTDGVVVVVGAEMVPRNGVRHTLERVHETGARLLGVVLNRAQVEKHSYYYGRYYGHYYGRYYGAPAPRPAVA
RGKVAHIREKRSAR
>gnl|bykdb|A0A2V7UGP8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MDVLSQKEINLVDYWNVLKRRRWVVFTAVVVLVITVTLGSFLIPPSYQAICTLQIEREQPNVLTFQQVQPVGYDYMSYND
FYQTQYRLLASHNVARKAMLKLDLRNDPVVNRLVNRVRHKGPFTRLAEIVRHSPLDEIPEDPDKPYIQFVLSGLDINPLK
NTHLVEISFVSVDPELSSRIANAVANSYMEFNQSARYDTSAQASEFIGTQTTELKKQVSDLEAKLNQYGKENEIIGLDDK
ENITNQKLGQLNQDVLEAQVESSRKEARYRGLLTTPPGSIKEVTQSNLIQQLRQKTAELEREYTQKSKQFKPDWPDMVRL
QAEWDSARKTMAEESQKIFDDTLKTAKMEYEEASAHEKTVRGALEGQKSEAIKQKQYGVEYSNLKAAVDSKREILNKLMQ
RETETGSLSQLKNAGTGNVWVVDAAEIPDRIFRPNKKMNILLSLFVGLALGVGMAFFLEYLDNSIKSTSDVEKYVQLPTL
GTIPMVVSSALAGESAGGRRLRREPVSPAVDLVTLRDPASPASEAYKTLRTSLLLSTADAPPKIIVVTSSEPQEGKTVTT
LNTAISLTQSGKKVLLVDGDMRRPRLHKALGSGNGHGLSSYLSGNAELDPIIQETEIPNLFLVSSGPVPPNPSELLASEH
FDFLLAALKSSARFDHVLIDSPPLLSVADPVIMASKAGATILVVQCGRTSRPAVIRGRQKLTQAKANILGVVLNDVDVRH
GEYYSYHYGYRYRAYRYESGPDRSEATGPAPPPAV
>gnl|bykdb|A0A2V7UHT0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=741 residues).
MWPRRTVLSKELSSVTPIPPAGSEGEPQEAHLWEYIYVVLRRRRLVLAIFLGVAALATLRALLTRPVYEASAQILIERDT
PNVLTFKEVAQVDAARDDYYQTQYKLLQSRALARRVIESMNLLQDAEYGGPRSPEEIEAVKAAAPGASQLMEGAIDAFLR
RLRVLPVRNSRLVTVTYESYRPDMAAAAANRLSQLYIQQTLEFRYQTSSEAAQWLGQQIEEQKTKVEEADRALQKVKEQE
GIVNIEERRTLLDQKLKELGTALTTLRTERLEKEALYRQMRGASNPEELPEVMRNPLVQSVRIELASLERAQAQLLERYM
DQHPEVVKVRNQIQETRKKIAAESQRVIRAAENDYKAAAAQEASVSSALEAAKEEALDLSRRSVQYDNAKREADAGKEVL
NSLLSRHKQTDVAQELKNSNIRIVDGASVPRGPVRPQKTRDIAMGLALGLFLGIGLAFFLDYLDNTIKTPEDVRKQLGAP
LLAVIPEIGSPTDVVIKSGAETPLADGYRLLRTSLTYSWPDSSSRILLVTSTSPGEGKTVTSVNLALILASMGGKVLLID
CDLRRPQSHTLLRGKKSPGLSDLLVGKARPSEAIQRPSGTTLSLLAAGTRAPSPADLMTLQTMRDFLEGLRGFYDWIVLD
TPPVGPVAEALILGPLTDGVVVVVGAEMVPRNGVRHTLERVKETGARLLGVVLNRAQVEKHSYYYGRYYGHYYGRYYGSP
PAQTAPARGKVANIREKRNAR
>gnl|bykdb|A0A2V7V2I1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=725 residues).
MSTTAPAGQAGVPEETHLWEYLHVVLRRRRLVLAVFLTVAAAATVRTLLTRPVYEADVQILIERENPNVLTFKEVARVDS
ERDDYYQTQYKLLQSRALVRKVIEEMDLFQDPEFGGPQPAEQRAALKASAPGSSRVMEAAIDQFLSRVKVQPVRNSRLVL
VGFEAYRPELAAQAANKLSQLYIQQTMEFRYQTSADAGLWLGSQIEEQRHKVEQAELALQKLKEKDGIVNIEERRTLVEQ
RLRELGTSLTALKTQRIEKEALYRQMKEAPNSEELPEVMRNPLIGSLRVELASLQRQSVQLQERYLDQHPEVVKNRNQIT
ETREKIASEAQRVIRAAENDYRAAVAQEHGVADALEMAKREALELSRRGVQYDSLKRELDASKEVLNSLMARHKQTDVAQ
ELKASNIRIVDAAAVPGSPVRPNRPSDIAMGLFLGLALGVMAAFFLEYLDNSIKTPEEVRLHLGVPLLGVIPEHGQDSGS
PVLSNSHQQGPFMEGYRVLRMALSYSWPGQDSRVLVLTSTAPGEGKTLTSVNLALTLATMDGQVLLLDADLRKPQAHELL
GLKKSPGLSDILVGLADTAECVERVKGTNLSLLPSGSHAPSPAELMSPQLLRGFLHGLRAAYSWVLIDTPPVGAVADALI
LSSACDGVLIVAQAERVPRKAVLHTLERVKDTGARILGVVLNRVPMEQNAYYYSHYYSHYYGHYYDDQHPKRQDEPAPMT
KQATR
>gnl|bykdb|A0A2V7V2Z1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MAYSFGYRLRSSSRCPAPTWPPGPSRSERRRGSPAVSPSASSGYEGEPQEAHLWEYIYVILRRRRLVLAVFLGVAALATF
RSLLTRPVYEASAQILIERDTPSVLTFKEVAQVDAARDDYYQTQYKLLQSRALVRRVIESMSLLQDPEFGGPRSAEEIEA
VKAASPGASAVMERAIDEFLGKLKVVPIKSSRLVMVSYESFRPEMAAAAANGLSKLYIEQTLEFRYQTSSEAAQWLGQQI
EEQKGKVEQAERALQQVKEQEGIVNIEERRTLLDQKLKELGTSLTTLRTERLEREALYNQMRGAANPEELPEVMRSPLVQ
SLRIELAGLERQQAQLLERYMDQHPEVVKVRNQIQETRKKIAAESQRVIRAAENDYKAYAAQEASVASALEAAKAEALDL
SRRSVQYDTAKREAEAGKEVLNSLLSRHKQTDVAQELKNSNIRIVDPASVPRGPVRPRTTRDILYGVFLGLALGIGLAFF
LDYLDNTIKTPEDVRKQLAAPLLAVIPEIANPAEVIIKSGVESPLADGYRLLRTSLSYSWPEAASRILLVTSTSAGEGKT
VTSVNLALILASLGGRVLLVDCDLRRPQSHVLLRGRKSPGVSDLLVGQARPSEAIQRPAGTTLSLLASGTRAPSPADLMT
LQTMRDFLDGLRGFYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPRNGLRQTLERVRETGTRLLGVVLNRAQVE
KHSYYYGRYYGHYYGHYYSSAPSRPVAGSKVARIGDKRSAR
>gnl|bykdb|A0A2V7VMF7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=1207 residues).
MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKVTDDRGPAGSGQVEVAYRDQR
SPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDVSGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPL
PTGRERDRAPARRRPLWLVRGSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIGLPLLGDVAVTGLSASEIQRK
LTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKALRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHS
LRLQFSGASPAPKDLVNLEVPLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRYYAGLVWRSRVFIVALGLVGLGLGFV
VALLQTPQYRAGAMIQIEPPAPTFMTVTDALAGMGNYWQNADFYNTQFRVLKSKTLGSRVVERLKLDDRPPFKDNPEAGA
LFVTHVGVEPIPESRLVTVAVTHQDAKEAALWANTLAEVYVEQTLASRVEAAKKAYDWLQERLGETQKGMREAQDKLAKT
YQGQDGFVPEGSGGSAAASSIGKLNEDYVAAQARRIGIEAALKQFAEMRKARKNLDTIPQVATDPVVAGLNAQIATFTVE
LSRLKEKYKEGHPEVQKVNKQVVQIQKAKEERAAQIADGLQAEFAQLQKRESELRDAIDAQKADAARQSQKKTEVEVLKK
EAQSAASLYDVLLQKLNESDIAASIRTNNASVVERASPPLAPVWPNKRKMAGVGILVGVALGLGLVLLRDFLSNTVRDPE
EIERYLHLDLLSAVPRYEADAEHLVTEAYQNLRTALLFARKDDAGQVVLITGTAPQEGKTTTLVNLAKLLAGSGERTIVI
DCDLRRAQIHQRLEISRAPGFTDYFVRHEDLDSLIQSTRVPNLFALTAGPLPPNPPAMLARKNVADLFSHLRRQFEWILV
DSPPLASVTDALLLARHADLAVMVVQHNNVDKKLVKRSVVALRKATPNLLGAILNAVDLKTRSYHYYYYQDGEAGKAEAR
PEAAVKG
>gnl|bykdb|A0A2V7VYF3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=758 residues).
MSKRIGHDETAEDTRPQAESYWNDDRDADNAAPEEAHLLEHLRVLYKRRWTAVTTFVLVVLAMMLRTLNGIPVYEARVQL
LIDVEAPKVLNFKDVFDQGHSPYDYEFTETQQKLLTSRSLARKTLDALRMWQHPYFGGPTPNTTSSSSTRGAIGFTNGIL
ALVRGAFQSKAETIGREKRAPAESAAESQAIDAFLGGLVINPVKNSRLVDVVYRSPDPVFATTIVNELAHQYIQQNVELR
FHASKDASDWLGQQLAEQRKKVEVSELAIQRFREDNDAVSLEDRQNIVVQKLADLNGAVTSAKNERITKEAGYNRLRTMA
DDRSALDAFPAILSNSFVQQLKSELADAQHKQAQFSETLGDKHPDMIKARSAVDTALAKLNTEIDKVVESVHNEYLTALA
REQDLVAALNAQKNEALGQNRKAIAYGALQRDAASNRQMFEALLQRTKETGLSEELRATNVRIVDAAEVPRSPAGPNTRT
DFLLAVLVGGVVAVGFVFGLEYLDNRIKSPDEITAHLRMPCLGLVPAAPDKYATGGAPLINNGVPAHFSEAFRTIRTNVL
FSSVEEGSRTIVVTSTGPGEGKTVVSSNLALALAQANQRVLLVDADMRRPQIHSYFSHPQEPGLSNFIVGNSEVGDVVRP
SGVPELWLLPSGLIPPNPAELLGSMKFKEFLATLKERFDWVIIDSPPVMAVTDACILAHGAEMTNRKAARRALKQLALAQ
AGLMGAVLNRVDVEHHGHYYSGYYRAAYARYYGAPAHD
>gnl|bykdb|A0A2V7W309 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDLNTQQEVHLSQYWNVIRKRWKVAAAIVLVVMIGTFLASYFSKPLYQSWIQIEVEEESQNVTIEDLFGIASSDQEFLQT
QYELLKSRGLAMRVIEDHKLLNDRDFYGPGVEGKTKAEIDQITQAMAGGLLGGVNIAPKHGTNLIVITYTGSSPKLAQKI
AEAWGDSFMRMTIAKKLDSVRQATEFLSQQIATVQANLEESRQDLLSYGKSKGIISVDEGSNVTLQKLGKLNTDVTSAQG
DMYDKQARYNSIQSTAPETVAQQDATVIHLNEELSRLQRDFNAKRAQYTEAHPVMQDLAQQIEKTKLARAAAVREAYSRA
LEEARAQVSAASSREGSVRSAYEQQRTEAQRLNVDAAKYFDLRMAVDSKQTLLAALQKQLNETQVTARLRGSASSNVHWV
DHAETPGSRINLSMKKNLQTAFPLGLFLGFAAIFFLEYMDRSIKTPEELERVTKFASLGVIPAAGTISRQYGYNYSYGRA
SGPQLRAVDAPPEEKPSPGIELLPHLDARSPVSEAYRAFRTSLLLASANSPKIIVITSSFAREGKTTTSVNLATVLAQMG
KPVLLIDADLRRPRLQKVFPGKLNLGIVNYLAANIPFEDTVQPTQVPNLSVVLSGPIPPNPSELLASDRMKHLIQELREK
YAFVIFDSPPVLAVTDAIVLAASADGVVLTVHGGYTPRELVQRSAERLRLSNIPVLGALLNNLDLQQYGYTYRKSYYDYY
DSNQDNAERRGQRADGRR
>gnl|bykdb|A0A2V7X2F7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=730 residues).
MASPSQPPPSEPAGEDHLWDYLAVVLRHRKFALAIFLTATAVATIRTLLTRPVYMATAQILIEREKSNVLSFKDVTEVDA
AKDDYYQTQYRLLQSRSLARRVVESLNLLQDPEFGGPRSPEEVKGALAAPPGSSPVMEGAIDGVLGRLRINAGKGTRLVG
VGSEAFRPDLAMNVANKLSQLYIEQTLEYRYQTSSEAGVWLGGQIDQQRQKVEQATQELQKLKEREGIVNIEERRTLLAQ
KLQQLGTALTETRTVRLEKEALYRQMRGADVPEDLPEVRKDSVVQQLRMDLSTLEQKQTQLLEQYLDQHPEVIKVRRQIE
DTRKRLSAEGQRVIRSAENDYKAAAAQEASLAAALESTKEEIQELGARSGHYDSVKREVEASRAVLNSLTERHKETDVAQ
ELKASNIRIVDPAVMPNGPVRPNRQRDILTGALLGLVLAFGAAFFLEYLDNTLKTPDDVRNHLGAPLLGVVPETGQSPAD
LLIQKGGSTQSTFAEAYRVIRTSLNYSWPNTVPRIIVVTSTAPGEGKTLTSVNLSLTLASSEGKVLLIDADLRRPQAHTL
LRGRRTPGLSDVLVGKAKPSEAIQVFAGGHSLLPAGTTVPSPADLVTGQAMRGFLEGLRGVYNWIVIDTPPVGAVSEPLI
LGPLADGVIVVVGAEMVPRKAVATTIERIKESGARLLGVVLNRARVQQHGYYYGRYYGHYYGHYYGHYGQQTEAPNRGKV
ASIAAKRGRR
>gnl|bykdb|A0A2V7XDY0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=696 residues).
MPSPVPAPAGGSSESPIDFRYYGNLLWKNRILLATAAVLGLALGLVIAFAQTPEYRASVMVQIDPPTPTFMSVQEALGGG
YWQNADFYNTQFRVLRSSALGEKVLDRLKLKDPAEHRDAGGEFMSHVNVEPIPESRLVLIHVTHRYPKEAALWANTLADV
YIEDTISTRVEAARKAYEWLQERLGATQKSMREAQDRLFKSYQSQDLFVPEGSTSAVTSSITKLTADLIEAQARRIGLEA
ALKQIAQLKAANQPLDAVPQFAADPTIMILNTQVSAANNELTRLRQQYKEGHPEIQKLLLQLDQAQKTKERQGTQIIAAL
RADYEQLQKRESELRGAIDTEKAQAASQSRKAAELDAIKKEAESAKGLYDVLLQKLNETDIAASIRSNNVSVVERASAPT
SPIRPNKKRIAAVAGFLGLLLGVGLVIARDYLDNTIKDPEEIERYLHIDLLAAVPQYDEANVHFVTEAYQNLRTALIFGR
KDERGQIVLVTGTVPQEGKTTTIVNLGKLLASSGEKAVLVDFDLRRGQLHSRLGLTREPGVTNFFVNHEDLDALVRPTRV
PNLFALTTGPLPPNPPAILTRPNMQDFLDRLRGHFSWILIDSPPLASVTDAQLLARYADLTTFVVQYNTADKKLIRRNLS
ALRKVTDTVLGVVLNAVNVKAKGYYYYYYPHDVETSKAPNKPSESKPAEDIAVGNR
>gnl|bykdb|A0A2V7YW66 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MSPLSPVPFEEEPEGAAEPASELNFGEYLGIARRHWKLAAVCCLLGLAGAAVHYAITPKAFQATATIQIERRNLTPLGNG
GQNPWLENYWNMEFYPTQYELLQSRGLAERVVKSLDLMEDPAFNPGAAARKDGGRGPTAEDDDAVLGSLAEQVRGGLSVA
PVRSTQLVQLAYTAASPEFAAKAANAFSEAFIDMGVEDRYATAGKASTFLGTQIETLKKEVQDKETQLQAFSRRTDIVTL
DPATNVILKRLEVLNGSLMEAKRVRIEKEAKYHETITGPKENVADSLSGGMVTELRKEVLNLQRDYDTKLKTYKPDFPEM
VTLKAEIEKSQQHINDVVKELTEKARNAAAASYQTALRQEQSLDGELTTLKGQAIDQNSAAVGFTNLKVEIQTRRDLLNE
LMHKQSETEVAVRLQDTRQSNIRIIDKALVPGGPFRPSLRQDVTYGLLLGLLAGLGLAVLIELMDRTVKSPEEVERRLGL
PPLAVIHDVTEMGKAYGYAGGYGYGYGYGEPGAGDKPRPVRPARSAAEKRGDRKERKERKRAAAAAGAPQIELVPHERPR
TLISEAYRSLRTGLLLSSARELKTVAVTSAMAGEGKTATAVNLAIVLAQLGRQVLIVDCDLRKPRLHQVLRVSNRHGLVN
QLTATGEEAIFPTEVPNLWITPSGPIPPNPSELLSSDRMRDWLRTMRSRFDFVVLDTPPALAVTDATIVGLLVDGVVLTL
RSGKVTREEARLCRDRLRQAGVKILGAVLNRYRSLQTGLGKRYKYYEAYGAEESEPKAGSAA
>gnl|bykdb|A0A2V7YYV7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=478 residues).
MELGRYLRVARHRLWMIIACPILAALSAGIVSFALPPVYEAHAALLVLPSNLGTSDPNVIPLTPDQILRTYALLLTQRKL
LDEVIADLRLKTRPDDLAKRIKATPQPNTTILDIAVDDTNPALARNIANDLVDKLIGELKDIQTSHLQVPNSRLSDVLVP
VSPAVVPDRPVSPTKALNISIAFGAGLLLAVGLAYLLERLDQSIKTNEDLTERLGLLPVGHIGYVLAGKGNRGELITLDA
HSHASEAYRALRTSLLFSAIDRELKEIVVTSAEVGEGKSRTAANLAIVLAQAGHWTLLIDADFRRPAQHRMFARIRNVGL
SNLILQDAAESEAIATVESVPNLCVLTSGPTPPNPSELLGSGRMRELMARLRTSFSYVIVDTPPVNAVTDASILSASANG
TILVVEHGQTSFPALERAKQMLDRVGAHTIGVVMNKVRASSGSYAYDYGYYAASPDGHARPGRRPSSKSEAPTSSSGT
>gnl|bykdb|A0A2V7Z0J5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=480 residues).
MELNRYLRVVRHRLWMIVACPLLAAVTAGVVSFALPPVYEAKVDLAVKPAQLLPSTDPNAPSISATTILATYALFMTEPP
LLNKVIADLGLKTTSDELVKQVKVTPDATTALVLHINVQDTNRARSRDVANTLVSEFIKEVNQIQQAETQSTNARSGDTF
VVLSPAVLPKNPVSPNKALNVAVAFVAGLLLALGLALLFDYLDQSIKSDAELTDRVGLISLGHVPFLVAGKGKRGELVTL
DAQSHAAEAYRALRTGILFSGVERSVKQLIVTSAEMGEGKSRTAANLAVVLAQAGYKTLLMDADFRRPAQHRIFARVRNI
GLSNVIIQDAAEEETITAVDAVPNLWLLTSGSIPPNPSELLGSGRMRELIGHLLANFNYVIIDTPPVNAVTDAAILAAYA
NGTILVVEQGRTTFPAVGRAKQLLDRVGAHTLGAVMNKVRASGSSYAYEYGYYATPQADPSAPDVEPLARVKPSRSARNA
>gnl|bykdb|A0A2V7Z0V0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=774 residues).
MSPLTPVPLDDEPEVAPEPESELNLTEYLGMLRRHWRLAAVCCALGLAGAGIHYAITPKAYQASTIIQIERRNLTPLGNT
QNPWLENYWNMEFYPTQYELLQSRGLAERVVKSLDLMEDPAFNPGAAREGAKGGTAEADEAVLGALADQLRGGLAVDPVR
NTQLVQLSFRASSPEFAAKAANAFAESYIDMGVEDRFATAGKASTFLSSQIEKLKEEIQDKETQLQAFSRRSDIVTMDPA
ANVTLKRLEALNTQYIEAKKMRIEREAQYHETQSGPRESMSDSLTTGVVSDQRGQILKLEREYETKLKTYKPDFPDMVTL
KADIEKARQHLNEVLGEQVDKAKSNSLAAYQTAQRQEQELEGELNALKRDVINQSSAAVEYTNLKVEIQTRRDLLDELMR
KQSETEVAVRLQDTRQSNIRIIDKATVPGGPFQPSLRKDGSYGLLLGLLFGVGCAVLIEVLDRTVKAPEEIERKLGLPTL
AVIQDLSESGKAYGYSAYGYGETAADDKPRARPGKAPAGGWREKKKAPAAALPPSQIELVPHERPRTLISESYRSLRTAL
MLSSARELKAIAVTSAVAGEGKTATASNLAVVLAQLGRQVLLVDCDLRKPRLHQVFRVSNRFGLVNQLTATAESETVFLP
TEVPNLWLTPSGPIPPNPSELLSSDRMRDWLKAVRARFDFVVLDTPPALAVTDATIVGMLADGVVLTLRSGKVTREEARL
CRDRLRQSGIKILGAVLNRYRSLQTGLGKRYRYYEAYGAEESEPRAAGKAGSAA
>gnl|bykdb|A0A2V7Z3M4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=472 residues).
MELNRYLRVVRHRLWMIVACPLLAAVTAGIVSFAVPPVYEAKVDLAVRPAQLLPSTDPNAPSVSSATILATYALFMTEPP
LLNKVISDLRLNTTSDDLARQIKVTPDTLALVLHINVQDTNRARARDVANTLVAEFVSEVKQIQQAETQSPNTRTADDFV
VLSPAVLPSKPVSPNKVLNVAIALMAGLLLALGVAFLLDYLDQSIKSDQELTERLGLVPHGHIAFVPAGKGKRGELVALD
AQSHASEAYKALRTGILFSGINHRLXXXGSGEGKSRTAANLSVVLAQAGHQTLLIDADFRRPSQHRMFGRVRNVGLSNVI
LGATTEEATVIAVDSVPNLWLLTSGPTPPNPSELLGSGRMKDLMSRLSDAFVYVIIDTPPVNVVTDAAILSAQASGTVLV
VEQGRTTFPVVNRAKQILDRVGAHTLGVVMNKVRASADAYAYDYGYYSPAASGAPNPLVDKTSNADHRAASN
>gnl|bykdb|A0A2V8AJG9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=773 residues).
MSEQFSSNPGPAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRGPAYGYGSNVIGDGEVHLLDYVKVLYKRRWTAITAFLV
VFLSVTIYTFTATPIYEAKVQILIEKENTNVVTFKEAFEQNQIADDYYQTQYKILQSRALARRTIDGLKLWEHPLLKPND
DNLTVGKIAAAPAAFVSSWFRTAAPVGMPGSDESKQQSRVIDRFLKDLTVSPIRNSRLVDVKFESPSAALSAQVANGLAK
AYIEQNLEFKFMSSKEASDWLGERLSEQRKQVEASEQALQRYREQTDSVSLEDKQNIVVQKLADLNAAVTRAKTERIQKE
AAHNQLRGLQHDRNALDTFPAILSNTFIQQQKGEIAELQRQQAQLSEKLGPRHPDMLKVSNAIQLAESKLQGEIAKVVQS
VKNEYQAALIQEQTLTGALDQQKRDALALSRKGIDYGALQRDNATNRQVFESLLQRAKETGVSTELKTSNIRVVDAAEVP
RRPASPNVPTNLLLAFFGGGTLALGLAFFFEYLDNRIKTPDEVKAHLGLPFLGMVPALFGDDVKDPLMNNGVPANFAEAF
RAIRTNVLFSSAEEGSKTIVITSTAPGEGKTTVASNIGIALAQASQRVLIVDADMRKPRVHSVFGQTQEPGLSNVLVGNA
KASEAIRGTAVSGLWTMTAGMLPPNPSELLGSKRFKDFISTLGQHFDWVIIDTPPVMAVTDSCIAAHRTHGTIFVVGAEM
TSRFATRRAVEQLRQAKCDVIGAILNRVDLKHHGYYYSQYYRKQYGEYYSRTA
>gnl|bykdb|A0A2V8DRT9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=770 residues).
MADQFQLDPGDLDNQKKNLAPRPRRAVRAASGKPAAAEHALEEVHLSDYVKIMYRRRWPAGTAFMLVVLVVLVYTFTATP
IYKARVQLLIEDEKSNVVSFKEVIEQDKATNDYYQTQYRILQSRSLARRTLDRMGAWDTFDSAKAPKKMSIRTAVASVVA
PVFHLFVARKAIEPEQTGETTTQSRILNDFLSNLTISPIRNSRLVEIEFASPYPYVAANVANSLSKAYIELNLEYKFTAS
RDASDWLGERMGEQRKTVDASERALQVYREQHDAVSLEERQNIVVQKLADLNAAVTRAKTERIQKESAYEQIKAVQSDRE
ALDTIPAILSNVFIQQQKTELAELQRQESQLSEKLGQRHPDMLKAKLNVQNAEARIQAEINKVVHALSNDYQAALAQEQS
LMHALDQQKNDALALNRKGIEYGALQRDAASNRQIFESLLQRTKETGISGELKVSNIRIVDAAELPQVPASPDKPLNVLL
AILGGSIMAVGLAFFFEYCDNRIKSPAEIKAHLGLPFIGMIPKMAVADGESAPLLDKGATPNFAEAMRTVRTNVLFSSTA
DGGQSIVVTSSGPGEGKTVVSSNLALALAQTGQRVLLIDADMRRPRVHQVFAERQEPGLSNILVGDTKTGDAVRPTSCST
LWILPAGHLPPNPAELLGSKRFEDFIETLKDHFAFVIIDSPPIMAVSDSAIVAHMADGVLFVIGSEMTSRGVARTAVEQL
INANGHMIGAVLNRVDLTHNAYYYSQYYRREYGHYYIKGANTKSADAKSA
>gnl|bykdb|A0A2V8ERZ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MLPSSPPDAPAPSTTAVTAGSPSHAGSSHGQGSAPHYAPEQDVHLLDRLAVIYRYRRICAATFVLVSAALIIQGYSTVQM
YQAQARLLIEDERSTAVPGLQNDANQYYEDPEPYYQTQYKILKGRDLTRRVVRKLRLDTVPEFNGTKPAPPTASTLLQEA
KDKIIGIAKPNAPAEAPKVDETADESGLVSAFIGRVSVDPVRGSHLVDVSFVSEDPKFAAEAVNALIEEYVNQNLELKLQ
STQGMLDWLDKELDNQQKRVEGSEKGLAEYREKENALSLDDKQNIVLSRLNQLNDAVTRARTERVQKESLYNQVKAIANG
TAPDAIPAIATNAGVASAKAKLSDLQREKAKLLERYQDKHPQVINAVAALQDAQRQLDLEIARAVQSVKNEYETAVLQEQ
TLARNLDGAKSEAQDLNRKGIGYGVMEREAKSNREVYQSLLTREKELRVSANSRTNNVRLVDRAETPRGPITAGGRRTVL
MSLMIGLVLAVAVALGLDYMNDTIKTPEDVTRRLKLPFLGLVPVVRGDKHPLLASSHVPHDFGESFRSLRTSLLSKYQGD
ATKIITVTSAQPLEGKTTTAANIAMALAYGGARVLLIDADMRRPGLHRPLRLTNDRGLSQVLTGQARVRDVIQRTVDPNL
LAITAGRSPLNPSELLSSERMKTLLTNLAHGPFNWIIIDTPPVLAVTDAVILAPMVTGVTFVVGAEMTRRRLAERAIETV
MQAHPRFAAVVLNKVNFAKNKYYYSRYYGHQYKNYYAEATP
>gnl|bykdb|A0A2V8EXP2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=783 residues).
MSTQFRDSTDSLQHRLTMASADAENAGAARAADSGPAAAAPPPTAYGYGSNVVGDDQVHLLDYVKVLHKRRVAALTAFLL
VFVSTAVYTFTAKPIYESKVQILIEKENANVVTFKEVFEQNQVADDYYQTQYKILQGRALARRTLDALRLWDHPQFNPKG
EAAFSLGALVTAPLRWLSAWATPPPAIEPGGVSAGETSAQARAIDRLLGGLTVTPIRNSRLVDVKFSSLSPMLSSQVANA
LARAYIDQNLEFKFLSSKEASDWLGERLAEQRQKVEVSEQAVQRYREQTESVAFEDRQNIVVQKLADLNAAVTRAKTERI
QKEATYNQMKALQTERAGLDTFPAILSNQFIQQQKGELAELQRQQAQLSEKLGPRHPDMVKIGLAINAAEERIQGEIAKV
VQAVRNEYLSAQTQEQSLINVLDQQKREALALNRKGIDYSALQRDALSNRQIFESLLQRTKETGISGELKTSNIRVIDVA
ETPRRPASPNVVANLLLALFGGLTLAVGIAFFFEYLDNRIKTPDEIKAHLGLPFLGLVPALFAKDLHDPLISKGVPANFS
EAFRAVRTNVLFSSADEGPKVIVVTSAGPGEGKTLVASNLAVAMAQAAQRVLLMDADMRRPRVHSLFGIAQEPGLSNVLV
GNAKPSDAVRITSVPGLWAMPAGMIPPNPAELLGSKRFKEFLGTLGQHFDCVIVDTPPVMAVTDSSIAAHVATGLIFVIG
AEMTTRHTAQRAVEQLSHARPKFLGAILNRVDLQHQGYYYSHYYRREYAGYYTQDSSKLPAAS
>gnl|bykdb|A0A2V8F6S9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MADSTPSGSRPASSASNSNGGVAPPLTYGTDGDVHILDRLAVLYRYRRIAITVFVLTTAALMIQGYSTTPMFEARAQIEI
DAERATALPGITTPDNTYYEDPEPYYKTQYRIIKGRELTRRVVKKLNLQDRAEFNGTERPRPTPFSMLREAEQRIVRLVR
PAKEEPTEAPKVDEAPDESGLVSGFISRVTVAPITGSKLVDVTFQSSEPKFAATAANALVDEYVDSNLEIKQAGTQNMIE
WLDKELAKQLQKVQESERAMANYRERQNALSLDDKQNLVGARLNKLNDDAMMARSRKLQKELLYNQVKAMAAGQPLDSVP
AIAQNPTVVGAKNKVQELQRTLTELSARYGEKHPSIQKARTDLAEGQKQYEFEVARAATTIKNDYESAVLEEQTIARGLE
SAKADAQNLSRLGVDYNVMQRDAQTNRTIYDTLLARQKELTVSSNSRQNNVRVIDHAELPRGPMAPTGRRTWLLSLAVGL
AIAVAVAYGLDYMNDTIKTPEDVTRRLKLPFLGLVPSVRGDKHPLLASSRVPHDFGESFRALRTSLVSKYPGAGTKVLLV
TSAQPLEGKTTTAANVAMALAYGGSRVLLIDADMRRPGLHRPLRSTNERGLSQVLIGQARVRDVIQRTVDPNLLAITAGK
TPPNPSELLSSERMKTLLTNLSHGPFDWIIIDTPPVLAVTDAVILAPWVSGVTFVIGAEMTRRRLAERAVETVMQTRPKY
AAVVLNKVDFARNKYYYSRYYGHQYKNYYAEAAV
>gnl|bykdb|A0A2V8F956 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=707 residues).
MAITTFLLVVGSVTVYTFTATPIFEAKTRLLIEAENRNVVSFKAVLDEDQTRADYYQTQYNLLQSRALALRTIDQLKLWE
TPPFRNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGGSAARTTESANPGPDETASQSDAIDAFENALTIAP
VRNSRLVDLKFDLPDGALAATIVNALAKNYISQSLEFKFMASKDASDWLGQQLLEQRKQVEGAEKKLQQYREQNDSISMK
DRENIVVQKLTELTGAVTQAKTERFQREALYRQVESLRGNPAMLDTFPAILANTFIQQQKTELAQLQSQSAQLGDKLGPN
HPDMVKIRSAIRLTQAKLDGEIGKVVQGVKNEYLAALAKENSLTGALNAQKGDAVQSSRQIFDSLMQRAKETGVSAELKT
SNIRVVDRAQTPTEPVSPQKGLNLLLALFGGSLLACGLVFFFEHIDSRIKTPDEVTAHLQLPHLGLLPALNEKQFANTYP
LISKTAPPNFSEAIRDLRTNVLFSSAEKGSRSVVVTSTGPGEGKSLVAANLAISLAHATQRVLVLDADLRKPQVHDIFEV
AQEPGLSNLLAGQAKASESVRKTAIPGLWVLTSGRIPPNPAELLGSQRFKDFLVSVKEHFDWVIVDTPPVMAVTDARLVA
HHATGVLFVVGAEMTSWHAAKRALDHLDHVQARFVGAVLNRVDLDRNAYYYSNDYRREYTQYYAKSS
>gnl|bykdb|A0A2V8G155 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=746 residues).
MSDTKEGLRMMGAPAPGDYALNDAALPPASPHVVNSLMVVYRRRWTVVTAFVLATAGATVYTFSQPRLYEARTRLLIETE
NPNVVNFKAVIDEDQTKAEYYQTQYNIIQSRAIARRALDELKLWNTPPFGGTAPADSPFSLRRVIALVHTTNAGPPPPPP
DETALQSRAVDAFLARLDVTPVRNSRLVDIKYRLGDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLEERLAEQRKV
VEQAEARLQAYREEHDAIVPAEDRQNIVVQRLADLNTALTRAKTERIQKQAAYDQIRNARDVPGSVDTFPLILTNGFIQQ
QKSQLSELQREYAQLSEKLGDKHPEIIKVKSAIQISQAKLSGEISKVVDSVKTDYLAAVAQERSLTAALEQQKTEALVMN
RKAIEYGVLERDAKSSRQIYESLMQRAKETGVSAELKTSNISVIDRAETPRTPVEPRVQYMLTLGGCGAFLFALCLAFFF
EHFDNRIKTPEEIQTHLRLASLGLVPAVRLKGSMSPSLYKRAPGNFAEALRTIRTNVLFALPEEAARCILVTSTAPGEGK
SVIASNLAMSLAHSGARVLLVDGDMRKPRGHELLGGPQEPGLSNVIVGETKLADAVRRTPIPSLWLLAAGKTPPNPAELL
GSERFRDLLLSLQTRFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQLTHCRARIIGAVLNRVAL
DRNRYYYSHYYSREYQAYYRSERTAS
>gnl|bykdb|A0A2V8GFD4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFDYLRILYKRRWLCLAVFVLTLGSVVMYT
FTATPIYEARTQILIETENPNVVSFQEVVDQNKTTLDYYQTQYRILQSRAIARRSIADPFLATNAQLSGGGRQMFDLQSL
FNSVVAYVNGKMTGEAYSKSTAVDETPLERRRVDAFLGALSIVPVRNSRLVDIVYSSPDPKFATAAANAIAKAYIEQNLE
YRFTASKEASDWLAARMAEQRSAVEASERALQQYREQYDAISLEDRQNIVVQRLEDLNGAVTKAHTERLQKQALFEQLQA
ARGDAAALDRFPTVLSNGFIQQLKGEIAALQRQHAEMADNLGERHPTMIKLKASLQSADAKLQAEIAKIAESVRTEYLAA
AAQERSLQAALDQQKHEAQELNRRAIDYGVLQRDAATNRQIFDALLQRSKETGISGELRTSNVRVVDAAEEPPWPAYPRK
RTNVTYGLLAAVLLAGMFGFVIEALDTCLKTPDDIKVQLGLPFLGLVPQLRRREFAKPSPMINHHVPGMFPEALRAIRTN
VLFSFAEGSAKTLVITSTAPEEGKTMVAANLAIALAMTSQRVLLVDADMRRPKIHQLFALDQEAGLSNVLIGSAKANDAV
KKTTVPKLWVLPAGRVPPNPPELLGSPRFAELMAAFRENFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAA
KTALEQLDAAGARYIGAVMNRAEIRRHPHYYSRYYRTKYTTSYAVSPGSQPSSAR
>gnl|bykdb|A0A2V8GTX0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MFTPGGLSTTGPAAGSPPPVPVHQPQARKTAGLFSPDPNIHLFDRLAIIIKHWKACAAIAVLVIAGMMYQTFTTVPLYRA
QARIQIDEEQTTAQVDFKQPELVYSDPEPYYQTQYKILQGRDLALRAVKRVKLEDVPEFNGKGAKPPLLTQVISDLKAKI
AAPFRGQTAAPPPRPAGPVNENQQADAFLGRVQVVPVRGSRLVDVYFVSADPEFAARAVNVLAEEYVNENLDFRLQNTDK
TLQWLTEEVAKQQSVVQASERMLAEYRENQNAISLEDRQNIIVSRLNQVNDAASHARTNRIQKEALYNQVAATKDREGLS
QIASNPFVQQLKTRIVELQRDRVRLEERYGEKHPDVQRVNGQIQDAQRQLDAEIERSVAAIKADYQAALDEEKQLSADLE
GQKAQATDLNRKSIDYSVLQREAESNRQVYESLLQREKELRVVSNSRANNVRLLDRSEVPESPFTPNTRRAWLMAILFGL
GFGIAAAFAIDYLDDTVKTPEDVTWRLHLNFLGLVPKVHGERHPLLSGPVPHDFGEAFRALRTALVASSGTDATRLVAIT
STQPLEGKTTTAVNVALALAIGGARVLLIDADMRRPSLHKAMRLPNDRGLAELLSGKARMREVVQRCGDPNLLVIPAGHT
PSNPSELLASDRMRAFLHQLTTGPFDWVIIDTPPVLAVTDAVVLAPLVHSVSFVVGAEMTRWRLAERAIETLQAGHPRSI
AAILNRVDFDRNRYYYSRYYGHQYKSYYAEAPAAS
>gnl|bykdb|A0A2V8HDM7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=746 residues).
MSDTKEGLRVVGAPAPGDYALNDAALPPASPHVVNSLMVVYRRRWTVVTAFVLATAGATVYTFSQPRLYEARTRLLIETE
NPNVVNFKAVIDEDQTKAEYYQTQYNIIQSRAIGRRALDELKLWNTPPFGGTAPADSPFSLRRVIALVHTTNAGPPPPPP
DETALQSRAVDAFLARLDVTPVRNSRLVDIKYRLDDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLEERLAEQRKV
VEQAEARLQAYREEHDAIVPAEDRQNIVVQKLADLNTALTRAKTERIQKQSAYDQIRNARDVPGSVDTFPLILTNSFIQQ
QKSQLSELQREYAQLSEKLGDKHPEIIKVKSAVQISQAKLSGEISKVVDSVKTDYLAAVAQERSLTAALEQQKTEALVMN
RKAIEYGVLERDAKSSRQIYESLMQRAKETGVSAELKTSNISVIDRAETPRTPVEPRVQYMLTLGGCGAFLFALCLAFFF
EHFDNRIKTPEEIQTHLRLASLGLVPAVRLKGSISPSLYKRAPGNFAEALRTIRTNVLFALPEEAARCILVTSTAPGEGK
SVIASNLAMSLAHSGARVLLVDGDMRKPRGHELLGGPQEPGLSNVIVGETKLADAVRRTPIPSLWLLAAGKTPPNPAELL
GSERFRDLLLSLQTRFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQLTHCRARIIGAVLNRVAL
DRNRYYYSHYYSREYQAYYRSERTAS
>gnl|bykdb|A0A2V8HSS5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFDYLRILYKRRWLCLAVFVLTLGSVVMYT
FTATPIYEARTQILIETENPNVVSFQEVVDQNKTTLDYYQTQYRILQSRAIARRSIADPFLATNAQLSGGGRQMFDLQSL
FNSVVAYVNGKMTGEAYSKSTAVDETPLERRRVDAFLGALSIVPVRNSRLVDIVYSSPDPKFATAAANAIAKAYIEQNLE
YRFTASKEASDWLAARMAEQRSAVEASERALQQYREQYDAISLEDRQNIVVQRLEDLNGAVTKAHTERLQKQALFEQLQA
ARGDAAALDRFPTVLSNGFIQQLKGEIAALQRQQAEMADNLGERHPTMIKLKASLQSADAKLQAEIAKIAESVRTEYLAA
AAQERSLQAALDQQKHEAQELNRRAIDYGVLQRDAATNRQIFDALLQRSKETGISGELRTSNVRVVDAAEEPPWPAYPRK
RTNVTYGLLAAVLLAGMFGFVIEALDTCLKTPDDIKVQLGLPFLGLVPQLRRREFAKPSPMINHHVPGMFPEALRAIRTN
VLFSFAEGSAKTLVITSTAPEEGKTMVAANLAIALAMTSQRVLLVDADMRRPKIHQLFALDQEAGLSNVLIGSAKANDAV
KKTTVPKLWVLPAGRVPPNPPELLGSPRFAELMAAFRENFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAA
KTALEQLDAAGARYIGAVMNRAEIRRHPHYYSRYYRTKYTTSYAVSPGSQPSSAR
>gnl|bykdb|A0A2V8IVN9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=769 residues).
MSDIRNFDPSVKLRFEEAANPEDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLDYVRVLYKRRWIAGTAFTVVMLLV
TVYTFTVTPIYQATTKLLIESDSPNVVSFKEVINEEQTKADYYQTQYNILQSRSLARRTLETLKLWESGEFVTNKRGIVQ
TLAGGVASLFGKKAPEPGIPDAGETSSQSRAVDAFLKRLTVSPVRNSRIVDVKFEAKDPDVAERVVNALAKGYIDQNLEF
KFMSTKEASDWLGERLGEERKQVEAAEARLQQYREQNDAISLKDRENIVVQKLSDLNSAVTQAKTERLQKEALYSQLNSL
RSGRGAALDTFPAILSNTFIQQQKSELLQLQSQYTQLSEKFGDKHPDIIKVKSAIQLAQARLDGEIGKVVQSVKNEYLGS
LAKENSFIAALNQQKGEALTMNRKAIDYGVLDRDVQSSKQIYESLLQRAKETGVSTELKTSNIRVVDPAERPRKPSSPQY
ALNLLLGLLGGTMLGVGLAFFFEYLDSHIKTPDEIRAHLGMPALGMLPAVQEKEFGGSYPMVGAHVTTNFNEAFRAVRTN
IIFSSAEEGSRILVVTSTGPGEGKTTFASNLAVSLAQTGQRVLLIDGDMRKPKLQEAFGMTQEPGLSNLLVGTAKASESV
RRSKTAGLWLLPAGKIPPNPAELLGSQRFRELLASLKDHFDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGAEMTSRHTA
KAAIRQLENAHAKFVGAVLNRVELEKHHYYYSQYYRKEYARYYAKTGSA
>gnl|bykdb|A0A2V8IYW3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=764 residues).
MIPGHKYTPQDVLDAVNRRKWLLICPVLVFGIAAFLITRSLPNLYQSETTILVVPQRVPESYIRSTVTNRIEDRLRSIRE
QVLSRSMLEPIILEFDLYPEQRKQVPMEDVVARMRTEVDVDPPVKDDTFKISYVSGDPVVAMKVVARLASMFIDGNVRDR
RVVAEGTNQFLESQLEDAKLRLIDREKKLEEYRRRYIGELPSQLQSNLQVIQTTQIQLQSLSESLNRDRDRRLVLERGLA
DMRADPATAAATADPSDRTPDPLDAARTELATLGRRLLPTHPDVIAAKRRVAQLEAERVAMPKASDAPASAAAPQVADNV
VVRRMRETQTEIDKLDRQIAGKEADSVRLRGTIAEYQRRVETAPTRESEMAELTRDYETLKKGYESLLAKKEDSNIAANL
EKQQVGEQFKVLDPARVPERPFSPKRLQLNLTAIGIGLMLGMAVSALLEYRDTSLRTESQLLEALKIPVLAVLPVMESID
EKRRRMLRLAFTFTGGFLLVAARITETGVLMPETAEIGVFVPLKNPIGVSEELFDPALTGKVAAPGMLPVATEQYRRLAA
ILHHAQADTGMRVVMVTSAISGEGKSLTITNLALTLTRSYERRVLLIDADLRRPTLHTIFKLESPCGVNEYVHSHGAKPL
ELLPVAPRLFLLPAGRPDSDPIGALTSETMQRIVKEGREQFDWVLIDTPPIGLLPDAGLLGGIADGALLVVRAGHSPFDL
IKRAVDTLGRERILGVVFNGADTSRRYGDDYYGYYAKSGYGKSR
>gnl|bykdb|A0A2V8J0X9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=757 residues).
MFDTQEVRAQLPAEVSPSALIALPSSTSQSTHVLDRLNAVFKHRRLSGTAFVLVVTAMMVQTYSTIPVYEAWSRVQIQDE
RTTQVGTLNASDPAFWQESGPYYQTQYSILQSRGLGRRVVRKLDLQNSPLFNGSAPPPRDPLSLARQGRAAASAWLRGLI
VKPPPAAAAPPAPDEPAHEAGLISAFLGGLSIRPEPNSRLVKIVYSHSDPKFAALAANTVADEYTQQNIDLRLQNTEKTL
QWLGEELKRQEQQLAASEGALTEYRERNNALSLEDRQNIVVSRLNQLNDKVTTSRNERLSKEAIYNQLRRADPSSDAIDN
FPIVGTNSAVVDAKNALATLTAQKANYAGRYGPEHPRMMEVKDQIENAKRRLVAERTKVLESLKNDYNAAFAQERSFSSQ
LEEQKGASMDLDRKSGDYKLLQRKADSDRQVYQSLLSQQKELAVVANSRANNVQVLDRADVPPFPVSPNPRRDWMTAILA
GLSIALGLAFGMEYLDDSVKTPEDITKRLRLPLLGLVPAVRGERVPVLTETVPHDFGEAFRSLRTSLVFTSGAQSTRIIA
VTSSQPLEGKTTTACNLAMALAFGGSRVLLIDADMRRPGLHKTVGLRNETGLSHLLVGQARVREAVQRTSEPNLVVITAG
RTPPNPSELLSSERMSNFLANLATGPFDWVIIDTPPVLAVTDAVIIAPKVSGVVFVIGSEMTRRVHAERALETLQSGRPR
SIGVVLNRVDFDRNKYYYSRYYGYQYKSYYGQNQGAA
>gnl|bykdb|A0A2V8JK38 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=977 residues).
MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWDRTSTLRPWSVGTAAVASTAGQQVTF
TFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMYSVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAF
DIAPQVPATVNITSPPSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLAYWRVIVTRRW
TVVAVFATIVLLTLIWTLKQKPMYAATITIQIERETPSLVNLRDYYQADSDTYVDYMLQSYFRILKSRSLARRVVTELHE
ELEKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEGDQLRSLIDQYLDRITVKPLRQSWLVEVTFQAKDPKLAAQVIN
AHGRHFVEQNIENRFQTTQQVSELLSQQIVNLKGGLEKAEERLQKYGQDNDILFTEDGRNTVTEKLRQLQEEYTRAQAER
IQKQSYERMVRTGSADALPQITGSSLISQFVGRLSDLKRQDAELTVTFAPDYPSRRRIRSQIEEIQKQIEGERGRIVKTF
EVEYSAATERERLLSVALEQQRDAVNKMNREIIQYNILKREADSSKDIYNGLLTRLKEAGISGGLRASNIRVVDQAEVPK
GAVTPNHKLNLAWGIFFGLIFGVGSAVFQEYIDRSIKSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFGR
KKEQNEPANAEKSDNRSIELAPHDEPSSVIAESYRSVRTSFFLSSGSAPTRSVVITSAVPGEGKTVTAVNTAVIVAQTGA
RVILIDADMRRPRMHKIFKCANANGLSSVLEGHCSLENAVSETNIKNLFLLPSGPVRPNPGELILSPRFKEVLKSLKKDF
DLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQHLAEAQVRIAGVVLNDLDLRHLAGYSARYRDGYVY
DRYYGHITHDENVENRS
>gnl|bykdb|A0A2V8JQV5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MDMEFSEHDLTNKGNGEPSQDPVRKVSKSGKPQQSPAYSGPMTSPAGVFDYWRVFLNRKGTVLIAAVLGTAIGLLISFPR
TPIYQARTTLEIQGLNDNLLNTREVNPSAPSVISTAFEEIQTQIKILKSDSLIGQAMKRFGLTHSADPLTRLTRWRIALG
IAKTSAASAREAAISLAAATLQVEALQQAHIIQITADSTDPKIAAEFLNTLTDEFINQKLRSRLQTNERTAEWLQLQLQE
LKVNLEKSEQELQDFGRATGLMFTSEKDSSVAEEKLHHLEADLSEALADRVEKQSKYEIAKSAPVESLPQILDDGTLRDL
QSKLTELRSQTAELRVSLTPAHYRVQRLEAQMGELETAFERERANILRGIANQYEDAKRREELLAQEYDAQTRVVSDQAD
KVAHYARLKREADSNRQLYEAMLQKVKEYNIASAVTANNVNIVDPARPPGGAYKPDVYMYAMLGLATGVFLGLMLIVRQE
QADRSIHAPAEAPVYLNVPELGVVLSAEADSSLGVPPESSPVRSLRNAIEFGKRIAGSDRSTPYGKDRPKPKIELMAWEK
PFSLFAECFRTTAASVLFSEHGGTVPQILVVTSANPQDGKSTMASNLAVALAETQRRVLVIDSDLRRPDLHRIFHAENRW
GLIDILQGDIEIRDYPLDMLARQTEVPNVHLLTSGTASRSVVHLLHSTRLPELLQRLRKDYDLILIDAPPVLQMADARVL
GRLADGVVFVIRSGRTTRDMALSACRRFREDRTRVIGTVLNMWDPRDASQKRYYYSNTYYEHYVHKETEEVKS
>gnl|bykdb|A0A2V8JTQ2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=745 residues).
MSESFELMNQRARDFDPVQLPRVALSSGPNPANHYLPRVGAPDEVFAAGMWRIIRDRKWTIAAFALVVVGIVVTASLLME
PQYKAVGRVVVVFHRDNDSGVLGFRGADTSLLDDPEDRTAIDTQIRILQTDALAMQVIKNLQLDKNPKFTARGGRAANQD
ALLQSFHKGLEISKVKGTRLIEIQFRSTDPQLAADVVNGLAKEYVDQYYRSQFQVSTQFSDFLANQLKELQARVEDSQRK
LVDYQKENGLFGLDDKQNIVTTKLTDLNRELTAAEVDRVQKDVNYQLARSGQPDLVARLEPDNLLTRLRAQQADLENQIA
QASVQLGPAHPKMAELSKQLAQVRRSVDAEVKGIGERITYEYQTAAERERMLRDALEAQKQVVDHLNASAVQSDILKREF
ETNRKLYEDLLQKQKEVGISASLKSSNIWIVDPARPPKLPAEPNILRNLALSLLFGICGGVWLSFGLAKIEEKTINTVEQ
AQSLSSLPALGVLPLLEAKSQNGAHRELAGGSGHVDHALVSLLQPMSLAAESYKTVLTSLLLSQPTPPRVIQVTSALPGG
GKTTVSTNLAILLARLRRRVLLVDADLRRSQIHLAMRLSGNTGLGPLLRNTVTFEEAVVSWANVPNLFILPAGPVFLPGD
TELLMWSFQDWVKRWREQFDHIIIDTPPVLSVADAVRISVEADSVILVIRSGQTARDAFLRAQDLLSKVNARLTGFVLNG
ANLDSSDFRYYHNYSQDQTKLFVDE
>gnl|bykdb|A0A2V8K4L4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=798 residues).
MRNHDDSSNLPVPFTPPPGNQLSTPLQARFMPEPQEEASREGVVAYWRMVMRHKWIVVLVAFLGTVAGILFTLPQTPIYQ
SSTSLEVQGLNENFLNLENLNPTSSPSGYLDPSYEILTQVKVFQSRSLLQQTTERLLKEKKTGYGTSTDRLAAWRKVLHI
APKQALDRNNAIAAAAGGINVKASGTTRIIEITSDSTDPQLAADFANTLVDEFIQKNLDDRWKTTERTGEWLTKQLDDLK
IKLERSEDTLQSYALAVGLQFTASSKGKDGDQENVASASVRLVQEELLKARADRMIAQSKYELLASSPPEALPQVLDDSS
LREYESKLVDLKRQRAELSPSFTPDHPRMQKLEAQITELETALEAARQKVVTRLRNDYAAAESHEKLLNDEFAKQLDTVS
SQAANEVHYNILKREVDTNRQLYESMLSKVKESSIASAMRASNFRIVDLAKPAGAPYKPNLMNNAMLGSMAGIFLGVVLV
LLKEQADRSIQQPGDSSLYLGISELGVIPSDRPTMLRRGQRPSALIPSVSGNNSNAGNPVELVTWQRQGSLIAESFRAVL
TSIMFSEQRPRVVVISSANPSEGKTTVSTNLSIALSEISQRVLLIDADMRRPRLHRLFDLKNDKGLSELLLSKHALKTSE
VVGAVRESWIPGLHILTSGPWAANASTLLYSARLPEIIEITRQSFDTVIIDSPPMLHIADARLLAKHSDSVLLVLRAGKT
TRTAGSMAIQKFVADGSTILGTILTDWNPDQNGYGYDYKYYSSHAAYYTDSGVTNDLEAVVGDSKESSGKQAVGSRDL
>gnl|bykdb|A0A2V8KP55 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=756 residues).
EEDETHLLAYWRVIVTRRWTVVAVFATIVLLTLIWTLKQKPMYAATITIQIERETPSLVNLRDYYQADSDTYVDYMLQSY
FRILKSRSLARRVVTELHEELEKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEGDQLRSLIDQYLDRITVKPLRQSW
LVEVTFQAKDPKLAAQVINVHGRQFVEQNIENRFQTTQQVSELLSQQIVNLKGGLEKAEERLQKYGQDNDILFTEDGRNT
VTEKLRQLQEEYTRAQAERIQKQSYERMVRTGSADALPQITGSSLISQFVGRLSDLKRQDAELTVTFAPDYPSRRRIRSQ
IEEIQKQIEGERGRIVKTFEVEYSAATERERLLSVALEQQRDAVNKMNREIIQYNILKREADSSKDIYNGLLTRLKEAGI
SGGLRASNIRVVDQAEVPKGAVTPNHKLNLAWGIFFGLIFGVGSAVFQEYIDRSIKSPDDVTRHLGLLALGTVPRLHNLS
LWRGYKYKYGYGYGFRFGRKKEQNEPANAEKSDNRSIELAPHDEPSSVIAESYRSVRTSFFLSSGSAPTRSVVITSAVPG
EGKTVTAVNTAVIVAQTGARVILIDADMRRPRMHKIFKCANANGLSSVLEGHCSLENAVSETNIKNLFLLPSGPVRPNPG
ELILSPRFKEVLKSLKKDFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQHLAEAQVRIAGVVLND
LDLRHLAGYSARYRDGYVYDRYYGHITHDENVENRS
>gnl|bykdb|A0A2V8LCT5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=814 residues).
MNEATKLVRRDDQPREIDRRTGDTTSYRTAYGYNMDAGENEVHLLDYWRAIRKRLWLVIGVAALLTTLALVYVARKPDIY
EAKSQVQVDLENNPMYAGKTAPMIVSPVNDPAYFNTQLQILTSQGLLRRVVKTLDLEHNQAFLRPQTAQPHSTWKTILQM
LGVGGREKKETKQQNNVLPLTTSVAPATSSEDLVEAKRLAPYVGMLLGGLRVDPVRENRAGYYKETRLIDIDYQHGDPEI
AAKVVNCVAETFVRSNLEKKNETNTSTSEFLSKRVTELQSQIRSDEEKLVVYAKSNQILSLDASQNTVVERLAGLNKQLL
EAENDRKMAEAEFNAAKAPGAASALAEAGKDIELSESKLAELKQKRAELLVTATEEAPEVKEVDQQIDVIQKHLVETRSR
STATLLTNLETKYRQAAEREDSLRKSFNQQKGETLSQNEAAINYRILQQQIETNRGLLDNLLQRSKENDVVLAGRPNNIS
VVDYAIVPDFPVGPGRMRTVMLAFVLSLGLGIALALFLEYLDDTVHSTEDVEKFLRLPALAVIPAMGAASAPRRLLSSAT
ALQKRNGNNGGNPELLLNITGRSALAEAYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGANVLII
DADMRRPRLRSIFDLSEREGLSSILSSEMKPDQMLGAIVKDPTTGLNVLTSGPVPPNPAELLGSEQMRKLIAVLSIPFTH
IVIDSPPVSSFTDGVLIASIVDGVLLVVHGGKSSRGVVRRSRQMLLDVGAKIVGVVLNNVSVRSHDYYYYYQRYYHQSYY
HADEAEEAKSVAAS
>gnl|bykdb|A0A2V8LLF9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=798 residues).
MTHDEHLVPARTGRDFDSTLADLTQSKPYGKYARYGTTQSETNVKEYFFIILKRKWLIMSLLLVVTSLATIQAYREPSIY
QASTMIRIEGRPQSVLSTGNLIISGQPDPNFWGTQLRLLQNPLLARQVIVSLDLQHNSRFLSGQAQTSIVASLKRIFSRE
NAPASSPSTNATVEPISEEDLRSRQFTAEELTQLEPYEDAIAAGETVEAVEKTSLVTIHFQHTDPELAQKIANTLADVFV
QNNLDRITAGTSKAEIDLTNQIAKVQDKIKKEEQDRFSFAKAHNLPIDNTPGTNLEAMRLQTYSAQLLAAEDNRRSQEAI
YDAARDANDPFNAPEIQSDQRIQKLRDKIGDLEDKRNSLLEIYTPEWPEVKKIEAQLEPLKKQLIAAPKEVLAGLKSRRD
SAIAHEKSLVGAYSRQHGTTIQQTKDQIDMAIITQALTTDQQYLNTLTQRLRELTATSGSGTASEVSIANYSRLPHEPVG
PARLRTIILALVMSLLVGIGLAFLLDFLDDTLKSVDDVDRYLHLPALALIPTARNEKTKLIAGDAAAPAATTALTMVNDV
RSPIAESYRHLRTSLLLSSAGMQPRTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSQFNLPNSRGL
TNCLSGDGKDLDALLHVYDKQPNLKLLTSGPIPPNPAELLGSDEMRKLLILLSERFTHIIVDSPPAISFTDASILSTFVD
GVILVVHGGRSSRAVVRRAKQKLMDVGAHIFGVVLNNVKIETKSDYYYAGYYGGYYDAGYYNSDEETAKDGDARAASV
>gnl|bykdb|A0A2V8M3M6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=804 residues).
MKEPAELIEKSNGSRDVGGVMERSLAPYTRYDSYADESNGYHRLRDYWRSVRKHFWLIIAILILVTGITAIYMARQPDVY
ESLSKVQVDSETANNPAIGALKGNPIFLNNPSQDPTYFNTQIQILTSAGLLGRVARTLDLEHNQAFLHPQSAQDLSFGES
LKGLIGLRKSQSKTKEQEGYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKQLSDTRIIEIRFKHQDSEIAEKINNTI
ADTFVVSNLERKTETTNSAGDFLQRRIDDLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENERKA
AEAAYRAVLAPGALEAQAEATSNKSSATPEAKLAELKQHRAQLLLEYTEKYPEVKDVDQQIAMLEKQVDQSRRHTESVVK
TNLETSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAA
IPKNPIGPKRMQAIVLAALFALIVGIALARYLDYMDDSVRTSDDVENFLRLPALTVIPTVGNSARRRLLSAMPGSKRNGH
QGGPELLLNGSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRL
HSIFDVDNDKGLSGILASKMSEAEMLNCVQQHEESSLYLLPSGRLPPNPAELLGSDQIRSLMSVLENTFTHIVIDSPPVA
SFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYREYYHSDIQPTEISPS
TADS
>gnl|bykdb|A0A2V8MHG6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=799 residues).
MKEPTELIEKSNGSRDVGGVLERSLTPYTRYDSYEDESNGYSRLRDYWRSVRKHLWLVMGIVVLVSGVTAMYMARQRDIY
ESLARVQVDSETANNPAIGALKGNSIFLNNPSQDPTYFNTQIQILTSAGLLGRVAKTLDLEHNEGFLHPQSATRPSVWES
LKGLVGLSKSQSKPREPEGYVLRPSSALSNDDIAQTNHLQPYVEMLQSQLSVKQLSDTRIIEIRFKHQDPEIAEKINNTI
ADTFVVSNLERKTETTNSAGDFLQRRIADLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENERKA
AEAAYRATLAPGALEAQAEATNNSSATTEAKLAELKQHRAQLLQEYTEKYPEVRDLDQQIAMLEKQAEQSRAHTESVVKT
NLETRYRQALQKEEALRQAFEKQRAETLTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAAI
PKTPIGPKRMQAIALAALFALILGIALARYLDYMDDSVRTSEDVENFLRLPALTVIPTIGNSARRRLLSAMPGSKRNGHQ
GGPELLLYGSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRLH
SIFDVDNDKGLSGILASKMTEGEMLGCVQQHEESSLYLLPSGRLPPNPAELLGSDQIRSLMSVLENTFTHIVIDSPPVAS
FTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYCYNQYRAYYQSAETEPHKISTS
>gnl|bykdb|A0A2V8MKV0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MTQDERLIPARAGRELDRSLADFATAKPYERYGAAGVETSLRDYLFVILKRKWLILSVALVITSMAAIQQYRQPSIYDGI
AQLKIEEKPPNILSSSQIVITQRDPNFWGTQIKMLQNPSLARQVILTLDLPHNPNFLGGRANSGLFNSLKYLFSRTKIAP
APAPAASSGEQTITQDELIDKVNNLTPEEVVRLEPYEDAITANEEVDTVEKTNLVSIRYHHSDPALAQKVANTLVDVFAN
NNKESLESGTRKSAAQLGSQIGTYDELVKKERDDRIAYAKQYGLPLTPTENNVPIQREQTYNKQLLDAQNEYRKLKADYD
EAKASTELLSNPEVQKNESVLKLRDKLSELQAQRAALRQTYTDEWPDIKKLDAQIKPLEQALEAAKRQILVSMESRYKAA
EATERSLAQAYSQAHGVTAAQLDHELELAAMTQKLTSDEQYLNTLNQKERELKATGSDKGTNVSVVSYSRLPHEPTGPPR
TRNILLALALALLAGIGLAFLLDFLDDTVKSLDDVDRYIHLPTLALIPAARSEKRLREGEAPTAGASTALAMVEDVRSHV
AESYRHLRTSLLLSSAGQAPKTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSNFNISNVRGLTNFL
SGELPLDEVIQPFEKLPNLKLLPSGPIPPNPAELLGSEQMRRLLTLLGEKFAHIIVDSPPAVSFTDASILSTFVDGVILV
IHSGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLDTHGYYYGGYYGRYYYKYGYYYSDYSDDDGKKAQTASG
>gnl|bykdb|A0A2V8MM59 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=796 residues).
MNEGTKLARVETEPQDLDRRLDDHGPRPYAYGYGTNGFDGEVNLLDYWRAVRKRLWLVIGVAALITAMAVIYAARKPDVY
EAASQVRVDLENNPMYEGKTTQLIYSPVNDPAYFNTQLQILTSQGLLRRVVKTLDLEHNKGFLSPQSSQPHSTWQTIMQM
SGFANPDPKAGKQSKELPLTTSFAPATSSEDLVEAKRLAPFVGALQGGLKVEPVRESRAGYYKETRLIDITYQHGDPEVA
ARVANCVAETFVHSNLEKTNQTNTSTSEFLSKRVAELQDKIRSDEEKLVSYAKSNQILSLDANQNTVVERLSGLNKQLLE
AENDRKLAEAEYNAAKAPGAANALAEAGAKDIADSESKLSDLKQKRAQLLVDATEEAPEVKEIQQQIAELQKHLGETRSR
STSVLLTNLETRYRQTLAREQALRKSFDQQRAETLTQNEAAINYRITQQEIDTNKGLLDSLLQRSKENDVVLAGRPNNIS
IVDYAIQPDGPVGPARMRSVMLALVLSLALGVGLALFLEYLDDSVHSTDDVERLLGLPALAVIPSMSGGSTRRRLLSPGT
SLQKRNGNGTGSPELLLHVTGRSPLAESYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGASVVII
DADMRRPRLRSIFDLAEQTGLSSILSSAMTEAEMLGSVHQDEASGLHVLSSGPIPPNPAELLGSDQMRKLIAVLSAQFTH
IVIDSPPVSSFTDGVLIASMVDGVLLVVYGGKSSRGVVRRSRQLLIDVGAKIFGVVLNNVNVRSHDYYYYYQRYYH
>gnl|bykdb|A0A2V8NC68 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=808 residues).
MKESSRPTETTALVHGNGNSGEPLMQPSFRQDYRYMGEDSFQTSGGGYARLREYWCSIRKHIWLVMGIILLITMLATIYM
ARQPDVFEARARVQVDLEINNPALGSIKGNSIVLNTPYQDPTYFNTQLQILSSAGLLSRVVKTLDLEHNQAFLNPQSFNK
RSTWDSIKRMFGLSDKKEREQEQKLDDAPLVDRIAPATAREDLKEVNQLAPYIESLQGGLSVKEVNETRIIELRYRHLDP
EVATKIVNTIADTFIQSNLEKKTETSSSAGDFLQKRIADLQSEIRSGEEQLINYAKNHQILSLDASQNTVVDRLVGLNRQ
LLEAENDRKMAEASYRAALRPDAASAMVEAKSSSDADAKLNELKRKRAQLLLEYTEKYPEVKDLDEEIALLEKQTKEGKT
HATSVAITNLETSYRQAMAREQALRADFEKQRGETLTQNEAAVNYRILQQEIDTNKSLLDGLLQRAKENDVVLAGTPNNI
HVLDYSPQPKVPVGPHRMQGILLASLFSLVFGVALARYLDYLDDSVRTVEDIERTLRLPSLAVIPAIGSLSKRRLLRNVS
ALQKRNGNHPAELLLSHTDGQSPLAEAYRQLRTSVLLSSAGGAPQTLLVTSSQPAEGKTTTVVNTATILAQTGATVVVID
ADMRRPRLHSIFGLKNESGLSTILANKMSEAEMLSLVEQHEESGLYMLSSGPIPPNPAELLGSDQMRRLIAALENTFTHV
IIDSPPVASFTDGVLLSSIADGVLLVVHGGRASRAVVRRARQLLQDVGAKIFGVVLNNVNVRSSDYYYYHHYYSHYYSKV
EADVDTAA
>gnl|bykdb|A0A2V8NCZ3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MKDQDDSSNLPVPFKSARGSQLPTPVPARFTAEDDSSREGVVAYWRMVMRHKWIVILVAFLGATAGILITLPQTPIYQST
TLVEVQGLNENFLNMQNLNPTSVTGGWGYEIMTQVRVLQSRSLMEKVTERLLNDKKTPYGTSSDRLAAWRKVFHLSSKPA
IDRDRAIRMAGEDIKVKGSNTTRIIEITADSADPRLAADFANTLVDEFIEKNLDDRWKTTERTGEWLTKQMDDLKIRLEK
SEDTLQSYAVAVGLQFTGAASKDGEQENVVSTSVRLLQEELLKARAERMVTQSRFELIQSSPPEALPQVLDDPSLREYES
KLVDLRRQGAELGSSFTPAHPRMQKLEAQIAEMETALEDARQKVVTRLNNDYAAAQSHEKLLNDEFAKQLNTMSSQTAKE
IHYNILKREVETNRQLYESMLARVKESSIASAMRASNFRIVDLAKPANLPYKPSPVNNAILGLMAGIFVGVVLVLLREQA
DRSIQQPGDSALYLGVSELGVIPSDRQGRGQGTAAVIPIGNGNTKNPVELVTWQRQGSLIAESFRTVLTSIMFSEQRPRV
LVISSANPSEGKTTVSTNLSIALSEISQRVLLIDADMRRPRLHRLFDMKNDKGLSELLREKHSTKTSEVLEAARETWIPG
LHVLTSGPWAANASTLLYSARLPEIIEIARQNFDTVIIDSPPMLHIADARLLAKHCDSVLLAVRAGKTTRTAAVMAIQKF
VADGSTLLGTILTDWNPDQNGYGYDYKYYSSHAAYYTDAAIANDLEAVSNSKDASG
>gnl|bykdb|A0A2V8NJ55 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=785 residues).
MMSQDNRLLPLTSTSLDRPLSDLAQSKKYYGVSATSETHLRDYLAIILKRKWLILSLVVVVTSLVTIQMYRQPPIYEAET
TIQIEQKKNILQTKELILNTGTDPYYWNTQLKLLENPELARQVAITLDLQNNPTFFEGQASSGFFASIRRIFFGDKPAPA
HVDKVPVVVNPTIKNEQLSPEQLERLEPYEDALRASLTVEPVEKTNLVTIRFRHSNPVIAMKVADTFAQVFIYNDLQRTT
SGTQTATEKLANQIAELQLKIKADEEKLLNYKEKNDIPISTAQGVDITNVRVGSYSSQLIEAENKRKQAQATYDAARNSS
DPWSIPEIQDDKSVQRLRDRISDLEEKRASLLRTYTEEWPAVQATNDEIKQVKSELDKKPAEIINSLKLRYETALATEQK
IKTDYEHERGAAQAQGKAALDIGGLTQELETYRQLFQTLSQKQNEIDLAGNDQGNNVTVATPARLPRGPVGPARSRNIIV
AFLLSLGVGIGLAFLLDYLDDTVKSIEDVDRYIHLPALALIPGQRSERSLLKSKNPPPNTGKESTALALIEDVRSPIAEA
YRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTAVNTAVMLAQTGAEVLIIDCDLRRPRIHTHFNISNVKGLTNCLSGD
LNTDELIQAYEKLPNLKIMTSGPVPPNPAELLGSDEMRKLLNSVSERFTHVIIDSPPSISFTDASILSTMVDGVMLVVHG
GKSSRAVVRRAKQQLLDVGAHIYGVVLNNVKPEGSNSYYYYGYYSSYYESSEEDEEMAAEGARAE
>gnl|bykdb|A0A2V8NW86 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=818 residues).
MDKHELPPTSHELVPRKSTEAYPGHGEAGSYLHGRRDEFEHGGFVEDWRILCRQKDILAWITFLGALAGVLLTIWQSPVY
RARTALEIQNINEDFLNIKQVNPVSEGDSSTVLTEIATQVRLLQSESLIKRVLTKLRDRFAEDPKVKTSRFSLWRKAVLP
ELKLSDESGAVQAAAESLKARASGLTRVVEASYDSTDPRFAAAFLNTLVQELMESNMEARMKSSEYTSQWLSRQLEDMRI
KLEHSEDALQSYARSTGLIFTSEKTNISEEKLRQLQGELSKTQADRITAQSRWQGTTTSPPDALPDVLNDSSLRSLQEKL
TELRRQKAELITIYTEKHNKVKQVEAQIASLEAALQKERTAIVDRIRNDYETALRREKLLSAEYRNQSRLVTDQDEKSIQ
YGILKREVDSNRGIYEAMLQRVKEANIASAVRATNVRIIDAAEPPKRPYKPSLPVNAAVGLLSGLCIGVAFLVTRGRADR
TLRAPGEAQLWLNVPELQVIPTAVEESGRCLDTERCDKTTTLLPSRQQRDPGLPKRTSEHADSLSVELVTWYRKASLIAE
SYRSLLTSILFSGSNGLPERTSKQADSLSVELVTWYRKASLIAESYRSLLTSILFSGSNGDCPRVLVLTSAGPKEGKTTV
ATNLGIALAETKRKVLIIDGDLRKPRMHELFDLPNGHGLSSLLRDPQRAVAKLSRIVQETKIPGLFVLTSGPLTKNAADL
LHSADLSGLVAKIKLEFDFVIIDTPPMLQMADARVLGRMADAIILVTRAGQTTRDAAEAATWRFTEDNTRVLGTVLNGWD
PKETSYYGYRYPFCRYHY
>gnl|bykdb|A0A2V8P7N1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=722 residues).
KVQVDSETANNPAIGALKGNPIFLNNSSQDPTYFNTQIQILTSAGLLGRVARTLDLEHNQAFLHPQSAQDLSFGESLKGL
IGLRKSQSKTKEQEGYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKQLSDTRIIEIRFKHQDSEIAEKINNTIADTF
VVSNLERKTETTNSAGDFLQRRIDDLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENERKAAEAA
YRAVLAPGALEAQAEATSNKSSATPEAKLAELKQHRAQLLLEYTEKYPEVKDVDQQIAMLEKQVDQSRRHTESMVKTNLE
TSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAAIPKN
PIGPKRMQAIVLAALFALIVGIALARYLDYMDDSVRTSDDVENFLRLPALTVIPTVGNSARRRLLSAMPGSKRNGHQGGP
ELLLNGSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVIIVDGDMRRPRLHSIF
DVDNDKGLSGILASKMSEAEMLNCVQQHEESSLYLLPSGRLPPNPAELLGSDQIRSLMSVLENTFTHIVIDSPPVASFTD
GVLLSSVADGVLLVVHGGAASRHIVRRSKQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYREYYHSTADIQPTEISPSTA
DS
>gnl|bykdb|A0A2V8PFE8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=817 residues).
MNQATKLVKREDEPGEIDRRFDGSANYRGPVYGYGPESSEGEVHLLDYWRAIRKRLWLVLGVAALITALSTVYVARKPDV
YEAKSQVQVDLENNPMYAGKSVPMIYSPVNDPAYFNTQLQILTSPGLLRRVVKTLDLEHNQAFLRPQSLRQPSTWKTILQ
MWGVSGPEKKDPSTQPKELPLTSTVAAATSNDDLAEAKRLAPYVGALQGGLKVEPVRESRAGYYKETRLIDIVFQHGDPE
VSAKITNAVADTFVRANLEKKNETNTSTGEFLSKRVAELQQQIRADEEKLVSYAKNNQILSLDASQNTVVERLAGLNKQL
LEAENDRKMAEAEYNAAKAPGAATALAEGAKDINESESKLADLKQKRAQLLVDATEEAPEVKEVDQQIAELQKHLHESRA
RNTNTLLTNLETKYRQSLAREESLRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPNNI
SIVDYAITPDFPVGPARMRSVMLAFVLALALGVGLALFLEYLDDSIHSTDDVEKFLRLPALAVIPSMSGGVARRRRLLSS
ATALQKRNGNTSGTPELLLNVNGRSALAESYRQLRTSVLLSTAGRAPKTLLITSSLPGEGKTTTAVNTAITLAQTGASVV
IIDADMRRPRLRSIFDLPEREGLSSILSSEIKPEDMLHAIHRDEATGLNVLASGPIPPNPAELLGSEQMRKLIAVLSGAF
THIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQLLTDVGAKIFGVVLNNVSARSHDYYYYYQRYYHQS
YYSHDVESDGADERASA
>gnl|bykdb|A0A2V8PJY0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=806 residues).
MKEPTELIEKSNGSRDVGGPWDRSLAPYTRYDSYADDSNGYSRLRDYWRSIRKHVWLVIGIVVLLTGLTAVYMARQPDVY
ESASRVQVDSETANNPAIGALKGNPIFLNNPSQDPTYFNTQIQILTSAGLLGRVAKTLDLEHNQAFLHPQSAQNLSFWES
LKGLIGFKKSQSKTKEQEEYVLRPNSALSNDDIAEANHLQPYVEMLQSQVSVKPLSDTRIIEIRFKHQDSEIAGKINNAI
ADTFVVSNLERKNETTNNAGDFLQRRIADLQSEIRSDEEQLINYAKNHQILSLDASQNTVVDRLAGLNKQLLEAENDRKA
AEAAYRAVLAPGALEAQAEATSNKSSAATEAKLAELKQRRAQLLLEYTEKYPEVKDVEQQIAMLEKQVDQVRTHTESVVK
TNLETSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYRIIQQQVETNKSLLDGLLQRSKENEVILAGTPNNVHVVDHAA
IPKTPIGPKRMQAIVLAALFALIAGIALAHYLDYMDDSVRTSEDVENFLRLPALTVIPTIGNSARRRLLSAMPGSKRNGH
QVGPELLLNSSQRSALAESYRQLRTLVLLSSAGGAPKTLLVTSSQPGEGKTTTVVNTAMILAQTGAKVVIVDGDMRRPRL
HSIFNVDNDKGLSGILASKMSEREMLGWVQQHEESSLYLLPSGRLPPNPAELLGSDQIRTLMSVLENTFTHIVIDSPPVA
SFTDGVLLSSVADGVLLVVHGGAASRHIVRRSRQLLSDVGAKIFGVVLNNVTVSKHDYYYYNQYRDYYHSAADTQPAEIS
PSMVDS
>gnl|bykdb|A0A2V8PWS6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=817 residues).
MNQGTKLVKREDEPGEMDRRFDDAANYRGGVYGYGPEGSEGEVHLLDYWRAIRKRLWLVLGVAALITALSTIYVARKADV
YEASSRAQVDLENNPMYAGKSVPMIYSPVNDPAYFNTQLQILTSPGLLRRVVKTLELEHDQAFLRPQTLRQRSTWKTILQ
MWGVSGPEKKDPSTQPKELPLTSTVAAMTSNDDLAEAKRLAPFVGALQGGLKVEPVRESRAGYYKETRLIDIAFQHGDPE
IAARITNAVAETFVRANLEKKNETNTSTGEFLSKRVAELQQQIRADEEKLVSYAKSNQILSLDASQNTVVERLAGLNKQL
LEAENDRKMAEAEYNAAKTPGAATALAEAGAKDINESESKLADLKQKRAQLLVDATEEAPEVKEVDQQIVELQKHLNESR
ARNTNTLLTNLETKYRQALAREDSLRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPNN
ISVVDYAITPDFPVGPARMRSVMLAFVLALALGVGLALFLEYLDDSIHSTDDVEKFLRLPALAVIPSMSGGVARRRLLSS
ATALQKRNGNPGGNPELLLNVNGRSALAESYRQLRTSVLLSTAGRAPKTLLITSSLPGEGKTTTAVNTAITLAQTGASVV
IIDADMRRPRLRSIFDLPEREGLSSILSSETKPEDMLHAIHRDEATGLNVLASGPIPPNPAELLGSEQMRKLIAVLSGSF
THIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQLLTDVGAKIFGVVLNNVSARSHDYYYYYQRYYHQN
YYSHDVESEPGERAASA
>gnl|bykdb|A0A2V8PYY8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MTQDERLIPARAGRELDRSLADFATAKPYDRYGATAVETSLRDYLFVILKRKWLILGVVLVITSMAAVQQYRQPSIYDGI
AQLKIEEKPPNILSSSQLVIVQRDPNFWGTQIKMLQNAQLARQVILTLDLQHNPNFLGGRANGGLFNSLKYLFSRTKNAP
SPAPATGSSETTMSEDELKNKISNLTPEELVRLEPYEDAIIANEDVGIVEKTNLVTITYHHNDPALAQKVANTLVDVFAN
NNLERLESGTKKSAEQLANQIATYERKVKEERDARVAYAKQYNLPLTPTENNVAAQSEQAYNKQLHDAENERRKLKADYE
EAKGAADLISNPEVQKNESVMKIRDKLTELQSQRAALLQTYTTEWPDVKKLDAQIKPLEQALEAAKRQILASMESRYKAA
EATEKSLAQAYSQAHGVSTAQIQHELELAAMTQNLTSDEQYLNTLNQKERELKATGTDKGTNVSVVSYSRLPHEPVGPQR
TRNILVALALAFLAGIGLAFLLDFLDDTVKSLDDVDRYIHLPTLALIPAARSEKRLREGDAPAAGASTALAMVEDVRSHV
AESYRHLRTSLLLSSAGQAPKTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHSNFNISNVRGLTNHL
SGELPLDEVIQPFDKQPNLKLLPSGPIPPNPAELLGSEQMRQLLTSLGERFAHIIVDSPPAVSFTDASILSTFVDGVILV
IHSGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLDTHGYYYGGYYGRYYYKYGYYYSDYSDDDSKKTQAASG
>gnl|bykdb|A0A2V8Q7I0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MPAVDRGLEKPQTDQIRSYGPAANEPTQLRDYLFVVLKRKWLILSLCLVVTSLVAVQMFRQPSIFQAETTIRIERKQNVL
VSKDFVLNSQPDANFWGTQITLLQSPALARQVALTLDLQHNPTFFGGQSQGGIFASIKRMFAGDKAKPKISAPGPTGLDV
VRAAQLRDQPLSPEELAALEPYEDTIIANEDIDGIVHTNLFTIKYKHHDPEMAQKIANTLAEVFASNNIDSQTVNSKDAG
DLLEREISEMQGKVRTKTERLFNYAREYSLPLTEDVMLNTEAQRLADLTKQLFESENKRKNAEAVYKSASTATDKFSIPE
VQKSGRVTALRDRISALREKRETLKVTYTDKWPEVLKLDAAIKPLEAELDRAADEIIARLKSEYQESYAHENSVRAMYNS
QHGTATQQTRNQIEMAQYKQELETDKQYLNTLMARKRDVQTSNTDRANEVSIENYSRIPRSPIGPARLRNVMIAFVLSLV
AGIGLAFLLDFLDDTVKSVDDIDRYVHLPALALIPASRGDRGRLKGVVPATAGGPSETTALAMIDDVRSPIAESYRHLRT
SLLLSSAGQPPKTILVTSSQPSEGKTTTAINTAFMLAQTGVDVLIIDCDLRRPRLHAQFEISNARGLTTWLSGEKDLDGI
IQTCPRVPHLKILTSGPVPPNPAELLGSEEMRRLLGQLGERYAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRA
VVRRAKQQLLDVGAHIFGVVLNNVRLETQDYYYSGYYSSYYSDAESGGDSARESA
>gnl|bykdb|A0A2V8QMP4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=790 residues).
MMQDNRLLPLTPETLDRPLRDLAQPSPVAVSSNEPVNLRDYLAVVLKRKWLILSLMVVITSLVAIQMYRLPSIYEAQATI
QIEQKKGGVLQTAGAGNLIIRGSDPNYWNTQLQKLKTQKLARQVILRLDLQNSPAFFGTNRGTGVIAGLRHIIARGKPTP
TPQPAAGGVPVLSDAELSADQIAPEQAQALEPYEDAMRAGLNIDAVEKTNLVEIHFQHTDPEIAASVANTLATIFRDNDI
QEETTGSQKAEDVLANEIIDLQARIQANEQKRINYRKENDLPLGTKQGQDLNALQLSTYSSQMQTAEAAYTSAEQTKNTS
GIWAIPQVQSNPTVVKLRDKIGELEEQKAALLVNYTPEWPAVQKIEKQLKSLHEQLDKMPDEIIAGLENRYEAAVKNERS
ATGSYFAARAKANDQSVADTKLADLDQQIATDRQNLNLYMQRANELKVTAPDRASGNVTMVEEARTPREPIGPPRVRNII
IALLLSIAVGIGLAFLLDYLDDTLKSIEDVDRHLHLPTLALIPAPRESRRLLARSGHEAEPATTTALALIEDVRSPVAEA
YRHLRTSLLLSSAGQPPKTVLVTSSQPSEGKTTTVVNIATMLAQTGADVLILDCDLRRPRVHAHFGLPNSRGVTNYLSGE
AQVSELVQTYDKLPNLKVITSGPVPPNAAELLGSEEMRRLLYVLSENFTHIVIDSPPAISFTDASILSTMVDGVMLVVHG
GRSSRAVVRRAKQQLQDVGAHIFGIVLNNVKLEGTDYYYYSGYYSGYYSDEEAAPEGAAAAAEAGGGRGV
>gnl|bykdb|A0A2V8R4S3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MMQDNRLLPLTPETLDRPLRDLAQPSPVAVSSNEPVNLRDYLAVVLKRKWLILSLMVVITSLVAIQMYRLPSIYEAQATI
QIEQKKGGVLQTAGAGNLIIRGSDPNYWNTQLQKLKTQKLARQVILRLDLQNSPAFFGTNRGTGVIAGLRHIIARGKPTP
TPQPAAGGVPVLSDAELSADQIAPEQAQALEPYEDAMRAGLNIDAVEKTNLVEIHFQHTDPEIAASVANTLATIFRDNDI
QEETTGSQKAEDVLANEIIDLQARIQANEQKRINYRKENDLPLGTKQGQDLNALQLSTYSSQMQTAEAARKQAEADYKSA
VETRNTSGIWAVPQVQSNPSVLKLREKMGELEEQKAALLVNYTPEWPAVQKIEKQLKSLHEQLDKMPDEIIAGLENRYEA
AIKNERSATGSYFAARAKANDQSVADTKLADLDQQIATDRQNLNLYMQRANELKVTAPDRASGNVTMVEEARTPREPIGP
PRVRNIIIALLLSIAVGIGLAFLLDYLDDTLKSIEDVDRHLHLPTLALIPAPRESRRLLARGSHEPEAGTTTALALIEDV
RSPVAEAYRHLRTSLLLSSAGQPPKTVLVTSSQPSEGKTTTVVNIATMLAQTGADVLILDCDLRRPRVHAHFGLPNSRGV
TNYLSGEAQVSELVQTYDKLPNLKVITSGPVPPNAAELLGSEEMRRLLYVLSENFTHIVIDSPPAISFTDASILSTMVDG
VMLVVHGGRSSRAVVRRAKQQLQDVGAHIFGIVLNNVKLEGTDYYYYSGYYSGYYSDEEAAPEGAAAAAEAGGGRGV
>gnl|bykdb|A0A2V8R8U7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=791 residues).
MIQDERLVPAGRGLDNSLADLTQAKPFGRYDRYNSAPAETNVREYLYVILKRKWLILSLVLVVTSLVTIQAYRQPSIYEG
GTTIRIESKPAPVLATGQVIINAPADANFWGTQLKLLQNPQLARQVVLSLELQKNPSFLGGQAQSSVFASLKRIFSGERI
ATPPAQNPAAEQTVTMDEMKDRQLTPEELATLEPYEDAIIANETIEPIIGTSLVTIRYQHTDPALAQRIANTLADVFVQN
NRERLDIGTSKAVESLAQEIAKYQDKVNKEQDARFAFAKAKDLPLGPESGPNIEAVRDATYSSQLLAAENERRTFLAIYE
AAKNAPDPFANPEVQKDERILRLRGKISDLKDKLTFLRQKYTDEWPDVKQASAQIDELEKELKKAPQEVLASMKSRADAA
EAHERSLEKAYSVQHGKTVSQTRNVIDLAIKTQELTTDAQYLNTLMQKRRELAAGGADRGTDVSVSNYSRTPQLVGPQRM
RNIMIAFVLALVAGIGLAFLIDYLDDTVKSLDDIDRYIHLPALALIPSVRSEKRLRGAEPLKPSDTTALAMVTDVRSPIA
ESYRHLRTSLLLSSAGTPPKTILVTSSQPSEGKTTTAINTAFMLAQTGADVLIIDCDLRRPRLHSHFNLSNTRGLTNCLS
GESEVADLLQTYDKLPKLKLLTSGPIPPNPAELLGSEEMRKLLVSLSEKFTHIIVDSPPAISFTDSSILSTFVDGVILVV
HGGRSSRAVVRRAKQQLLDVGAHIFGVVLNNVKLESTDYYYNTYYSSYYRTDESDVQGGADAGQNSRAASS
>gnl|bykdb|A0A2V8RQV0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=839 residues).
MEQEQRLTTLPHLGELRHSKHEYAGSYSGAYSDEVIEGRRTVQQYFNIVYKRLPLILALTILVTAAAAFYMYRQASVYQA
STQLVIEPRKPKVTSKDSININFGNDANYYNTQLELLKNPELMKKVVISLGLYRNKTLFGGQNAGILAGIKSLFSRSKAQ
TEEANALPVISDTEQLNSKGELAKLSPEEEALANQHVGNLIGRLQIVPQERTNLVNVTIQNEDPALAGKVTDEIAAIFIE
EDKERETQGERKAIEDLTKSIEELKLTIQDQESQLMAQMRESDLPLLEKGQDLAAQRLGAMSEAYMKAMETRRQLEATLN
AAESANARGEAVNIPSIGENKIFQDTMRLNTERKAKLQDQIRDIEKQIQQTEVEKSELLVKYTEAYPEVGKKDAKIASLR
ETKEKTEKEVSKIIDTDQKKIEKEAVSGALVSLRAQLNAARTQEAQAQAAYEQESGTANVQGQAQTKMITLKREIETNRN
LLDTYTQRLKEQELSRANDAPENIKIAANAGPAILVGPPRGRNIFVAFLFSLAAGIGLAFLMDYLDDSVRTSEDIGRHLG
LPTLGLIPHHGIAERRRLMAAGNGAALSPHAAALITLEERNSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEGKTT
TAINTAITLAQSDVDVVIVDCDLRRPRVHSYFDLDNTQGLTNYLSGERNTENLIKSSRELPRLKVITSGPIPPNPTELLS
SNEMKNLMQFLRGKFKHIIVDSPPAISFTDAAILSTVVDGTILVAMANRSSMHLMRRFKQRANAIGARIYGVVLNGIKSG
SIEYEYYGTGYYDYYGKAKDDTSTPIMETNGNGHAEESE
>gnl|bykdb|A0A2V8RTL7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=832 residues).
MKEIRELVPTKPNDTVVELERPFETHVIPGTGRYPAYRDVYGPEGFQIVDYWRAIRKRLWLVVGIAVLITTLAAIYMARK
PNIYLASSVVQVDLEQTNPDLITNDRQRVLSNPDPSYFNTQLQLLNSDTLLRRVVKEHNLDANKDFQAAKNAHGTSAWRS
MMKAVGLASDKSSNSPDANTQKSEETNSSLVSADEIAEALRLSPYVDLIKEDLIVEPVRESRATVKDTRLIEISYRNTNP
ELAAFVVNAIGETFVNANQEKRSGTSRKTSDFLQKRINDLQTDIRGDEIKLVELKQSEGILKTDGDQTIVIDRLSGLNKQ
LLEAENARKLAEAKYFAIKDSPESLNALAEQDSQRYITERENSVLQLRTDVRKKINDLNAEKARKLEDYKETAPEIIEID
KQIASLEDSLEKLLEKNNKDIQAYKERSATILLENYKTQYQQAKDQETKIRSAYDVQYNEAQGQNSGAVMIKLLEQTIET
NRGFLDNLRKQQSGNDVASQGSDNNISVASFGIPPEAPVAPRRLMTVVAALLLSSLFGMGLALFLEYLDDTINTTEEVEN
LLQLPALTAIPTIDSIPKRKLLLVGGKGEEVEEDRLNSELLIFADPRSSLSESYRQLRTSILLSTAGHAPKSLLITSSLP
SEGKTTTATNTAISLGQTGAKVLIIDADMRRPRLHSVFNVSNNQGISTVLSSELSTKEILDVINYDERTKVSVMTSGPIP
PNPAELIGSEQMVGLLKTLQSEFTHVVIDSPPITSFTDGVLLASLVDGVILVVHSGKSSRQVVRRARQLLIDVRAKVLGV
VLNNVNLNSQDNYYYYQSYYYRNNYRHTDEGE
>gnl|bykdb|A0A2V8S6K4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=803 residues).
MSQDNRLLPLPTPAGNIDRPLRDLTQPAVQVTGSYSLPEPTHLRDYLNIVLKRKWLILSLVTVVTTLVAIQMYRLPSIYE
AKTTIQIEPKRNALIKTKDIVVNAGADPAYWGTQLKLLENPSLLRQVIMRLGLQNNPSFLGGQSRPSIFTTLRRAFSRNK
AQTNEQPQPADGGLTVANEAAPGDELKLTPEQLKQLEPYEDALAGNLTVDPVERTSLVDIHFKHTDPELARQVADTLAAV
FIENDRARESKGTEDMKVATARQITDLQAQIAELEKKRTDALVQSGSAVNPEAKGANVTVERVAMLSTEWLNAQNEVTKL
QSEYDAAQKAQAASDIFSIPKVQDNKQIQDLQIKLAALNEQRVALLKQYTENWPAVQKVEAQIKQTEDAQQKIAKAIVIG
MGASLDGAKKRAASLQAAYYKERSAAQAQGIQVIGLSNVEQQLTTSKQMLSTLLQRRQELETADIEGQSNNVIIQTPART
PQLVGPPRVRNIIIALLLALGAGIGLAFLLDYLDDTLKSIEDVDRHVHLPTLALIPAPREARRLAFGRTAHVHDHTESTA
LALIEEVRSPVAEAYRHLRTSLLLSSAGQPPKTMLVTSSQPSEGKTTTAVNTAMMLAQTGAEVLILDCDLRRPRVHMHFN
LPNTRGVTNYLSGEINVSELIQTYDKQPNLKVITSGPVPPNAAELLGSEQMRRLLQLLGEQFTHIIIDSPPAISFTDASI
LSTMVDGVVLVVHGGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLEGNDYYYGYGYYSNYYAHDADEEETSGPAQARAG
GQP
>gnl|bykdb|A0A2V8SEX6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=826 residues).
MKETREIIQKPLNEPVELERHFEPQIVPAGRYPSYRENVAEGFQLLDYWKAIRKRLWLVAGIAVLVTTLVAIYMARKPDI
FSATARIQVDLEQVNQDLVTSDRQRPISNPDPSYFNTQLQLLDSENLLRQVVKEHSLDTNKEFLTARSEGTGILRAMLRA
VGLASDPKKDTAPNDEFAASANSSLISSDEIAEAVRLAPYVEIIRKNMSVEPVRESRATVKDTRLIEISFRHTNPQLAAF
VVNSIGETFVTANQNKRSGTNRKTSDFLQRRITDLQSEIRSDELELAELQKNIGILKTDGEQTIVLERLAGLNKNLLEAE
NKRKNAEAQYVAIKDSPEAINALAEQDNQRIIQDRKLAIIAYRNDTQKKISDFRSQRAKLLQEYKESAPEIVEIDTQIRS
LEDSLTKLVDENTTEVQKLQERASKLLVDNLRTKYLQTKNEEDKIRAAYDEQYNAAQVQNGGAVRLKLLEQTIETNRGFL
DNIRKQQSSNDVASQGSDNNISVAGFAIPPEHAVSPSRLMTVFAALFLSTLFGMGLALFLEYLDDTIRSTEEIETYLQLP
ALAAIPTIDSIPKRRLLLVGASNEEVEDPGNNSELLISADSRSALAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKT
TTATNTAISLAQTGAKVLIIDADMRRPRLHSVFNIENGDGLSTILSTEMTEKEILKVVKQDEGTKLNLLTSGPIPPNPAE
LIGSEQMANLLKLLSQNFTHVVVDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVRRARQLLQDVGAKIFGVVLNNV
NLRSQDNYYYYQSYYHRNNYRPSDEQ
>gnl|bykdb|A0A2V8SJH5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=848 residues).
MEQDQRLTPLPKSLDLRASKTEYPATYAGFYDDEVSEGRRSIQQYFNVVKKRLPIILAITLLATVAAALYMYKQPSLYQA
TTEMVIEPRKPKVQSKESININFGNDANYYNTQLELLQSHDLMKEVVIRLGLYKEADVFGEEDRGLLSGVRSMFSSRKAN
SGPDNSLPVVSELPAGTDASDNIQLTPEERARVENYAAMLAGRVTVQPKERTNLVNVSVTTPKAELSARVADKVEEVFID
KDAQRETEGSRRTYEDISKSIEELGKTISEQEADLISYMRSSGLPLQEKGQDLSAARLQSMSETWLKAMEGRRQLEARYT
AAAQAGARGEGMNIPDLSESKIFQDTIRLNTERKAKLQDQIRDIEKKIQDSEVEKAELLVKYTPEYSKVKVVEERIASLK
ATKDRTESEVSTIIDKDQKKIEKDAVNGALVTLRSQLSAAQKQEAQSLAAYEQEASQANVQGQAQTELITKKRAIETNRN
LLDTYTQRQKEQELAIASGRPENIKIAANAVTPGGPIGPARTRNILVAFLVSFGVGIGLAFLLDYLDDSVKTSDDIGRHL
GLPTLALIPHHFGSEKRRLKLIAANGNGLANGNGNGNSATATGLITLAERRSPMAEAYRHLRTSLLFSSAGKPPQSILVT
SSQPSEGKTTTAINTAVTLAQADADVVIVDCDLRRPRLHTYFDLENTQGLTNYLSGERNTEHLIKTCRELPRLKVITSGP
IPPNPAELLSSNEMKNLLQFLRGRYKHVIIDSPPAISFTDAAILATLVDGVVLVAMAGKSSIHLMRRFKHRLGTIGARIY
GVVLNGIKAGSMEYDYYGTGYYEYYGKSETDLSTPVMEEVESIHTTKP
>gnl|bykdb|A0A2V8TCE6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=746 residues).
MTSPREAESEIREFWSILVRRQWAIYTVAGLVLGLTALRLLMVQSTYKAKALVEIQRSSPDVLAFRDIIRTDPSYQGYSA
FYETQYRILQSRAVARRAAERLDLPRHPLLPRKSPGLLQRTLAALRRALPRGEAHAAPAEPMGPFIDLVLAGLSIEPVKD
SNLVEVVYLSPDPRFCAQLANAVADAYIEFALSSQFDTTEQASDFLSRRVGELRDEVEDLEKRLQSYRESRRILPSAGAE
NIALKGVSDIDAIYLQARARRIATESEWTAARGTDPSSLPAVVENPTVQRLQHEVNDLEIQRAELLRTFKPGWPQVEVLT
RKLEGARQQLSSETEAIARRIVSAEQAKYRAALDEEERLGKLLEEQKSEAQRTGRDSIEYATLQAEVERKRAVLNALLQR
QNETAVSSQLRDMNAGNARIVDRAIPPTAPCKPRPGVELPLGLFVGLLLGMGAAFGMESWDNTLRTQEEIERFLGTPTLA
RIPSASLDPQRRGGPAWGTGEIDLMSHHHPSSPLAESFRDLRTALSLSSAGSTPRSLTVASTRPEEGKSTIAINLATVLA
QSGKKVLLVDSDLRRPRLHRAFGLRNGSGLSTFLCGKASLEEAVQMTLVARLWLLASGPVPPNPAELLDSACFDELLKMV
LDSYEMVVLDSAPLLTVADGAILASRTEGTLLVVESDRTTREEALRAREKLRQVSARLLGVVLNNAAESGRSYGRYRYRY
EPSADSGAADARRAPFRRAAGLLRMR
>gnl|bykdb|A0A2V8TLH7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=717 residues).
MSENLPIVEEQREVHLLDYWRTISRGRWTILSVFVVIVTLVAIGTFTQKPVYRARATVEITSQASKVAPVADVSQLGTSN
FGWSAEERYFNTQNEIIKSRDVAQRVFDKLDLYHHPMFRKSSDPVGVFSSMVQVELIKDTGIMQITLDGPEPKEVQTWVN
SVAEAYVDRNLDLSIEATGRAVKALLSEIAPMREKLQDTQRSSFELAEKENLYVPENQQKITNDRLSALQADYTETQVKA
AELESVLKRVDEVRQNGGSYEVIPQISGDAVVQDVYREKAILERDLEKLSVTYKDKHVRVLEKQSEIDKTNQKLASEVDR
IISNLRTQYALLKDRESKLAVAINETRSESLRVNQKASNYELMRTEALDTKRIYDLISARVKEIDLSASLLSNNLRVLDR
APLPQMPIRPRPILNLLIGVMLGLLLGVGTVFFLDYMDNTVRTSEDVERYLKLNILAVVPRDNDATRRAVREAYQTLRTS
LLFSRKARTANAVLVTSAGPQEGKSCTSVNVARTLANAGEKVVIIDCDLRRPTVHQWLKLSKDQGITNYILSTEGDDWRT
YLKTTDQSNLYALTSGPIPPNPADVFGHERFKRLLKELRQEFDWVFVDSPPAVSLADAMILASLCDMVAFVVKHNENDKD
LIRRCVGDLRKINANVIGAVLNNIDLERSDYKDYYYVGYYYYGESSSSKKDRKRRSTTSLETVDDQGVEGKVTRIVG
>gnl|bykdb|A0A2V8TTB0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=745 residues).
MKKFENNLPAVPEVYRAAAPVPVIDAEFEPQAPQVPLAHYLWILRKHGWTIAGFVVAAVLGTLIVSLRLTPVYESTVTVD
IDRQMPTGVLGPESLQNATNDADQFLATQMKLIQSDSVLRPVVDKFRLREVEKDALEQPSERWQGSDEAPVILKYLKITR
PPNTYLLLISYRSPNRQLAADVANAIALSYLAHTYRIRYKATAGLSEFMERQLEELRAKMEKSSAALAQFERELNVINPE
EKTSILSARLLQLNTEYTNAQGDRVKKEAAYNSIQSGSLAAAQVSSQGEALKKLTENLNEAKERFAEVRNHYGINHPEYR
KAQTKVQELETQIADTGASIAQRVEIEYREAVNREAMLEKAVAETKAEFDRLNARSFEYQTLKREAESDKKLYEELVRKI
KEAGINASFQNSSIRVADPARPGLKPVFPLTWLNVLLAFLFATFLGVGAAVLTDVLDNTIRDPDQVARLMNTNVVGSLPT
VKDWRRRLSPISSSGSANGHRNGNGAIPAPPNGAVPAADNTDQALSNYEEAIRTLRTSILLTDFDRSLRSVLLTSASPSE
GKSTVAAHLAATHAGQHKRTLLIDGDLRRPSVHRLYQVPNSVGLSNVLLQQISWRDVVIRMDDPKGLDVLPAGPPTRRAS
DLIGSGVAELIEEATREYDLVVLDAPPLLGFAEPLQMATAVDGVIVVARAGDTSRKALSSVIGTLARLRANLVGVVLNEV
HRKVSAGYYYYYGHYSKYYGRTEDK
>gnl|bykdb|A0A2V8U914 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=705 residues).
MRVLYRRRVTLLSVTLAGVFIAALLSMAQPRLYRSVASLEVQGVNENFLNLRDIDPAATPNASSNDVYVKTQSEILQQDA
LIEQASDKLNLAERPEFQPHSGFWERLREASPRAAQNAAQYAADVARKHLKIEPARDSQIIRVAFDAHDPQLAADFANTL
ARTFIEQSVNGRRRAAQEIQEWLGPRIQELRSKLQTSEAALDEYTRESGLVLAPGDDTLAADKLRGVQDELSKAQSDLIA
KQVQFDLIAKNPAEITTENPGIRDYETKLTDLRRQLADLESILQPESYKVVRVKAQIVQLEAAIARESRRVRQSVQNDYV
AAQRRQTGLASVYARQSALVSKMTAKMTHYNTLKHEVDTNRQFYEAMLQKVNEAGLASAVRQSNIRLVAPAEPAFRPYKP
NLPLNLSIGLFAGLVLAVGSVMLTEQTNSRLRAPGEASFYLNLPELGTIPSAESLEPALQKLIGTENGKQPVERITWDKR
FSKMSEAFRATVASILSAEQNGDHHDVLVITSPLAGEGKTTVSSNLGIALAEVRGRVLLIDGDMRRPRLHKIFGLANSWG
LSDILRERNATEDLPLDALVKKTGVPRLYLLPSGPCTDSIFSLLYSERMARLMQRFRQEFDYVIVDAPPCLEFADARILA
RYAEGVLLVLRANYGDKKTALAAANRLFLDGVPVLGTILNHWNPVVWGDAYGYPSYRGVYDQTAS
>gnl|bykdb|A0A2V8UZY0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=769 residues).
MSKYFELMNRLRRDSPLAVSACDIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASDEMFAAGLWRIIQDRK
WTITAFALVVVAIVLTASYYMKPRYEAVGRVVVVFHRENDSGVLGFKGVDTSLLEDPEDRAAIDTQIGILQTDALAMQVI
KDLHLNKNPKFTGRVEQPDNEDRLVKSFHKSLRISKVKGTRLIEIKFRSTDPRLSADVVNSLAKEYVDHYYRSQFQVNAQ
ISSFLANQLKELQSKVEESQQRLLAYQKQSGLFGLDNKQNLVTAKLDDLNRGLTAAEADRIQKEVNYRLAVSGRPELIAK
LEPDNLITRLRAQLADLENQIAQASVQLGPAHPKMVELSKQLDQARRSVDAEVNRIGKRITYEYQSAVGRERILQDALEA
QKQTADKLYANAVQSEILKHEFETNRKLYEDLLQKQKEVGISASLKSSNIWIVDPARPPKLPVEPDIRRNFALSLLFGIF
GGVLLAFGLAKVNEKTIITLEQARLLSPLPALGVLPLLKTMSRNGAARQLTGVGGDVKPELVSLLQPLSLAAESYRAMLT
PLMLSAATPPGIILVTSAVPGEGKTTVCTNTAILLARLHRRVLLVDADLRRPSIHRAMRLSCNTGLGALLRKSVTFDEAV
IQRAEVPNLYILPAGPVMLPDDTELLVSGFKDLVDHWRDQFDHIIIDTPPVLAMTDAVRMSVEADSVILVIRSGQIARDT
FLRAQDLLRRVNAHVAGFVLNGAQVDSSDFRYYYSYHSQHQTKSLGEGR
>gnl|bykdb|A0A2V8VC99 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=714 residues).
MPETLAPLEEKRDVHLLDYWRIIWRGRWTILTIFVVVVTLVAIGTLTQKPVYRAQATIEISPQSRKVSPVADVAEMGASQ
YGWFAEERYFNTQYEIIKSRDVARRVFDRLDLYNHPLFKETTDPIGTFSSAIEVEPIKDTGIVVIGLEGLNPEEVAAWAN
AIAEVYVDRNRDQAVEATAKAVRALLSEIAPLREKLKDSQQSTFEFAERANLYVPENQQKITNDRLSTLQAGLTETQVKK
GELEGLLKQIDSVRLSHGSYENIQQISGDPVVQELYREKVGLEREYERLLVTYKDKHIRVQEKQKEIDEISRKIASEVDR
IINGLRAQYELLKDREAKLIKVSDDTRAESLQVNRKASSYEMVRGEEAETKRIYDLISIRVKEIDLSSSLMSNNLSILDK
APVPKVPVRPRTVLNMAIGVLFGLLLGVGTVFFMDYMDNTVRTSEDVEQYLRLNLLAIIPKQSDETLSAVKEAYQTLRTS
LLFSRKNRSANTVLITSAGPQEGKSCTTVNVARTLATAGERVMILDCDLRRPAIHTRLNLSRDHGVTNYILSSDGDDWRN
YIKASDLPNLYALTCGPIPPNPADVFGHERFLALLKELRSQFDWVFIDSPPVVSLADSMILASLADMVAFVVRHNENDKE
LIRKCVTNVRKINSNVIGAILNNVDLERSHYKDYYYVGYYYYGTSGGKRGRRRKGSSSIAAVPTTDAEEKRSVG
>gnl|bykdb|A0A2V8VZA0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=767 residues).
MADENKLVPRENGSSGAVEVVSLSNRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR
VEIDRENANILPFQGTDSYDYMMDLENYIETQSKILTSETLALQTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLGELKIRVQRSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLLKKRSDAASQYNDA
LAQYGPNFPKVQRLQAQLKEFDQTIEKEKQKILDVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNVALAFLVGLVGGMGLALMREYLDNTVKSPDDVET
LSGLPSLAVVPQFAGSNGNGKRHGLLQGLSSNGHDKRIELVAQHLPKSQMSEAFRALRTSILLSQAGHPPQVILVTSALP
REGKTTAAGNLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAGGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLVDAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLNSVKCRILGV
VLNAVDRYYPYSYGYGPQEAVEAPHEEDSDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A2V8WIU1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR
VEIDRENANILPFQGTDSYDYMMDLENYIETQSKILTSETLALQTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLGELKIRVQRSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYQFAKAGNLDAVPEVQNNSALGDLLKKRSDAASQYNDA
LAQYGPNFPKVQRLQAQLKEFDQTIEKEKQKILDVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNVALAFLVGLVGGMGLALMREYLDNTVKSPDDVET
LSGLPSLAVVPQFAGSNGNGKRHGLLQGLSSNGHDKRIELVAQHLPKSQMSEAFRALRTSILLSQAGHPPQVILVTSALP
REGKTTAAGNLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAGGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLVDAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLNSVKCRILGV
VLNAVDSGAPDYYYSYRYYPYSYGYGPQEAVEAPHEEDSDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A2V8WQK6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=773 residues).
MKPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPGYDSLLDYWHILIRHRMTVLRFAVAGLLGAIVVSLVQ
TPIYRVRTSLEIQGPNFPEMKGANDSNGSYASPESYVETQVKILQSESVIEHVIDKLKLQKERPRTGWRGLASRVQRIFA
FSKASNLPEREELIRQIKRNLTVRTSGNSRLLEVLYESPDPQRAADFANTLVSQYVELSQEERWRSAQGTAEWLTSHLGK
MKGELEASEAQLQDYARASGLSLTSEKENPVVNRLKELQDELSKAQADRIAKQAKSEEARSKPADSVPEMLEDPTMREYR
QKLTELQRQYAELSATLTPEHYKVKRVQAQITELRSEMQKERANVLRGLGNEYAAAVRRERLLSKAQAEQEKIAADQSDK
VIHYDTLKRDVDSNRRLYEVMLQRVKEASLATAMRDSNVLVVDRAKPPLLPYRPSLPVNSAIGLFSGVFLGFGFVLLRER
IDRRISAPGDAQVYLDLPELGVLPLDQAAVSWQIPNRLPPHRAASSRPPESALRSSLGDCPELATWKRKPSLLAECTRTT
LISILSPNQNGEGPRIIVLTSACPGDGKTTVACNLSIAMAEIGRKVLLIDGDLRRPRLHKIFGVANTWGLSDLLWADNPL
ETVPISHLVRETEVSSLSLLPGGSCGITPSNLFYSPRMSRLLRRLRSEFDMVMIDAPPVIHLADARVLGRLADGVILVVR
AGQTTTESALFASQRFAEDGTRVLGTVLNSWDPKNSRGYGYGNYREYEKYVGQ
>gnl|bykdb|A0A2V8WX45 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=796 residues).
MEDQKQVELYGRGHRLDRRGPGALDGRVVELPDSYEILESDEGLDLRAYGRILHKRLPTILIVFFILFTTILVVTLKQRS
VYRAQVLLEIQKENPDIPTIKELYELEAVSDAYLRTQYNILASESLSRRVIEQLRLDTLPEFNSPRWWQIWPKTKKPSTA
QTFAIGPVPAGGDRELSQRVLERFQDQLTVDPVNRSRLVTVRFDSRDPELAARVVNTLAADYVDQSLEARWQATQKAAEW
LTQQLVGVKAKLEKSEDELQTYARRNGLVFLETDKGASQNVANERLQQLQEQLTKAQAERYEKEALYRLVQTGEYESLPG
VFENKLIQDLSERLAELKREHAQLSTTFNADYPRVKEIQSQIDEIEGSLQVERKRAADRIANDYSAAVRRENLVQQALGE
QQEQVSLIAEKSVQYNILKREVDTNKQLYEGLLQRLKEAGVSASLKASNIRIVDSAEPPARPVKPRIALNLMVAAFLGLG
LGVCAAFFQERMDNTLKGDDDVERLFGLPSLALIPVVPPSNGDQHGIHRFLQQDKALVLKGNGTGKDARSSWHRIDLDGT
QHGALVEAFRSLRTSVLLSTPDRPPGSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLVDADLRFPSLHKLFGTSGSLG
LVSYLTGQQDWHAAVRPCGSHGLDVLVCGPVPPNPSELLSSQSMGALVRSAKTEYGFIILDSSPMLALADSRILAPLVDG
VLLVVKSGTTPREQILHAQSGIRSVGGNLIGVVLNSVDIRTNGYYNYGPYGPDARPPLQETFATTDFETPQQKASD
>gnl|bykdb|A0A2V8XAR9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=779 residues).
MADDNKLVPRENGSNGPVELVPLPARLPSWELSPREPHLYDYLLVLRKHQWLILSFMLAVVTIVTISTFRMQPVYNATAR
IEIDRENANILPFPGADSYDYMMDLENYIETQSKILTSETLALQTIRNTGLSARPEFSSPNGPSEAMASGSLANQKRPPE
LGEFLGSLSVKRVPNSRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLSELKIKVQKSEDARI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERMKKESLYEFAKSGNLDAVPQVQSDAGLAELLRKRNDLSSQHSDA
LSQYGPNFPKVQRLQAQLKDLDANIEKEKKKIVDVLESDYREARQRESMLTQALDQQKAAANQMAEKLVEYNILKREAEA
NKALYEGLMTKLKETAISLGLRSSNIRIVDPAMIPSTPSRPAKARNITLAFLVGLVGGIGLALMREYLDNTVKSPDDVET
LARLPSLAVVPQFASSNGSSKRQGLLQGFAANGQDKRIELVAQHLPKSQISEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGSGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLADAIAELRTKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLASVKCHILGV
VLNAVDSSAPDYYYSYRYYPYSEGYGPQEPGETFHSEHSESVAEAVIQHYDDEDDTQAL
>gnl|bykdb|A0A2V8XIF4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=774 residues).
MQASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPGYDNLLEYWHLLAQHKMTLLAFGVCGLVAAILFSFIQ
TPTYRVRTSLEIQSTNFVEIKGGDPSGSTASIASPESYVETQVRRLQSESLLERVIDKLKLRKERPATGWRAFESRVQRF
FDLSKTPHLPEKEELIRQIQRNLTVRESGNSRLLEILYESPDPKLAADFTNTLVSEFVELSQEERWKSAQGTAEFLTNHL
DQMKAQLEASETQLQEYARTSGLSITAEKENPAENRLKELLDELSKAEADRIAKQAKFEEAQSKPADSLPEMLEDPTMRE
YRQKLTELQRQYAELSATLTPEHYKVQRVQAQINDLKAEMQRERNNVLRRIGNEYTAAVRRERLLVEVHANQEKVVADQS
SKAIHYDTLRRDVDSNRRLYEVMLQRVKEASLATAMRDSNVLVVDRAKPPLLPYRPSFPMNSAIGLFSGLFLGFGFVILR
DRLDRRITAPGDAQAYLDLPELGVIPFDQGGLAGQIAGRLHSHRPTRTLTSDTAPDSSANWPELATWKRKPSFLAECART
TLTSILLPSQNGDCPGVVVLTSPSSGDGKTTVACNLAIAMAEIGRKVLLIDGDLRRPRLHKVFGAPNNWGLSDVLWGDTP
LETLPISHLVRETEVAGLSLLPGGSCGITPTNLFYSPRMARFLKRMRKEFEMVMIDAPPMIHLADARVLGRHADGVILVM
RAGQTTTESALYASQRFAEDGTRVLGTVLNSWDPKNSHRYGYGSYADYEEYVGQ
>gnl|bykdb|A0A2V8XN17 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=796 residues).
MDDQNQVELYGRGHRLDRRGPGAPDSRVIELPDSYEILESGEALDLRSYGRILRKRLPTILVVFFILFTGILIATLKQKP
VYRAQVLLEIQKENPDIPTIKEMYELDAVSDAYLRTQYSILASESLARQVIDQLQLEALPEFNSPRWWQFWPSKKKSPPP
QTFTIGPVSEARDRELSQRVLERFQDRLTIDPVNRSRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDELQSYARRNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQTGELGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQIDEIEASLRDERQRAADRIANDYSAAVRRENLVQQALDN
QQKQVSLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPVKPRTLLNLSVALFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVASANGNHLGIHRFLPRDKSLVLAGNGSGKNSRSWHLIDRDGAQ
HAALGEAFRSLRTSVLLSTPDRPPSSLLVTSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRSLGL
VSYLTGQQDWRAVVHPSGSRGLDLLLCGPVPPNPSELLSSQSMGALIRSASAEYGFVILDSSPMLALADSRILAPLVNGV
LLVVRSGTTPREQLLHAQSGIRSVGGNLIGVVLNSVDIRTNGYYNYGSYGSNRGDPPQETFVPTNLHLPPQQKASD
>gnl|bykdb|A0A2V8XZK2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MAEENKLVPRENGSNGAVELVPNTPRFASFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATAR
VEIDRENANILPFQGADSYDYMVDSENYIETQAKILTSETLVLQTIRDSGLTARPEFSVGGGPSEAVASGSLANRTRPPE
LAEFLGSLSVRRVPNSRLMDVSFESTNPQLAARIVNAHIATYVEQNFRSKYESTTHASDWLADQLNDFKIKVQRSEDARI
AYERQNQIWTLDDKQNMTTQRLGDINRQFTDAQSERMKKESLYEFAKAGDLDAVPQVQSNAALTDLLKKQRDSSAEYTDA
LAQYGPNFPKVQRLKTELKDIEDSIEKEKRKVLEVLESDYREARQRETLLSEALDQAKVEANQMSEKLVEYNILKREAEA
NKALYEGLMTKMKETAISAGLRSSNIRIVDPAMVPTSPARPAKARNIMLAFLVGLIGGIGLALMREYLDNTVKTPDDIES
LARLPSLAVVPQFTGLNGSKGRGVLPGLSSNGHERRIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALPR
EGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGTGKYAGLSSYLAGVSSLDLVSVPHPAIPNLVAIPTGPLPP
NPADLLSSHRLADAIAELRTKFKFIVIDSPPIMAATDAVILSVLADGVLLIVRSGETPKAAFTRTRDLLNSVKSRILGVV
LNAVDSSAPDYYYSYRYYPYSYGYGPQEAGEPAQGDDASESVTEALSRHHDDDSQAL
>gnl|bykdb|A0A2V8Y334 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=792 residues).
MGEQQNVELYSRGPRFERGGRAFLDHRVLDLSDAYEIVEPEEPLDFRAYARILRKRFSTVLIVFFLVFAVTLIATLKEKP
LYRAQVLLEIQKENPDIPTIKDLYELESVSDSYLKTQYSILASESVVRRVIDQLHIDALPEFNSPKWWQFRKKAFKPRNQ
TFALDQESSARDPEVYQRVLERFQDRLTVDPVSRSRLVTVRFDSNSAELSARIVNTLAEDYIDKNLEARWKATQKAADWL
SQQLVGVKAKLEKSEEQLQDYARHNGLVFLETDKGASENVANERLQQLQEELTKAQTERYQKEALYRLVQAGDYGSLPGV
VENKLIQDLSERLADLKRELAQLSTKFNAEYPRVKEIQSQIDEIEGTLKEERQRAADKITNEYFAALRRESLVKEALDGQ
QKQVNLIAEKAVQYNILKREVETNKQLYEGLLQRLKEAGVSASLKASNIRIVDPADPPAKPAKPRIPLNLAVGVLLGLGL
GISTAFLQERLDDTLKGADDVERLFGLPALALIPSVHHLDGDRHGVRKLLDRTNHPGNGHNGTASNPGARWHRIDQSGKP
QPALVEAFRSLRASVLLSTADHPPGSLLVTSTQPGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQKLFCIRETLGL
VSYLTGQQDWRAAVCPSGSPGLDVLLCGPVPPNPAELLSSKSMGAFIASAKSEYGFVILDSSPLLTLADSRILASLVDGV
LLVVKSEATPREQVLQSQSSIRSAGASLIGAVLNGVSLHTNGYYGLGIYGSNGNSHSEIISDAEDSWSTLRK
>gnl|bykdb|A0A2V8YF91 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MTDENKLVSRGNGSNGAIELAPVTPRFVSFDLSPREPHLYDYLLILRKHLWLIVSFMLTVVTIVAIANFRMKPVYVATAR
IEIDRENANLLPFQGADPYDYTVDFDNYIETQAKILTSETLALQTIRNGGLSDRPEFSGPGGPSEAVASGSLTNQIRPQE
LGQFLGSLSVKRVPNSRLMDVSFESTDPRLAARIANAHIATYVEQNYRSKYESTTQASNWLADQLSELKVKVQKSEDARI
AYERQNQIWTLDDKQNITTQRLSDINRQLTEAQSERMKKESLYQFAKSGNLDAVPQVQTNTALTELLKKRSDTSAEYANA
LTQYGPNFPKVLRLQAQLKEIDENIQGEKRGILDALESDYREARQRETLLTDALDQAKAEANQMAERLVEYNILKREAEA
NKALYEGLTTKMKETAISAGLRSSNIRIIDPAMVPTSPARPAKTKNITLAFLVGLVGGIGLALLREYLDNTVKSPDDIEA
LARLPSLAVVPQFSGSSGGNRRGFLPSFSGNGHEKRMELVAQHLPKSQISEAFRALRTSILLSQADHPPQVILVTSALPR
EGKTTVAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLGPGKYAGLSSYLAGASSLDLVSVPHPSIPNLVAIPTGPLPP
NPADLLSSHRLAEGIAELRTKFKFVVMDSPPIMAATDAVIVSVHSDGVLLVVRSGETPKAAFARTRDLLNNVKCRVLGVV
LNAVDPGAPDYYYSYRYYPYSYGYGPQEVTETAQGEASDAAEEAASRRHDDDSQAL
>gnl|bykdb|A0A2V8ZG48 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=792 residues).
MSEQNKVELYARDARFERARLGFLDHRIVDLSDSYEILEPDEPLDLRAYGRILRKRLPTILIVFFLVFTVGLIATLKEKP
IYRAQLLLEIQKENPDIPTIKDLYELESVSDSYLKTQYSILASESVARQVIDQLHLDTLPEFNRPKWWQFGKRLSLPRKQ
TFALDPVRPGQDPEVYQRVLERFQGRLTVDPVSRSRLVNVRFDSNDAQLSARIVNTLAEDYIDQNLDSRWKATQKATDWL
SQQLVGVKAKLEKSEEQLQDYAQRNGLVFLETDKGTSENVANERLQQLQEELTKTQAERYEKEAVYRLVQAGDYGSLPGV
VENKLIQDLSERLAELKRQFADLSTKFNPEYPRVKEIQSQINEIEATLKEERQRVADKIVNEYLAAVRRESLVKQALDEQ
QKQVNLIAEKAVQYNILKREVDTNRQLYEGLLQRLKEAGVSASLKASNIRIVDSAVPPAKPAKPKIPLNLAVATLLGLGL
GISAAFLQERLDDTLKGADDVERLFGLPALALIPAVHHLNGNGPSVRRLLDHSNLLRSRQNGTASNPCACWHRIDQGGKR
HAALVEAFRSLRASVLLSTADHPPGSLLITSTQPGEGKTTVATNLAISLAQLGQRVLLVDADLRFPSLEKLFCIRENLGL
VSYLTGQEDWRTAVCPSGSPGLDLLPCGPVPPNPAELLSSKSMGAFLGSAKSEYAFVILDSSPLLMLADSRILASLVDGV
LLVAKSGATPREQIRQSQSGIRSAGANLIGVVLNNVTLHTNGYYGLGIYGSNGNSHSEAISDPAEPWNRLSK
>gnl|bykdb|A0A2V8ZHL8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=759 residues).
MPPGVKDMPDNEALSLRGAKLPVLESPQSPAFPVLGIDVQDFESFSYLQAYWNIVNKRRWTIATVAFIATLLVAIASFKM
TPIYEATARLDIEADTAQIQSFNDLYRQVPTDEAFIGTQIQVLESDNLAQRTIEQLGLAREPGWVLAAGSGNDGLPAQPQ
NSEDKLLRLFKSRLHVQRVRDSHVVNISFEGPDSSLSAKIANSLASNFIEYNFRQKYDATRQASGWMEQQLDELKAKVEK
SQQALVDYERQNAIVNISDKESVVEQRLADLSRDLTNAQSDRVQKESLYELVKSNESQVAFVAQNDLLQRLEEKFADLKA
QYVDALEQYGPKHPKVERFRSQVDEVQSLIDTERKRIVERLRNDYMAALGREKLLAAAVAKEKADVGALSQLLIQHNLLK
REFDSNQQLYDSLLQRLKDATVSAGLRATNIHVVDPARPPRVPVRPQKLLNIAIGLVVGLILGVTLAFVKEALDTSIKSI
EEAERVVNAPALAVVPLEREIPHRPALSRARNNGNSKPSETALALLKQPSSALAESFRTLLTSVVLSTAPRPPQALLITS
ATAREGKSTTALNLAIALAQRGDSTLIIDADLRRPGIAESLDLIDGEGLAGFLTGAHSIEAALIQFSPVPALRVLPAGPK
PPNPAQLLSSSAMESLLKELRQRFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARKVLENAGARILG
LVFNKVDVRHNGYYGYYGHYYYSGSGKTERHSASEAVRS
>gnl|bykdb|A0A2V8ZTX6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
HVELAPLPNRFASFDLSPREPHLYDYLLILRKHQWLILSFMLAVVTIVSIATFRMQPVYVAIARIEIDRENANILPFPGG
ESFDYMVDSENYIETQAKILTSETLALQTIRNNGLALRPEFAASGGPSEAVASGNLANQTRPPELAEFLGNLSVKRVPNS
RLMDVSFESTDPRLAARTVNAHIATYVEQNYRSKYEATSQASDWLADQLRDFKIKVQKSEDARIAYERQNQIWTLDDKQN
MTTQRLSDINKQFTDAQAERMRKESLYEFAKAGNLDAVPQVESNTALADLLKKKGETSADYADALTQYGPNFPKVLRLKA
QLKDIDDNIEKEKQKILDVLESEYREARQRETLMGQALDQAKAETNQMAEKMVEYNILKREAEANKALYEGLMTKMKETA
ISGALRSSNTKNIILSFLVGLVGGIGLALLREYLDNTVKTPDDIETLARLPSLAVVPQFAGTNGSKRRSMLQGFSENGHN
KRIELVAQHLPKSQVSEAFRALRTSILLSQAEHPPQVILVTSALPREGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIA
RLLNLGGGKYAGLSSYLAGVSSLDLVSIPHPAIPNLVAIPTGPLPPNPADLLSSHRLADAIVELRSKFKFIVLDSPPIMV
ATDAVILSVQADGVLLVVRSGETPKVAFTRTRDLLTSVKSRILGVVLNAVDSSAPDYYYSYRYYPYSYGYGPQETGESVQ
AEASESVSEVVSRHQDDDSQAL
>gnl|bykdb|A0A2V9AC41 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=894 residues).
MEQVNQPSPYFIKRTARVEQGTIDLNEFAVVDDQVHPLREYWLTIKRHRWLIVMTALAILACAMLYLFTRIPLYTAEATV
LIERKAPQILKVQDTRADSIDSGDYNNEFYKTQYEILRSPALAERVIREEGLQNLPLFGGKADKADSQKGLVANLKDGLK
ERVKGFVPDKPKVNAPPPDPATAGKRLAGSYLSKLHISPVGGTSLVKVRFTTPDPALSARLANAHANSYVRYGVDLRSQT
NEEASEFLKQRLTELKERVEQSETALNSYRKDKGIISVDEKENVVIDRLLDLNRSLTKAEAERIGLEAQMHSIHGRNYDE
VPLVRDSLVIGGLKGELAKSEADYASLAKEFKAGYPPLDNLKVRMEETRRRLQAEIQNEVKRIEVTYTAAKNNETGLRAT
MEDQKKTTLNLKDAAVQYAMLAREVDMNKQLYDGVLQRLKEIGVAAEIRSSNIYLMGKAEPPGGPSYPDKNGILLRGLFL
GLLMGVGLAFLFDQLDNTIKSPEEAERFIQLPTLGVVPDFALLTGTRTGYVSKLVNSAKAELPAPTRDEDRPSVLDHHPL
SLVAEAYRSLRSSLLLSQAGGPPHTMLMTSATRGEGKTTTLVNTAIVFSQLGIRVLVIDADLRRPRCHMLLKMENTAGLA
DVLAGQIGMEEAIRPTQAENLFLISAGTIPPNPAELLGSRKMHELLQQLREQFEFIFIDSSPVMAVSDAVFLSTMVEGTL
MVVNRRTPKPLVRKTRTRLSTPHTKILGVLLNRVDVRAGEYGSYYAHYYEYYPHDLDLSDGPPAAFGNGNGALSHRVNRH
SPATPEPAARKQRSNGLPAGFIDSVGSKLAEAMGPMATLVLDDHILALGESSESFPEAKIEELTKLVSEEILDDSLRVRF
EKQMSKEIQKLGEL
>gnl|bykdb|A0A2V9AEW6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=711 residues).
MTLLGFAVVGLLASIMISLVQTPIYRVRTSLEIQGTNFQEMKGIDSNGNYVSQESYVETQVKLLQSESLIEHVIDKMKLH
KEQPTTAWGIFASRVHRLFAFSRTGRLSEREQMIRQVERNLTVQSSGSSRLLEVLYESPDPKQAADFANTLVSEFTELSQ
EAHWKSAQGTAEWLTNHLDEMKTQLEASEAQLQDYARITGLSFTSEKESLAEARLKEIQDELSKAQADRIANQAKYAEAA
GKSADSLPEILEDPTMRDYRQKLTELQRQYAELSATLTPEHYKVLRVQAQIDELKAQIEKERGNVLGRMRNEYEAALRRE
KLLTEAHDAQQKVVADQSSKAIHYDTLKRDVDSNRRLYETMLQRVKEASLAAAMRDSNVMVIDRARPPKLPYRPSLPMNS
AIGLLGGMFLGLGFVLLRERLDRRISAPGEAQIYLDLPELGVIPLDDTAVSRHGANLLNMRRLTPSVPSGVESDSSDKSP
ELATWKRKPSLIAECVRTTLTSILLPNQDGDPPQVVLLTSPCLGDGKTTVACNLSIAMAEIGRKVLLIDGDLRRPRIHQV
FGMTNRWGLNDVLLSDTPFEEFPMSHLARKTEVAGLSVLPSGNCGVTPTNLFYSPRMSKLLARLRREFDMVLIDAPPMIQ
LADARVLGRLADGVILVVRAGQTTTESARFAIQRFTEDGTRVLGTVLNSWDPRTMRYGYGGYGVYKDYVGQ
>gnl|bykdb|A0A2V9AY68 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=794 residues).
MSEQNKVELYARRPRFERGGSVLLDNRVLDLSDSYEILEPDEPLDLRAYGRILRKRFSTILIVFFLVFAATLIVTLKEKP
VYQAQVLLEIQKENPDIPTIKDLYELESVSDSYLKTQYSILASESVARRVIDQLHLDSLPEFNKPKWWQLQERFFTPHKQ
TLALDPAGRARDPEVYQRALGRFQDRLTVEPVSRSRLVTVSFDSNNARLSASIVNTLAEDYIDENLEARWMATQKATDWL
SQQLVGVKAKLEKSEEQLQDYARHNGLVFLESDKGVSENVANERLQQLQQELTKAQAQRYEKESVYRLVQAGDYESLPGV
VENKLVQDLSERLAELKRELAQLSTKFNPEYPRVKEIQSQIDEIEAALKDERKRAADKITNEYFAALRREGLVKGALDTQ
QNQVNVIAEKAVQYNILKREVETNKQLYEGLLQRLKEAGVSASLKASNIRIVDSAEAPAKPAKPKIPLNLAVASLLGLGL
GISAAFLQERLDDTLKGADDVERLFGLSALALIPSVHQLGGNRNGVRKLLRRTNGLRHGHNGTASNPGVRWHRIDQGGKP
QAALVEAFRSLRASVLLSTADHPPGSLLVTSTQSGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQKLFCIRECPGL
VSCLTGQQDWHAAVCPSGSPGLDLLLCGPVPPNPAELLSSKSMGAFLTSAKSEYGFVILDSSPLLTLADSRIIASLVDGV
LLVVKSGATPRQQVMQSQSSIRSAGANLIGVVLNNVTLHTNGYYGLGMYGSNGNGNSHSEMISEAADSWNTLSK
>gnl|bykdb|A0A2V9B240 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=764 residues).
MPHKVKDMPDNQALSLRGPRLPVPESPHLPAFPVLGTDVQEFESFSYLQTYWNIINKRRWTIVTVAFIVTLLVAIASFKM
VSIYEATAHLDIEADTPQIQSLNDLYRQVPTDDAFIGTQIQVLESDNLAQRTIEQLGLARDPAWALAVGLGNDVPPVQLQ
VWEDRLLGPFKRRLHVQRVRDSHVVNISFESPDPGLSAKIANSLANNYIEYNFRQKYDATRQASGWLEQQLDELKAKVEK
SQQALVDYERQNLIVNISDKESVVEQRLADLSRDLTNAEGDRVQKESLYELVRSNESQVAFVAQNEILQRLEEKFADLKA
QYVDALEQYGPKHPKVERLRSQVDEIQSLIDTERKRVVERLRNDYEAALGREKLLAAAVAKEKVGVGALSQLLIQHNLLK
REFDTNQQLYDSLLQRLKDATVSAGLRATNIHVVDLARPPKVPVRPQKLFNIAVSLVVGLILGVTLAFVKEALDSSIKSI
EEAERVVNAPALAVVPLERELPHRPARSLTRNNGNSKSSGAELALLKEPSSALAESFRTLLTSVVLSTAPRPPQALLITS
ATAREGKSTTALNLAIALAQRGDSTLIIDADLRRPGIAESLDLVDGEGLAGYLTGAHSIEAALRQFSPVPTLWVLPAGPK
PPNPAQLLSSSAMESLLKELRQRFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARRVLENAGARILG
LVLNKVDVRHNGYYGYYGHYYYSSGSGKTKRTPASESVSSHLPG
>gnl|bykdb|A0A2V9BCA0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=780 residues).
MEENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPHEPHLYDYLLILRKHQWLILTFLLTVVTIVSIATFRMKSVYVAPA
RIEVDRENANFLPFQPADPYAYLLDQENYIETQSKILTSETLALQTIRSVGLAGHPDFSEGGKPSEAVTTGSLANQNRPP
ELAAFLGSLTVKRVPNSTLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLADQLNELKIRVEKSEDAR
IAYERQNQIWTIDDKQSITTQRLGEINKELTEAQSDRMKKEALYQLAQSGSLDALPAVRDSELLQDIYKKRNDAYTQYTS
ALNQFGPNFPRVQRLQEQLKEFDGLIDAEKKNIVTSIENEYRAARQRELLLLKALDQQKAEANQMAERLVQYNILKREAE
ANKALYEGLLTKLKEAGISAGLRSSNIRVVDPAMIPSSPARPAKMRNISLAFLVGLVGGIGLALLREYMDNTVKTPDDVE
MLARLPSLAVVPAFIDTNGRNGRRRFLRGLAAATNGREARVELVSHHLPKSQMSEAFRALRTALLLSQADHPPQVILVTS
ALPREGKTTAAANLAVTLAQLGDKTLLIDADLRKPGVGRALSLGEGKYAGLSSYLAGVSSLDLVTVPHPAIENLAAIPTG
PLPPNPADLLSSHRITDAIAELRAKYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDLLTSVKCRL
IGVVLNAVDSTAPDYYYSYRCYPYSYGYGEPQAGELPASTEQDAISRRRPPEHEDDTQAL
>gnl|bykdb|A0A2V9BT79 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MTDENKLVPHENGSNGNVELVPIPGRFASFDLSPREPHLYDYLLILRKHQWLIVSFMLSVVTIVSIATFRMQPVYVATAR
IEIDKENANILPFQGADSYDYMMDSDNYIETQSKILTSETLALQTIRNNGLALRPEFAESGGISEAVANGNLANQTRPPE
LAAFLGNLSVRRVPNSRLMDVSFESTDPRLAARTVNAHIATYIEQNYRSKYEATSQASDWLADQLRDFKIKVQKSEDARI
AYERQNQIWTLDDKQNMTTQRLSDINKQYTDAQAERMKKESLYEFAKAGNLDAVPQLDSNSALTELLKKRGETSADYADA
LQQYGPNFPKVLRLKAQLKDIDDNIEKEKRKILEVLESDYREARQRETLLADALNEAKAETNQMAEKMVEYNILKREAEA
NKALYEGLMTKMKETAISGALRSSNIRVVDPAMVPATPARPAKGKNIMLSFLAGLVGGIGLALLREYLDNTVKTPDDIET
LARLPSLAVVPQFAGSNGHKRRGMLPDFSQNGHDKRIELVAQHLPKSQMSEAFRVLRTSILLSQAEHSPQVILVTSALPR
EGKTTAAANLAVTLAQLGDRTVLVDADLRKPGIGRLLNLGAGKYAGLSSYLAGVSSLDLVSIPHPAIPNLVAIPTGPLPP
NPADLLSSHKLADAIVELRTKFKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGETPKVAFTRTRDLLTSVKSRILGVV
LNAVDSSAPDYYYSYRYYPYSYGYGPQETGDAAQGEILESASEAISRHHDDDDSQAL
>gnl|bykdb|A0A2V9BWU8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=803 residues).
MSEPNKLEPFAQGPRSGHGGLRFMDNRVVDLSDSYEIIEAEEPVDLRAYGRILRKRFATVAIVFFLVFAGSLIATLKEKP
VYRAQVLLEIQKENADIPTIKDLYELESVSDSYLKTQYTILASDSIARRVIDQLHLDSLPEFNAPKWWSLKRFARAPQKQ
AFALGPAPVAHDSAVYQRVLERFQDRLSIEPVSRSRLVTVRFDSGNAQLSARIANALAEDYIDQSLEARWLATQKATDWL
SQQLVGVKAKLEKSEEQLQDYARHNGLVFLENDKGASQNVANERLQALQEELTKAQADGYQKESVYRLVQSGNYGSLPGV
VENKLIQDLSERLAELKRELAQLSTKFNAEYPRVKEIQSQIDEIEATLREERQRAADKITNEYSAAVRREELVKQALDDQ
QKQVNVIAEKAVQYNILKREVETNRQLYEGLLQRLKEAGVSASLKASNIRVVDSAEPPARPAKPRIPLNLAVAALLGLGL
GISTAFLQERLDDTLKGADDVERLFGLSALALIPSVHCLNGDRPSVRKLLDRTLPLKSAHNGTASNPAARWHRIDQVDRG
EKPQAALVEAFRSLRASVLLSTADHPPGSLLITSTQAGEGKTTIATNLAISLAQLGQRVLLVDADLRFPSLQRLFCIRES
LGLVSYLTGQQDWRTAVCPSASPGLDLLLCGPVPPNPAELLSSKSMGAFLGAAKSEYGFVILDSSPLLTLADSRILAALV
DGVLLVVKSGATPREQVIQSQTSIRSAGANLTGVVLNNVSLHTNGYYGLGIYGSNGNGSSNSNGNSHSEMISDSADSWST
LSK
>gnl|bykdb|A0A2V9BWU9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MDESTALMQRDRRAGSSFEVITAHPQFSSWETPPREPHLLDYWRILRKYQWSILSFLLTVVTFVTIATLRMHPVYEATAR
VEIDNENTNFLPFKSDSYEMYMDMENYIETQSKILQSETLALQTIQSAGLVELPEFGGQPGKASKPASVPVNAANQARPP
ALGGFLGSLRVKRVPNSRLLDVTFEAGDPKLAARVVNVHLENYIEQNFRSKYLATTTASNWLKDQLNELQFKVEKSEDAR
IAYERQNQIWNIDEKQNITQQKLSDLNKELTQAQGERMRSEALYQLVGTGHIDALPPVRDSLLLQDLQKKQSELNTQYVE
ALNQYGPSFPKVVRLQAQLKEIEHLIAREKANIINRIEAEYHTARQRENLLSQALDKQKGESNAMAEKLVQFNILKREAE
ANKQLYEGLLQKMKEASISAGLRSSNIRVVDPAMVPSAPSRPQKTRNILLAFLIGLVGGVGLALLREYLDNTVKTPGDIE
MLTRLPSLAVVPAFVTLNGRNRVPKMLKSGSGNGTESRVELVSHTLPQSQISEAFRALRTSLLLSQAEHPPQVILVTSAL
PREGKTTAAVNLAVTLAQLGDRTLLVDADLRKPGISRALSMSDGKYAGLSSYLAGVSSLELVTVPHPAITNLAAIPTGPV
PPNPADLLSSRRLSEAVSILRQEYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFMRARDQLVAVKCRLLG
VVLNAVDSSSPDYYYSYRYYTYSYGAYGKEKDGAFERHHQS
>gnl|bykdb|A0A2V9C238 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MDPENKIKLYEPAVRKWERLRPTPAVRAEPLEMKESADLLAYWRVLRKRRWTILTVFFVLFTVVLLGTLKQKPIYRAKAL
LEVAKENPNILTVQELFALDTVSDTYLETQFKILQSDTLARRVIEGLRLDKLEEFNPRASQLGDAKPQNAAAAQSFTAGD
TERDPWAYQTALKRFRDRLSVDPIKRSRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLSQQLLELK
ARLEKSENEMQSYARENGLLFLEKEKGAENIVNERLRQLQEELTRAQAARYEKESLYRLVQAADYASLPGMAENKLVADL
AVRLADLQREQAQLATTFTADYPKVRQIQSQINELDAALARERGRVAGRITNDYLAAVRRENLVAQAFAEQQKQANLIAG
RSVQYNILKREVETNQQLYEGLLQRLKEAGVSAGLKASNIRIVDAAEPPKKPARPNLPLNLALAVLLGTGLGVVQEHVDN
SLKTSEDVERFLGLPALALIPAVESLNGRRKGAYRLYGGSKPLANGKPQTSALPSTTPRWYRIDVEATQQSALAEAFRSL
RTSVLLSTADRPPRTLLVSSSQPSEGKTTVSINLAISLAQLGQRVLLIDGDMRRPSVRKAFDIDNSLGLVSYLTGQQDWR
AAVRPTGLESLDALVCGPVPPNPAELLSSERMRTLLREAKVEYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPR
ELAQRAGAYARDVGANLIGVVLNNLDLRGGDDYYYRYYHYNYYGSDEHPSGDSKG
>gnl|bykdb|A0A2V9CBM2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MGEQNQSEPYSHAHRLARKRGSLEASVVELADSYEIIGPEEGIDLRACGHIVRRRLSTILAVFFVVFVVIAIATLKQKPT
YRAQVVLEIQKENPDIPTIQELYQLETVSDDYLRTQYDILASDSLARRVIDQLRLDTVSEFNAPQLFSWKWKKKAPTSQT
FTVGPIPADRELYQRVLERFRDHLTIAPINRSRLVAVRFDSHNPDLAARVANNLAADYVEQGLDERWAAAQRASDWLSRQ
LLSVKAKLEKSEDQLQAYARHNGLVFLQTDNGTTQNIANERLQQLQQELTKAQAELYEKESLYRLVQTSDYGSLPGVFEN
RMLQDLTVRLTDLKREYAQLSTTFGSDYPRVKEIQSQITDVEASLQQERKRAADQITNEYFAASSRESLLRHELAEQQKQ
IDRIAEKSVQYNILKREVDTNKQVYDGLLQQLKSAGLAASLKASNILIVDPAEPPAKPAKPKILLNLVLASILGLALGVG
EAFLQERLDDTVTGADDVERLCGLSVLALIPAVQPSNGDQHGGVHYKLLEHAGALSLRENGGARKLVPSWYRIDVHATRH
APLVEAFRSLRASILLSAAEGPRNSFLVTSTQPSEGKTTVASNLAIALAQLGRRVLLVDADLRSPSLHRLFGARESSGLV
SYLTDPQDWRTLVRHSGSSGLDLLFCGPVPPNPSELLSSQSMETLIQSAGEQYEFVILDSAPMLALADSRILAPLVSGVL
LVVKSRTIPREQVLHAQSSISSVRANLIGVILNGVDVRTNGYYDYGRYRSTATKIVSDENFA
>gnl|bykdb|A0A2V9CG11 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=748 residues).
MESPPNREVATAGGYDSFLDYWRILIRHKKMLLLVTLAGLIAAILIGLVQTPVYRARTSLEIQDFNENFLDLKSVDPTVT
ADDYTTGASYFETQVKLLQSESLLERVIEKLNLREARKSHSIVRRMLRLSNSQHVPEDELVHQAERNLTVRAAGNTRVLE
VLYESPDPKLAADFANTLASEFIEETQGMRLKAFQRTAEHLTVKLDEMKAKLEQSEAQLQDYARTSGLTFTSEKDNVSDA
RLVELQSELTKAQAERIAKQAKFEQVKSTPVESLPEMLDDPTLREYRLRLTDLQRQFVELTATLTPAHYKVQRVQAQIAE
LQSAVKNQRTLILRRIGSEYSAARQREEFLAKAYADQEMIAADQSSKAIRYRTLKGEVDSSRQLYEAMLERVKQAELATA
MRASNVLVIDHAEVPRLPYKPNLPMNAALGMFGGFFLALGLVLFRERLDRRIQSPGDAHVYLNISELGVITSAEIKHSRQ
IANHKQANPALAMEAGSSELVLESHLDDRPELAAWNRKSSLSADCYRATVTSILLANQNGDLPQVIVVTSPCQGEGKTTV
ASNLSIAIVELGRRVLLIDGDLRRPRLHKVFGLCNNRGLSSILSVNDIVHIKQLLCETAISGLYVLPAGSSTTNTTRLLH
SRRMSELLALLRREFDMVIVDAPPVTQLADARVLGHLADGVILVVRAGQTTLESALFATECFAKDRTRVLGTILNGWDPK
TGGRYGYGGYYAGYGGVSQRGGIAGDEG
>gnl|bykdb|A0A2V9CYQ5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=793 residues).
MGEQNQSEPYRHAHRLVRRTGNGLEASVVELADSYEILGPEEGIDLRACGHIIRRRLSTILTVFFVVFVGIAIATLKQKP
TYRAQVMLEIQKENPDIPTIQELYQLETVSDDYLRTQYDILASDSLARRVIDQLRLDTVSEFNAPPLLSWKWKKKAPRSQ
TFTVAPIPADRELYQHVLERFRNHLTIAPINRSRLVAVRFDSQNPDLAARVANALAADYVEQGLDERWAAAQRASDWLSR
QLLSEKAKLEKSEDQLQAYAHRNGLVFLQTDNGTTQNIANERLQQLQQELTKAQAELYEKEALHRLVQTSDYGSLPGVFE
NRMLQDLTVRLTDLKREYAQLSTTFGSDYPRVKEIQSQITDVEASLQQERKRAADQITNQYLAASSRESLLRHELAEQQK
QIDLIAEKSVQYNIRKREVDANKQVYEGLLQQLKSAGLAASLKASNILIVDPAEPPTKPAKPKILLNLLVASILGLALGV
GEAFLQEHLDDTVRGADDVERLFGLSVLGLIPAVQPSNGDQHSIHKLVEHPGSLSLRENGCARKLVASWYRIDVHATRHA
PLVEAFRSLRASILLSAAGGPPNSFLVTSTQPSEGKSTVATNLAIALAQIGRRVLLVDADLRSPSLHRLFGARESSGLVS
YLADHQDWRTLVRHSGLSGLDLLFCGPVPPNPSELLSSQSMETLIKSAGKQYEFVILDSAPMLALADSRILAPLVSGVLL
VVKSRTIPREQVLHAQSSISSVRANLIGVILNGVDVRTNGYYDYGRYRSTASQIVSDKISLESDSQGALTQSN
>gnl|bykdb|A0A2V9DEM9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=780 residues).
MDPENKIKLYEPAVRKWERLRPTAAVRAEPVEMKESADLLAYWRVLRKRRWTILTVFFVLFTVVLLGTLKQKPIYRAKAL
LEVAKENPNILTVQELFALDTVSDTYLETQFKILQSDTLARRVIEGLRLDMLEEFNPRASQLGDAKPQNAAAPQSFTAGD
TERDPRAYQTALKRFRDRLSVDPIKRSRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLSQQLLELK
ARLEKSENELQSYARENGLLFLEREKGVPENIVNERLRQLQEELTRAQAARYEKESLYRLVQAADYASLPGMAENKLVAD
LAVRLADLQREQAQLATTFTADYPKVRQIQSQINELDATLARERGRVAGRIINDYLAAVRRENLVAQAFAEQQKQANLIA
GRSVQYNILKREVETNQQLYEGLLQRLKEAGVSAGLKASNIRIVDAAEPPKKPARPNLPLNLVLAVLLGTGLGVGAAFLQ
EHVDNSLKTSEDVERFLGLPALALIPAVESLNGRRRGVYRLYGGSKPLANGKPRTLALPSTTPRWYRIDAEATQQSALAE
SFRSLRTSVLLSTADRPPRTLLVSSSQPSEGKTTVSINLAISLAQLGQRVLLIDGDMRRPSVRKAFDIDNSLGLVSYLTG
QQDWRAAVRPTGLESLDALVCGPVPPNPAELLSSERMRTLLREAKVEYHFVVVDSPPLLNVADSRILATLVEGIVLVVKG
GETPRELAQRAGAYARGVGANLIGVVLNNLDLRGGDDYYYRYYHYNYYGSDEHPSGDSKG
>gnl|bykdb|A0A2V9DKX2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=761 residues).
MDESTALIQRDRRAGSSFEVITAHPQLSSWETPPREPHLLDYWRILRKYQWSILSFLLTVVTFVTIATLRMHPVYEATAR
VEIDNENTNFLPFKSDSYEMYMDMENYIETQSKILQSETLALQTIQSAGLVELPEFGGQPGKASKPASVPVNAANQARPP
ALGGFLGSLRVKRVLNSRLLDVTFEAGDAKLAARVVNAHLENYIEQNFRSKYLATTTASNWLKDQLRELQFKVEKSEDAR
IAYERQNQIWNIDEKQNITQQKLSDLNKELTQAQGERMRSEALYQLVGTGHIDALPPVRDSLLLQDLQKKQSELNTQYIE
ALNQYGPSFPKVMRLQAQLKEIEHLIAREKANIVNRIEAEYHTARQRETLLSQALDKQKGESNAMAEKLVQFNILKHEAE
ANKQLYDGLLQKMKEASISAGLRSSNIRVVDPAMVPSAPSRPQKTRNILLAFLIGLVGGVGLALLREYLDNTVKTPGDIE
MLTRLPSLAVVPAFVTLNGRNRVPKMLKSGSGNGTESRVELVSHTLPQSQISEAFRALRTSLLLSQAEHPPQVILVTSAL
PREGKTTAAVNLAVTLAQLGDRTLLVDADLRKPGISRALSMSDGKYAGLSSYLAGVSSLELVTVPHPAITNLAAIPTGPV
PPNPADLLSSRRLSEAVSILRQEYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFIRARDQLVAVKCRLLG
VVLNAVDSSSPDYYYSYRYYTYSYGAYGKEKDGAFERHQQS
>gnl|bykdb|A0A2V9EVV8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MADENKLVPRENGSNGAVELVSLQSRVPSFELSPREPHLYDYLLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVGTAR
IEIDRENANILPFQGAESYEYMMDLENYIETQSKILTSETLALLTIRNNALSTRPEFSSPNGPSEAVASGSLANQKRPPE
LAEFLGSLSVKRVPNSRLMDVSFESTDPRLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLGELKIRVQKSEDTRI
AYERQNQIWTLDDKQNITTQRLSDINKQLTDAQSERLKKESLYQFAKAGNLDAVPEVQNNSALGDLFKKRSDAASQYTDA
LAQYGPNFPKVQRLQAQIKEFDQTIEKEKQKILDVLESDYHEAQQREALLTRALDQQKADTNQMAGKLVEYNILKREAEA
NKTLYEGLMTKLKETAISQGLRSSNIRVVDPAMIPSTPARPAKTRNIALAFLVGLVGGIGLALMREYLDNTVKSPDDVET
LSRLPSLAVVPQFASSNGSSKRHGFFQGLSSNGHDARIELVAQHLPKSQMSEAFRALRTSILLSQADHPPQVILVTSALP
REGKTTAAANLAVTLAQLGDSTVLVDADLRKPGIGRLLNLAAGKYAGLSSYLAGVSSLDFVSVPHPAIPNLVAIPTGPLP
PNPADLLSSHKLADAIAELRAKFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDLLSSVKCHILGV
VLNAVDASAPDYYYSYRYYPYSYGYGPQEALEAPHENESDAIAHRVSRDRDDDSEAL
>gnl|bykdb|A0A2V9EY85 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=799 residues).
MDDQNQVELYGRSHRLDRRGPGALDSRIIELPDSYEILEPGEALDLRSYGRILRKRLPAILVVFFILFTAILIYTLKQKP
VYRAQVLLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASESLARRVIDQLQLETLPEFNSAKWWQLWPRKKKSPAP
QTLAIGPVPEAPDRELSQRVLERFQDRLTIDPVNRSRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEW
LSQQLVGVKAKLEKSEDELQGYARRNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQNGEFGALPG
VFENKLIQDLSERLAELKREHAQLSTTFSPDYPRVKEIQSQIDEIESSLREERQRAADRIANDYSAAVRREDLVHQAVDG
QLKQVNLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAGVSAGLKASNIRLVDSAEPPAKPFKPRTLLNLSVAVFLGLA
LGICAALFQERMDDTLKGDDDVERLLGLPSLALIPVVPASNGDHLGIHRFLPRDRFLSLAGNGNGPGKDPRPSWHLIDRD
GTQHAALGEAFRSLRTSVLLSTPDRPPSSLLITSTQPADGKTTVACNLAISLAQLGHRVLLVDADLRSPSLHKLFGIDRT
LGLVSYLTGQQDWRAAVHPSGSRGLDLLVSGPVPPNPSELLSSQSMGTLIRSASAEYGFVILDSSPMLALADSRILAPLV
NGVLLVVRSGATPREQLLHAQAGIRGVGGNLIGVVLNSVDIRTNGYYNYGPYGPNAGSPPQETFVPANFQMPPQQKASD
>gnl|bykdb|A0A2V9FFE5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MDDRDQVELYGRRHQLERRGPDALNTRIVELPDSYEILESGEALDLRSYGRILRKRLPSILVVFFILFTVILIATLKQRP
VYRAQALLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASESLARRAIDQLRLETLREFNSRKWWQLWPETRKPSTT
QTFTVGPLPQVRDRELSERVLERFLDRLTIDPVNRSRLVAIRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEW
LSQQLVGVKAKLEKSEDALQGYARHNGLVFLETDKGASQNVANERLQQLQEQLTKAQSERYEKEALYRLVQTGESGALPG
VFENKLIQDLSERLAELKREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRAADRMVNDYSAAVRRENLVQQALDD
QQKQVNLIAEKSVQYNILKREVDTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVKPKILLNLAVAMFLGLG
LGIGTALFQERMDNTLKGDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSRSCWHRIDRDET
QHASLVEAFRNLRTSVLLSTPDRPPSSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLLDADLRYPSLHKLFGTSGSLG
LVSYLTGQQDWRAVVRPSGSRGLDLLVCGPVPPNPSEMLSSQSMSALIRSASAEYGFIILDSSPMLALADSRILAPLVNG
VLLVVKSGTTPREQFMHAQSGIRGVGGNLIGVVLNNVDICTNGYYNYGPYGLNPDCPSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9GM43 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MDDRDQVELYGRRHQLERRGPDALNTRIVELPDSYEILESGEALDLRSYGRILRKRLPSILVVFFILFTVILIATLKQRP
VYRAQALLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASESLARRAIDQLHLETLREFNTRKWWQLWPETRKPSTT
QTFAVGPVPQVRDRELSERVLERFLDRLTIDPVNRSRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEW
LSQQLVGVKAKLEKSEDALQSYARRNGLVFLETDKGASQNVANERLRQLQEQLTKAQSERYEKEALYRLVQTGESGALPG
VFENKLIQDLSERLAELKREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRAADRMVNDYSAAVRRENLVQQALDD
QQKQVNLIAEKSVQYNILKREVDTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVKPKILLNLAVAMFLGLG
LGIGTALFQERMDNTLKGDDDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNVAGKNSHSYWHRIDRDET
QHASLVEAFRNLRTSVLLSTPDRPPSSLLVTSTQPAEGKTTVACNLAISLAQLGHRVLLLDADLRYPSLHKLFGTSGSLG
LVSYLTGQQDWRAVVRPSGSRGLDLLVCGPVPPNPSEMLSSQSMSALIRSASAEYGFIILDSSPMLALADSRILAPLVNG
VLLVVKSGTTPREQFMHAQSGIRGVGGNLIGVVLNNVDICTNGYYNYGPYGLNPDCPSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9H8K0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=797 residues).
MDDKNQVELYGRDQRLERRGPDALNTRVIEMPDSYEILESAEALDLRSYGRILRKRLPTILIVFFILFTAILIATLKQRP
VYRAQVLLEIQKENPDIPTIKELYELDAVSDAYLRTQYSILASDSLARHAIGQLGLETLPEFNSPRWWRFWQERRKPSTT
QTLATGPVPEVRDRELSQRVLERFLDRLTIDPVNRSRLVAVRFDSHDPELAARVVNTLAADYVDQNLEARWQATQKAAEW
LSQQLVGVKAKLEKSEDELQSYARHNGLVFLETDKGASQSVANERLQQLQEQLTKTQAERYEKEALYRLVQAGESGALPG
VFENKLIQDLSARLAELKREHAQLSTTFNPDYPRVKEIQSQIDEIAASLREERQRATDRIVNDYSAAVRRENLVQQALND
QQKQINLIAEKSVQYNILKREADTNKQLYEGLLLQLKEAGVSASLKASNIRLVDSAQPPAKPVTPRTLLNLAVAMFLGLG
LGICTALFQERMDDTLKGDDDVERLFGLPSLALIPAVPPSNGDLQGIHRFLPRDKALILEGNAAGKNSRSFWHRIDRDGT
QHAALVEAFRSLRTSVLLATPDRPPGSLLVTSTQPAEGKTTVACNLAISLGQLGHRVLLLDADLRFPSLHKLFGTSGSLG
LVSYLTGQEDWRAVVRPSGSRGLDLLVCGPVPPNPSELLSSQSMGALIRSASAEYSFIILDSSPMLALADSRILAPLVNG
VLLVVKSGTTPREQLMHAQSGIRSVGGNIIGVVLNSVDIRTNGYYNYGQYGPNADSSSHETVVTANFQMPPQQKASD
>gnl|bykdb|A0A2V9ILE2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRMLVRHGWTILTVAFVVTMLVALISFRLQPVY
QATARVEIEAATPEIRTLSDLFEAMPADDMFLQTQVNVLQSDNLAWQTIEQLRLGENPAFAPPLKGASPQRGESAEAESP
LVGIFKGGLRVEIMRNSRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLDELKAKVERSQQAL
VDYERDNKIINISDKENVEEKKLGDLSKELTDAQAEVVRAESLYNVARNNENQMASLVGNDLLSRLEEKYAELKSQYVEA
REQYGPNFPKVVRLRDQAEEIRSSLEAERKRIVERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNILKHEFQT
NQQLYEGLLQRLKDATLSSGLRATNIHIVDQARVPGAPVRPRKLFNVTIGLLVGLILGVALAFVQEALDDSIKSIGQVER
YLSTNALAVIPLARTVRSRSLDRGGNGSADRREAVELTLLKRPASELAEAYRSMRTAILLATSPRPPQVIVMTSAQPSEG
KTCTSLNLSLALAQRRVRVLVIDADFRKPGIAAAMGMSNERGLSNILRGEQSVDEVLLQAHTLPNLWVLPAGPVPSNPTD
LLSSPDMARLVEELKQRFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRIIENAGGKILGVVLNKV
DVRRGTYYGSYYGYGRGYYNYYYGARSGR
>gnl|bykdb|A0A2V9IVR7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=733 residues).
MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRMLVRHGWTILTVAFVVTMLVALISFRLQPVY
QATARVEIEAATPEIRTLSDLFEAMPADDMFLQTQVNVLQSDNLAWQTIEQLRLGENPAFAPPLKGASPQRGESAEAESP
LVGIFKGGLRVEIMRNSRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLDELKAKVERSQQAL
VDYERDNKIINISDKENVEEKKLGDLSKELTDAQAEVVRAESLYNVARNNENQMASLVGNDLLSRLEERYAELKSQYVEA
REQYGPNFPKVVRLRDQAEEIRSSLEAERKRIVERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNILKHEFET
NQQLYEGLLQRLKDATLSSGAPVRPRKLFNVTIGLLVGLILGVALAFVQEALDDSIKSIGQVERYLSTNALAVIPLARTV
RSRSLDRGGNGSADRREAVELTLLKRPASELAEAYRSMRTAILLATSPRPPQVIVMTSAQPSEGKTCTSLNLSLALAQRR
VRVLVIDADFRKPGIAAAMGMSNERGLSNILRGEQSVDEVLLQAHTLPNLWVLPAGPVPSNPTDLLSSPDMARLVEELKQ
RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRIIENAGGKILGVVLNKVDVRRGTYYGSYYGYGR
GYYNYYYGARSGR
>gnl|bykdb|A0A2V9IXG5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=681 residues).
MQDLNVSESLPQLDIRYILHVLWTGKWVILACMLVALALAAVNNNFQKVSYRAQAQIQIDAPPFLPSPGADFNAQSSYYL
NIDRYFKTEKQKLTSRRMHLLFAGRLKQQNPRFQNQSSDGIAGELGGGISLAPVEDTNLLWLEFVADDPRKAADWVNLYV
DLYVEENDRQQGEAVKQSRDVLKRQLYEIKSMLASQQTQMNQYAESSNLPVTPEMASVEFEMVSRYRADYEDAKAKREEE
EQKLAKLETYIADSSKLTNIPELVSSPSFRSYYIQWVEANNALEKLRLDGKGEEHPTLVAKRTELDNLRKQLRNELVKYA
DGMRVSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMSSFIKSKENWASAFAAVEQKLRDLSLQEGFVTSNIKVVEHAG
AGYRVATRGANFVILATLGGMILGMALVVLGEVINPRVKTVEEIQTSLSVPALGFLPRTKDFGLHQIRESYNVLRTELLF
NKNLRQHKVIMVTSSLPEEGKTTVTMNLAKTLAAAGDRTMVVDFDLRKARLRSILSTGKQNGNSIFSPVEGLKLRVEQTQ
LPSLHLTVAESLPQNPPYLLSQPSLRDFISYLSDRYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSL
SALAKTHANIMGAVLNDLDVKKTRYYAYQSYYRYYSDSDAK
>gnl|bykdb|A0A2V9J2P4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=681 residues).
MQDLNVSESLPQLDIRYILHVLWTGKWVILACMLVAMALAAVNNNFQKVSYRAQAQIQIDAPPFLPSPGADFNAQSSYYL
NIDRYFKTEKQKLTSRRMHLLFAGRLKQQNPRFQNQSSDGIAGELGGGISLAPVEDTNLLWLEFVADDPRKAADWVNLYV
DLYVEENDRQQGEAVKQSRDVLKRQLYEIKSMLASQQTQMNQYAESSNLPVTPEMASVEFEMVSRYRADYEDAKAKREEE
EQKLAKLETYIADSSKLTNIPELVSSPSFRSYYIQWVEANNALEKLRLDGKGEEHPTLVAKRTELDNLRKQLRNELVKYA
DGMRVSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMSSFIKSKENWASAFAAVEQKLRDLSLQEGFVTSNIKVVEHAG
AGYRVATRGANFVILATLGGMILGMALVVLGEVINPRVKTVEEIQTSLSVPALGFLPRTKDFGLHQIRESYNVLRTELLF
NKNLRQHKVIMVTSSLPEEGKTTVTMNLAKTLAAAGDRTMVVDFDLRKARLRSILSTGKQNGNSIFSPVEGLKLRVEQTQ
LPSLHLTVAESLPQNPPYLLSQPSLRDFISYLSDRYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSL
SALAKTHANIMGAVLNDLDVKKTRYYAYQSYYRYYSDSDAK
>gnl|bykdb|A0A2V9J4D6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=739 residues).
MTHRSRFTPSSASLRPGSSNAPPSFAPLPSCASAGGKSFRWRWLSWISVTIYTFKAERVYQATARLDIEAETPMNLSAES
LYRNESTPADETFLLTQTQVLRSDNLAWETIQQLKLADDPSFTKGPQKQRKESIDSADVRGRLVKLFDSYLGVNLHRNTH
IVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWMEQQLDELKAKVEKSQEALVNYERANSIVNVNDKQSV
AEQRLSELSSDLTRAQSDRAEKESLHQLVKSNEAQIALLAQDHLLETLEQKVADVKTEYIDARTTYGPNFPKVVRLQQQI
DEVQLLIQQERHRVVERIQRDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHNILKRDSDTNQQLYDNLLQRLKDATVT
AGLRATNIHVVDKAVPPATPVRPKKALNVALGLLAGIILGTAFAFLEEQLEQKTVKTMEDVQRLVGLPSLGLIPLWAPNH
NGRQYGLRRKKNSELPASNGQTGLAALEHPASSVAESYRALRTSIMFSTSPKPPQVVLVTSGHPKEGKTATAVNLASLMA
QTGSRVLLVDCDLRIPGASKLMGISNSKGLSGILTGAYSVDEALQEVKGQPGLWALPSGPPPPNPAELLSSPEMQSVMQN
LRQRFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQILHSTGARILGVLVNKADLRRGGGYGYGYN
YYNGYYYSDYNSYSLRPPE
>gnl|bykdb|A0A2V9JEC4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=759 residues).
MPRNTDHEQTASARSETALSERPAIGEYVVPQLEDAEGGASAFRVYWHVLKRRWPTVITVASAVTLLATLISLKMQPVYK
ATARLEVKGEMPQLQTINEIDRHAPVDSTFLQTQVDLLQNDSLMWQTIHRLDLESRPEFNPRRTASSKSQLESLPPLQDR
LIRAFKKHLHVALMGNSRLITVSFESTDPELAANAANTLATNFVEANFQGAYDTTREATKWMEQQLDELKTKVERSQQAL
VDYEKANDIASIGDKENVVQLRLEDLSKDLTTAQTDRAQKESLWESVQEDNSLAEVASNDALLQHLEQNYADLKTQYAAS
LAQAGPNFYKAVQIRKQLAEVESLINRQRMRLVKQTKDAYDTAVRRETLLSRTVAEQRKDVERLNQLLIQHNILKGEFET
NQQLYNDLLRRLKDATLSVSLRAASVRVADRARVPAVPVRPDTRRNFPLFAFAGLVIGVTLAFAQEALNNSIRTPDDLEG
SFSIRALTIVPAVFSSRLPYSRLPRLRSKHPLPPSRIELAVLENSSLDVAEAFRILRTSILLSMTPRPPQLLLITSPLPC
EGKTSCSINLAASLAQRGGRVLLLDADLRRPGVARALSLDGKKGLSTVLTGGHQIEVALETFQNLSTLSILCAGPVPPNP
SELVSSATMEQVIGELRRRFDHIVIDSPPALVFTDATILSALVDAVVLVVESDVTTRAALRRARQTIEQAGAHIVGAILN
KATRRATDGYYGSRYSYYGSYYHKPPTSDVLDSGNGSSG
>gnl|bykdb|A0A2V9JPV9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MSRYFNKDEERRYFELMNQHPRNSLAVQPPSRGVPRSTPNLSNRYPQRVIDAPEQVSAAGLWRIIRNRKWVIALFALVVV
AIVATASFLMKPQYEAVGRVVFHRENDSGVLGFKGVDTSLLEDPEDRAAIDTQIGILETDTLAMQVINDLHLDTNPNFAD
RAAHSGNEDRLVKSFHKNLTISKVKGTRLLEIKFRNTDPRLAADVVNQLTKAYVDRYYRNQFEASTQMSEFLASQLKELQ
AKVEESQQKVVDYTKEIGIFGLGDKQNIVTAKLDDLNKELTSAEADRVQKEIDYRLARSGEPELIAKLGPDNLITKLRAQ
QADLENQMAQASVQLGPANPKISELSKQLAQARQSVDVEVRRIGERITYEYKSAVGRERMLRYALEAQKQAADELNANAI
QYDILKHEFETNRKLYEDLLQKQKEVGISASLKSSNIWIVDPARPPKRPAEPNILRNFALSLLFGIFGGVLLAFGLTKMN
ETISTLEQAIALSPLPSLGVVPLLEAKGKSRAPAQLNGVNGDLKPELVSVLQPLSLAAESYRAILTSILLSQPTPPAVIL
VTSALPREGKTTVSTNLAITLARLRRRVLLVDADLRRPSIHRAMGLSTNTGLGALLRKSTVFEKAVSDCAKIPNLFILPA
GPITLPDDTELLVSGFKDLVERWREQFDHIIIDTPPVLPMTDAVHMSVEADSVILVMRSGQIARDEFLCAQDLLLKVNAR
LLGFVLNGAGLSSSDFQYYYGYYGQDQSKRLGKGA
>gnl|bykdb|A0A2V9JSI3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=745 residues).
MTNDNALAPIEHVPFERVGYRKPSVVTVEAEEFDSPLDLRHYWNNLVKRRWTVVTVAFVVSTVVAMVNFRMPPVYEARVS
VEVEGEAPEVQSISNFYRGTPSDEAFLRTQVKVLESDSLAWQTIQQLGIDQSAEFSPPRGGKPVSPAIVQISLINAFRDH
LRVEWVRNSRMLEVSFEARDPRLAAAVANALVSNYAEYNFRKRYDATRQASGWMEQQLDELKAKVEKSQQAMVDYERQNA
IVNINDKQSVEEQRLAQLSNDYTNAQNVRLDKESLFELASSNEAEAAVLMQSEVLGRLEEKYAELKAQLVDASGQYGPNY
PKVVRLQDQVNEIQGFIERERKRIAGRVRNDYRAAMGREKLLAAALAREKEAVGRLNQVLIQHNLLKREFETTQQLYENL
LQHLKDATVSAGLRATNIHVVDPALPPAAPIRPKKTQNIAMGLLGGLALGVMLALFADVLDNSVKSVEDIERLTGMPTLA
VIPLAASDRARRAWRKGAGEKAASSTTPVGLAVLKHPASPLAESYRALRTSVLLSTPGHPPQVILITSSQPNEGKSCTCL
NLALTLAQRGGRVVIIDGDLRKPGVASVLGLANGKGLSSILTGAHGLEEALQQLDALPGLWVLPGGPRPPNPADLLSSVS
MKEVLAELRGRFDHVVIDSPPVLLVTDATILTPLVDGIMLVVESGMTVRGAIQRTHKILENAGGKVLGVVLNKLDARRNG
YYGSYYPSAYGKYYLTDEEQSAVKS
>gnl|bykdb|A0A2V9KA79 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=747 residues).
MQNGTANTSASLTNLVAIFKRRLWLVLATTFVGTLCGGGASVLLPVRYRAQVLLAAESAPTRDYLRLGGYGDAIHIQDQL
RIIKEHLYKPALLERIIREFGLYPVTRGAATSRQIDEMRARIQITVEGNDAFYVSFEGTGAAQVRDVANRLAEEFIHEVS
AADESRVEEAAGLVGARVEQLRKQMQEQQDRITRYKQATLSELPENLGNNYKLLETIQARLQTVGERISNDAARRVAAAN
EMRELQRQGATENRAVVEEASAVQKKLEDLRLELKGLQARGYTENHPEVIRLRRQIQEFEASASAQAPVEGPVSARRPAG
EPSPFFLRYLQLKSEVEAIDQRLNSSKQEQRDLTAQLETYRSRVQSTPTHAGALADMTRDLESTRTQYQSLLDKQQQATL
ASKRGKVETNVLWRIADPARLPSAPVTPGRVRILLLGLAAGLCLGLGLAVLAENLDTTFENAEQFQSFFDFPVLCIIPSM
NLHNLRRKVRSEEISPRAPARRHTGEQRVSIASVPDRPGKHSLTSQPPPSIATDQYNILAMKIRSQLGDENGRVLTITSA
AGGEGKTLTSVNLSLALASTFEGQVLLVDADLRKPRIHHYLDIRPGTCFDDLLVQPRLAIEDCLTTVRTLHVMLGRRSLA
NNPVQALAAKRMHEILAHARQRYRLIVLDAPPILPMADSHILAGLSDGVLLVVRARQTRRELFQHAVESFHATNILGVVL
NDVDVDHTRYAYAYRYYQKNYATKTPA
>gnl|bykdb|A0A2V9KBD6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=730 residues).
MDLSRPEPRLPPKVPSPRVQRVVGAPDEALASTLWRIIRPHKWITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVFHRD
NDSGVLGFKGVDTSLLEDPEDRAAIDTQISILQTDALALKVIQDLRLDQNPMFIGGAKAVNEDRLVKLFHKSLDISKVKG
TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYYQSQFQVSEQISAFLTNQLKELQARVEDSQQKLMEYQKQNGILGLDNQQ
NIVTTKLADLNKELTASEADRVQKEVSYRLARSGQPELLAKLEPGSLLTTLRAQQDDLERQNAQASVQLGPTNPKMAELS
SQLSQVRSSIDAEVKRIGDRLTYEYHSAAERERMLRAALEKQKQVADDLDAHAVQSEILKHEFETNRKLYEDLLQKQKEL
GITASLKSSNIWIVDPARAPKLPSEPNLVRNVALSLAFGLFGGMCLAFGLEKINEKTIRTVEQVQLLSPLPVLGALPLLE
ANSKNGAPANLPALSIYRNRALVSLLEPMSLAAESYRSVLTSLLLSQPTPPVVIQVTSALAAEGKTTVSANLAILLARLR
RRVLLIDADLRRPRIHLAMQLNATAGLGALLKKSVAFEEAVCSFPNLPDLFILPAGPVTQPEDTELLLSTFKELVESWRQ
RFDHIIIDSPPLLPVADALRLSVVADSVILVIRAGEVGKDTFQRAQDALFKVNAPLTGFVLNGAQLDSADFRYYHSYYSP
DQSKRLGNAA
>gnl|bykdb|A0A2V9KCS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=852 residues).
MWRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADSTSGALMDQIVHLPKGPQRELIR
RTNGGVPASGSLPYGDSPVDQEYGADAVSGGLLYYWHMILRRKWTVLIIGFVGTLSGFLVSLPQTPVYRSRTSVEIQALN
DNLMNTRQIDPTPGTNDMYVQTDILTQIKILQSDSLMERVVTKLKLDKKPAALEQPTKLSAWRKALGLPQPAAPSREQAA
GMAAASVSVRSVNETRIVEILCDSTDPKFAADFANTLVSEYMEQSLESRWKNAQRTGDWLTRQLEDQRINLEKSEDRLQG
YARSSGLMFTAEKDNVAEARLRQLQEELSKAQGDRVAKQSRYEVALSSSLEALPEVLDDASLQDYRQKLTELRRQLAELG
ATYTSTHPKVERVDAQIASVQSALERERVNILKRIRNEQEAAVRRESLLAAEYGSQAKLVSEQSGKTIHYNILRREVDTN
RQLYDSMLQRVKEYGIASAMHASNMRVVDPAKAPRLPYKPNLLQHAGVGFIAGLLLGTVFVVIQEQADRSLQSPGDGPTY
LNLPELGVIPSAKADRGLNSYFKRLPALKGPKDSEQTLGSALVKKNGRRNGNGNHEIELVTWYRKPSLLAESFRTTLASI
LFFEADGNRPRILVMTSSAPGEGKTTVTSNLAIALAEISRRVLVIDADMRRPRIHDIFDVANTWGLSDLLREKDAVDDYP
FEALSRKTLIPGLYVLPSGPGTVSISNLLYSPRLAELLNRFRKEFDTVLFDTPPMLQISDARVVGRLADGVILVLKAGQT
TRDMALAATQRFAEDGTPVLGTILNQWNPNSTAGYGYYSDYHQYYSGERKSG
>gnl|bykdb|A0A2V9KIE8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MGKSEILPGDRLNRIAPVSMEQVRGQEFLEVGHEEAPHLMDYWHLILKRRWTVLTALLAVFLTVAIGTFKQKPGYSGTAL
LEINPEPPNVLNFKEVLQISNQDVDSYRETQFRVLESRTLAERVVRDLALYRSPEFYRKSILFGLMETTPANVPSPTDNA
PPDVNSEAFTNAVKHFLDAVEISPVRRSNLVEVSFGSHDPRVAAQVANRLAQDYIDSNLQVKWDETIKASDWLQGQLVGL
KAKLEKSDDQLQAYAQEHSILFITEKQNLVNDRLQQLEQEYTKAQAARFHAEASYTLVKSTKNMDLPSVLSDKFIQELEG
RLAELERQYAEMTSMVKPEYPKAVQLKKQIDVLEARITAQKQALVENIVEEYHAAESNEKLLAQAVVQQKAEVNDIAQKT
IQYNILKREADTNKQLYESLLQRLKEAQVSEGLKASNIRIVDQAETPKLPVKPRVILNLALGFAFGLALGIGLAFFQEYL
DNTVKSPDEVEELVRLPSLAVLPSFALNDGKGDASKQLAKAAPGDRVVAPAIQTTAVGKESFRTLRTSILLSAHPVPRTI
LITSALPGEGKTTTTVNLGVALAGLGSKVLIIDCDMRRPACHRATGVENKPGFVQCLTGRVQISEAILPVPGVANLWVIP
CGPIPPNPAEVLSSPVAGALLNSLRSEYEYVIMDSPPLLSVSDSRILATMTDAVVLIARANSTPYQVIQRAKNLLYGAGA
RILGVALNGVDFRHGGYGYGYYRRYGYGYGYGYGYGYGYGYGYGKDAEEGDNEAQSPDQNS
>gnl|bykdb|A0A2V9L5B5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=778 residues).
MNESIDVHQRRGLVQGDQDSSGESQHAIEPAFSRSLQESEVLDVSPEEVPHLLDYWQVVLKRRWTVLVCLLVVFTTVAIG
TLKKRPVYEGKVLLEINPEEPQVLNFREVSQEAPTVDVDSYRETQYKILRSRTLAEKVVNDLHLYQSPEFYRNRGLFGLY
ESDPEKIPSSDPGPPDTLTDAYRNSVTHFLASVDVNPVRRSNLVEVTFDSYSRTVAALAANKLADDYVEQNLEVKWDAAE
KASQWLQGKNAEIKAKLEKAEDELQAYAQANSIVYITEKQNMATARLEELLEAYTKAQSERFEKQSLYSLVEAGKIQDLP
GVLSNRLVQDLEIRLADTKKEYAQVTTWVKPDYPKAQQVEKQIDALQAELDKQKKAVVDNIVDEYRSATAKEQYFAQAVD
DQKREVNEIAARSIQYNILKREVDSNRQLYEGLLQRMKEAQASAGLRASNIRVVDAAEAPKYPAKPRVLLNLVLGLILGL
GLGVGMAFFQEYLDKTLKTPDEVERLLRLPSLGVLPRFTPNGAGEVRQDSLEAVEPGVATALAPAIQTHAEVLEAFRSLR
TSILLSASPVPRVILITSALPGEGKTTTAVNLGAALASLGSKVVVIDCDMRRPSCHRSVGVKNSPGFVQCLTGHVELAEA
VLPAPGVPNLSVIPCGPIPPNPAEVLSSSLAAESLRKLRADFDYVLVDSPPLLSVADGRILATMVDGAVLVARAFETPYD
LVRRARALLYNAGARILGVALNDVDLRREGYGHNGSYGYSYTGYGAPGSEGSSRHGNT
>gnl|bykdb|A0A2V9L7I0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=765 residues).
MDESENLQRDPVRALARTATQPLEKPEILDVSPEEVPDLIDYWQLILKRRWTVLVCLLAVFTTVAIGTLKQRPVYVGKVL
LEINPEEPQVLSFKEVTQAAPTVDVDSYRETQYKVLQSRTLAEKVVNDLRLYLSPEFYRNQMFFGLFESDPEKIPSISQP
GLPDTSSDAYVNAIAHFRKSVDVSPVRRSNLVELTFDSYSPEVAAQAANKLARDYIEQNLEVKWDAAAEASKWLEGKIVE
IKAKLEKAEDALQAYAEANSIVYITEKQNMGNARLEELLQEYTKAQAQRFEKQSLYSLVEAGKVQDLPAVLSNRLIQDLE
ERLADVQKEYALVTTWVKPEYPKALQVKKQIDALQAEIDRQKKAVTENIVDEYRSAAAKEKYFAQAVEDQKREVNRIADK
SIQFNILKREVDTNKQLYEGLLQRMKEAQVSSGLNASNVRIVDAAEIPKGPAKPRVLLNLILGLVVGLALGVGVAFLQEH
LDKTLKTPDEVERLLHLPSLGVLPRFTLNGNGKVPEEEDSLAAVPEVEMAVAPAIQSHADAVEAFRSLRTSILLSASPVP
RLILITSALPGEGKTTTTVNLGAALASLGSRVVIVDCDMRRPACHRSTGVRNAPGLVQCLTGKGDLAQAVLPVPGVANLN
VIPCGPIPPNPAEVLSSPLAAELLRKLRTEFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFETPYDLVQRARSLLYG
AGARVLGVALNDVDLTRDGFGYQHYHYGYIAGVSPSSGRESEARD
>gnl|bykdb|A0A2V9L9C5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MREEFGKSGTLVGRAINDSPEPIHPIISITSAGEFERPSVLRAIAVLRKRWWEVLSVAMVVLISVTIYTFKAERVYQATA
RLDIEAETPMNLSAESLYRNESTPADETFLLTQTQVLRSDNLAWETIQQLKLADDPSFTKGPQKQRKESIDSADVRGRLV
KLFDSYLGVNLHRNTHIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWMEQQLDELKAKVEKSQEALVN
YERANSIVNVNDKQSVAEQRLSELSSDLTRAQSDRAEKESLHQLVKSNEAQIALLAQDHLLETLEQKVADVKTEYIDART
TYGPNFPKVVRLQQQIDEVQLLIQQERHRVVERIQRDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHNILKRDSDTNQ
QLYDNLLQRLKDATVTAGLRATNIHVVDKAVPPATPVRPKKALNVALGLLAGIILGTAFAFLEEQLEQKTVKTMEDVQRL
VGLPSLGLIPLWAPNHNGRQYGLRRKKNSELPASNGQTGLAALEHPASSVAESYRALRTSIMFSTSPKPPQVVLVTSGHP
KEGKTATAVNLASLMAQTGSRVLLVDCDLRIPGASKLMGISNSKGLSGILTGAYSVDEALQEVKGQPGLWALPSGPPPPN
PAELLSSPEMQSVMQNLRQRFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQILHSTGARILGVLV
NKADLRRGGGYGYGYNYYNGYYYSDYNSYSLRPPE
>gnl|bykdb|A0A2V9LGY4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRMLVRHGWTILTVAFVVTMLVALISFRLQPVY
QATARVEIEAATPEIRTLSDLFEAMPADDMFLQTQVNVLQSDNLAWQTIEQLRLGENPAFAPPLKGASPQRGESAEAESP
LVGIFKGGLRVEIMRNSRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLDELKAKVERSQQAL
VDYERDNKIINISDKENVEEKKLGDLSKELTDAQAEVVRAESLYNVARNNENQMASLVGNDLLSRLEERYAELKSQYVEA
REQYGPNFPKVVRLRDQAEEIRSSLEAERKRIVERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNILKHEFQT
NQQLYEGLLQRLKDATLSSGLRATNIHIVDQARVPGAPVRPRKLFNVTIGLLVGLILGVALAFVQEALDDSIKSIGQVER
YLSTNALAVIPLARTVRSRSLDRGGNGSADRREAVELTLLKRPASELAEAYRSMRTAILLATSPRPPQVIVMTSAQPSEG
KTCTSLNLSLALAQRRVRVLVIDADFRKPGIAAAMGMSNERGLSNILRGEQSVDEVLLQAHTLPNLWVLPAGPVPSNPTD
LLSSPDMARLVEELKQRFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRIIENAGGKILGVVLNKV
DVRRGTYYGSYYGYGRGYYNYYYGARSGR
>gnl|bykdb|A0A2V9LK56 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MDEIQNSNGFQGASLAPRTTALPDSRVLDIGPEKVPSLFDYWQIILKHRWLLISTLLIVFSIVAVGTLKQKPSFQGSILV
EIDPDPPSVVNFKEILQVASADVESYRETQYRVLESRSLAESVVKDLELYRLPEFYRSRRLFGLFESDPARIPSPTEDLD
PSSEAFNNSIANFMNSMSVGPVRRSNLVEISFYSNDPKLAARIANRLADDYIEQNLQVKWDAALKASEWLSGRLDELKGK
LEKSDNALQEYAKKNSILFVDDRKNLANERLGQLQQEYTKAQADRFQTESLYNLVKPDAAKDVPGTLSNKLIQDLEFKIA
DLEREYAQLTAVVKPDYPSAVRLKKQIDLLQSILGKDKRTLVQNLVDAYSSAVNREKYLEQALKGQEKQVNDIAEKTIQY
NILKREADSNKDLYNGLLQRMKEAQVSAGLRASNIRIVDAAEVPRRPVRPRVILNLALGIIFGLGLGVAGVILLEYLDNT
LKSPSQVESLLRLPSLGVILEFDLFSARKSGEARLTKGSEAGGKSDIVIRRDPAAVEAFRSLRTSILLSANPSPKIVLVT
SALPSEGKTTITVNMGATLASLGSKVLVLDCDMRRPTCHRATGVPNRPGFVQCLAGRVELKQAIFPVPGTENLFVIPCGP
IPPNPAELLSSQLSMDLLNALRSQFDYVLLDSPPLLSVSDGRILATLTDAVVLTIRAGHTPIEAVRQACASLKSVGARIL
GVTLNGLDLRRDGYGYGYGSRYGYHYGYGYGYGYGYGADSEDSTEAGTQNSSDGVR
>gnl|bykdb|A0A2V9LPQ3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MADIQKLTTTEPAPLARRRAASSESIGFGLLPTDFDGFSSVLRVYWEIVYRRRWQIVAITVAAVTIMAIYSFKVNPIYRA
TAHVEIEAEAPLTMSVSDRFRSMPADEAFLKTQALVIGSDHLAWETIGQLGLAENGAFIPQTPKDASGQRAPEPRMLRDR
LVREFQRSTTVRLMPNSHMMEVSFESTDPDLSAKVANTLINHYIEYNFRKRYDATRQASGFMEQQLEELKAKVEKSQEAL
VGYERQNSIVNVSDRQNVVEQRLSDLSRDLTTAESDRAQKESLYQMVKSNPEQIAMLAQNDLLQKLQEKSADLKAQYVDA
LGQFGPNFPKVVRLRGQVAQMQSLIEQEQKRTVERIQNDYRAASTRVSLVSTSVVQQKAEVGRLNQLLIQHNILQREFQT
NQQLYDDLLQRLKDATVSAGLRATNIHIVDTASPPAVPVRPNKLLNLMLGLVAGGLLGLVLAFAEEGLERRSIRTPDDVE
RLLGIPALAIIPSASLLIRRYGSSKRGGAQGEAQKRSESVAVMMLTEPASAVAESYRALRSAILFSSTPEPPKVLLVASS
QPKEGKTCTSINLALSLAQNSVPVLIIDADLRKPGVTRELNLPSTKGLSGVLTGRYSLDEALREVENTSLSVLPAGPTPP
NPAEMLSSPAMRQLITELVERFKHVVIDSPPLLMVTDATILSTMVDGTVLVAESGVTSPGALARCHRILDVAGGKVLGVV
INKVDFQQEGYYYGSLYRYYGSYYGKPDNGESASP
>gnl|bykdb|A0A2V9M454 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=757 residues).
MNGDELVPLNSGPVTPPPNRNGSGPHSYIDLEQVDAFGQLRATWDILLKHQWLILVTAFVLTLLVTVYSYKMKPVYRATA
RVDVEAEEPLLQSLNDLFRTEQADDSFLASQISILQSDNLAWETIQQLGLARLPNSGQTSPADGRVLGTPPAMKNAAVAA
FKARLKVERPKDTRMALVSFESTDPREAAAVVNGLVTNYIEHNFKSKYDATRQATGWMEQRLDELKLKVEKSEEAMVTYE
RQNNIANIGDKQTAEEARFEDMSKELSQAQSDRISKESLYKMVVSNEAQVGFIQTNSLLPGLEAKELDLKEQYSEALAHY
GPTYPKVLSLQDQIKDLQALVVRERKRVVDNLHNDYLAAVEREKFLATAVAQQKVQVDRVNQLLIQHNLLKREFESNQQL
YDNLLQHLKDGNVSAGLRATNIRIIDEATIPSFPVRPNRPRNIEFALAAGLILGIALAFTREALDNSIKNAQEIEKLTSL
PTLSIVPLSHSSVLRRPGLFHSKAANGANGDGGYAVELAVLKKPGAAISEAFRTLRTSVLLSTAERPPKVLLITSAQPSE
GKTATTLNLAVTLAQKGSRVLLIDSDLRRPGLAKALKLRNQNGLAEILTGACEFDETLLEKVEGLDRLSLLPAGPYPPNP
AELLCSTKMENLIKHLRDQYDHLVLDSPPVLPITDATILSSLVDGVIMVVECEATTRAALSRACRVIEHSGGKILGTVLN
KVDVRRDGYYGYRYYHGYYSYKYKAYYREEDRSSGRS
>gnl|bykdb|A0A2V9MAM9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=758 residues).
MLPVSKLSKAPQRPSHSLSRAEFQRLARPSPEALAAGTSAEIETGSLSIIEYLRVLRRHSLLLAVITAATVGAAFLVSIA
QPRLYQSVASVEVQGLNENFLNLRDVNPTATAPTHSEDSYIETQAEILRQDSLIGRAFNRLPAERRGGLVLPGWSERLLP
VFAPRSPGGNDDREAILRVKDRLRIEPSKQGRIIRILCDATDPQLAADFANALAQVFIEQSVEARWNGASQIREWLNPQL
EELKGKLVKSEGELQAYLRSSGLIFGAGQETLAENRLHLIESELSKAQADRIAKTPAYQLADKEHPELLVDNAVIRDYQV
KLTELRKQLADLDSVLTPENYKVVRLKAQITALESALAKEREETRQRLRNDYLTARRREALLSSAYQQQTHLASDLRKKM
IHYDTLNREVATTRQFYEAMLQKVNDAGVATAIRPSNIRVVGPAQPALQPYKPNFLLNVAIGLFGGLVLAIGCVTVVNQA
EAGRSREPGDVEARLNLVELGAIPSARSVVGASPGRSLRSDSHNATELTGWENKFNALSESFRCLVTSILRLGGDEGQSP
PRVLVITSTLPAEGKTTVATNLGITLASIQRRVLLIDGDMRQPRIHHIFDLPNTWGFSNLLRGADELPMDTIVKRTTVPN
LYVLSSGPGTEDIFSLLFSPRLRRLIERFREEFDHVIIDAPPSLEFADARLLGLTADGVLMVVRANHTDNKTVQLAIQRL
LTDGVPVLGTVLNDWNPNIATYGYYRYGKSYSWKNAET
>gnl|bykdb|A0A2V9MN96 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=734 residues).
PYRIGGQHPLLSYWRILKKRKWTIVATFAIILVLAIIATLRMPRLYEAASRIAIYPENSNVLGLKDLENGGMSEDWDYNV
SLETQLSILRSDALALKVVEALHLDSNPRFTGFVPVANDASRSIGSANLGPDSQQIASMLSIFRSGLTVQVMPRTRVIEI
TYIHPDPQLAAEVTNALVKTFVEENFRTKYESTSQTADWLSKELSDLQLKVQASEEKLVRYEKQKGIVGIDEKQNIVTAK
LDELNKELTGAQTDRMQKEANYGLAEAGDPSGFAKLSADNLLEKLRVQQAELETQYAQATTQFGPSYPEVIQLRSQLNQV
RNSIATEQKNLLSKVRDEYMAAIQRETLLTSAFDHQKQEANQLNESGIEYTALRRDADSNRQLYQSLLQRLKEASVTAGL
RSSNIRVIDVARLPTGPAKPDVRRNIFLGFLLGLAGGVALAFLQESMDTTVGSLEELSAITALPMLGVIPLQLAENGRRH
LHPAGGSLITASTVDGPVAHVRPKSEAAESYRALRTSILLSSFGAPPKVVLVTSALPQEGKTTVSANSAVVLAQKGGRVL
LVDADLRRPGVARALGLKTSGGLSTLLSGVDTMENVMVPFPGLPFLQVLPAGPIPPNPVELLGSSVMKDCIARWRNEFDH
IIFDTPPCLSVTDSVVLSVEADRAILVARSGQTPKGAVRRASELLLQVNARVMGVVLNAFNFRSTDDNYYYYGSKYSGSY
YQQPEENDRGAYAS
>gnl|bykdb|A0A2V9NGH6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MDSAPLIAANTRVLRELPSAHPVEFRRQFGFGIYNPATFQDSVVHEYLRVLIKRKWVVISSVVMIFVVVAIATLKATPVY
DATGSIAINKLDPALISFKDSANAGPDYYDPSDLDTEVGILKSDLLAFQVIKQLNLDKRPEFGGSGQAQSTSLELTTDIL
QPDSVKASAVLASFKSDLKVLLKPNTRIIEIRYRSTDKDSAARVVNTLINTYIEQNFKTKFESTMQASDWLSKQLIDLQI
KVETSQEKLVRYQKQHQILGIDEKQNIITAKLDELNRELTTAESGRMEKESIYGLVQATDSDAAAAAAISADHSTRNASL
SSSLLEKLREQQADFRIQVSQLSTQFGPAYPKVAQLNSQLQEVESQIQLEMKKVIARVRSDYLASVHREEMLRAAMEKQK
QEANQLNESAIEYTLLKRDVDTNRTLYEGLLEKLKEAGVTAGLRSNNIRPVDLARVPIEPAEPDVPRNLSFALVLGLTTG
VSLAFLLEGIDNTVRTPEQAQAISGLPSLGIIPDGSKLSIESSARRRLSLTSSREAIELVTQSRPQSQMAEAYRALRTAL
LLSSVGAAPKVVVVTSALPSEGKTTTSINTAIVLAQKGNRVLLVDADLRRPSIHKTLGMGPRTGLSSVLTGSANVQQTIV
RSALLPSLFILPAGPPPPNPAELLSSGNMKKVLDELREQYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQAL
RRARDILLQVNAHATGVLLNAVDLNSGDYYYYEYQGKHGQRYFGQDEPAIAEEAKATSSGA
>gnl|bykdb|A0A2V9NL07 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=789 residues).
MYLLFQFSIQLGRQMEPSPVMQIGNQVREMGPASMQIGRNIAAIHPAMAAQDSILREYLRVLIKRKWIVVGTLAAIFGAS
LVATLRITPIYDAVGSIAINKPDPMLQNLRDPGNSGMDYYDPTDLDTEVRILHSDLLALQVIKQLNLDQMPEFGGHGAPP
ASSLALTTDAFEADSARANALLGAFKGGLHVVLEPNTRIIDIHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASD
WLSRQLVDLQMKVETSQEKLVKYQKDHQILGIDEKQNITTAKLDELNKELTAAESARMEKESVFRLSDSVDTESAAAVAN
SGSAKGSGSTSGLLDKLQAAKADLKIQIAQVSTQFGPAYPKLAELNNQLQEIDSQIQGETKKVGGRLRGDYLAALQRENM
LRSALEEQKQQENKLNESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVTAGLRSNNIRQVDIARTPAGPAEPNIPRNLGF
ALALGLTSGIGLAFLLEGIDNTVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAASKEAVELITISRPQSQMSES
YRALRTSLLLTSLGAPPKTILITSALPQEGKTTTSINTATVLAQKGTRVLLIDADLRRPSIHKTLGMGPRAGLSNVLTGG
TTLQQATVRSTLLPNLFILPAGTPPPNPAELLASSQMLDLLAELREQYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRS
GQTTKPALRRSRDILAQVNARVAGVLLNAVDLDSPDYYYYYEYQGKYGQRYYDEDMTGGDSVRAASGSA
>gnl|bykdb|A0A2V9NWS3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=795 residues).
MVGLNFFLGASMASGPLIPANGQMLREISSLSSFDLNRQLAAYYPNAPIQDSVVREYMRVLIKRKWVIISCLAIIFGAVS
VVTMRSTRIYDATGSIAINKSDPALLNFKDSPSAAVDYSDPTELDTEVRILKSDLLALQVIRQLDLDKRAEFGGNGQVPS
PNSVQLTTDSLQVDSQRTTDLLSAFKGKLRVALEPNTRIVDIHFRSPDRELAAHVVNTLISTYIEQNFKTRFESTMQTSD
WLSKQLVDLQMKVETSQEKLVKYQKEHEILGIDEKQNITTSKLDELNKELTSAESDRMAKESFYTLVQAADADTAAAAAL
SSATGSGLSSASSNLLEKLREQQADLKIQVAQLATQFGPAYPKLTQLNGQLKEVDAQLQAEMKKVVARVRSDYLAALQRE
TMLRGALTKQKQEANKLNESAIEFTLLKRDVETNRALYEGLLEKLKEAGVSAGLRSNNIRNVDAARVPSEPVEPNVPRNL
AFALALGLSTGIGLAFLLEGVDNTVRTPEQAQAISALPSLGIIPMGSKAPTESNGRQRLSLASSKEPVELVTQSRPQSQM
AESYRALRTSLLLTSIGAPPKVILVTSALPQEGKTTTSINTAIVLAQKGTRVLLIDADLRRPSIHKALNIATKIGLSNVL
TGNATMSQATVRSTILPTLFVLPAGPPPPNPAELLASAQMKDSLAELREQYDHIVIDTPPILSVTDAVVMSIRADTVLLV
IRSGQTTKQALRRSRDILMQVNARVAGILMNAVDLRSPDYQYCYEYQGKYGHRYYQEDELPESEEAAKRASAGGL
>gnl|bykdb|A0A2V9PYE6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=691 residues).
MDPALISFKDSPSVGPDYYDPSDLDTEVGILKSDLLTFQVIKQLNLDKRPDFGGSGPAQSTSLGLTTDILQPDSVRTSEI
LAHFKSDLKVSLKTNTRIIEIRYRSTDKGLAARVVNALINTYIEQNFKTKFESTMQASDWLSKQLIDLQMKVETSQEKLV
RYQKQHQILGIDEKQNIITAKLDELNKELTAAESGRMEKESIYGLVQATDSDAAAAAATSADHSTRIASLSSSLLEKLRE
QQADLRIQVSQLSTQFGPAYPKVAQLNSQLQEVESQIQLEMKKVIARVRSDYLASVHREEMLHAAMEKQKQEANQLNESA
IDYTLLKRDVDTNRTLYEGLLEKLKEAGVTAGLRSNNIRPVDLARVPIEPAEPDVPRNLSFALVLGLTTGVSLAFLLEGI
DNTVRTPEQAQAISGLPSLGIIPDGSKLSIESSARRRLSLTSSREAIELVTQSRPQSQMAEAYRALRTALLLSSVGAPPK
VVVVTSALPSEGKTTTSINTAIVLAQKGNRVLLVDADLRRPSIHKTLGMGPRTGLSSVLTGSANVQQTIVRSALLPSLFI
LPAGPPPPNPAELLSSGNMKKVLDELREQYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQALRRARDILLQV
NAHATGVLLNAVDLNSGDYYYYEYQGKHGQRYFGQDEPAIAEEAKATSSGA
>gnl|bykdb|A0A2V9QB26 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MTEPMDKHALPPASHDLVLRKSEGSPGHGEAGSYLYGHRDELEPGGFVEDWRILCRHTGILAGITLMGALAGVLLSIWQS
PVYRARTALEIQNINEDFLNIKQVTPVSEGNSSTALTEIATQVRLLQSESLIKRVLTKLKDRFPEDPKVRTSRFSLWRKA
SLPETKPSDESGAAQAAARSLNARVSGLTRVVEASYDSTDPRFAAAFLNTLVQEFMDSNMEARLKSSEYTSQWLSRQLED
MRIKLEHSEDALQSYARSTGLIFTSEKTKISEEKLQQLQGELSKTQTDRITAQSRWEITAASPPDALPDFLNDSALRSLQ
EKLTELRRQHAELITIYTEKHNKVKQVEAQIALLEAALQKEQAAIVDRIRNDYKTALRREKLLSAAYRNQSRLVTDQDEK
SIQYGILKREVDSNRETYQAMLQRVKEANIASAVRPSNVRIIDAAEPPEHPYKPNLPMNAAVGLLSGLCIGVAFVVTRGR
ADRTFRAPGEAQLWLNVPELQVIPTAVEESRRCLYTERCNKTTTLSLSRQQRDSGLPKRTSKQVDSPSVELVTWYRKASL
IAESFRSLLTSILFSGSNGACPRVLVLTSAGPKEGKTMVASNLGIALAETKRKVLIIDGDLRKPRMHELFGLPNGRGLSS
LLRDPQRALAKLSRIVQETNIPGLFVLTSGPLTESAADLLHSANLSGLLAKIKIEFDLVIIDTPPMLQMADARVLGRVAD
AIILVTRAGQTTRDAAEAATQRFTEDNTRVLGTVLNGWDPKETSHYDYRYQFYRYHH
>gnl|bykdb|A0A2V9QD92 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=775 residues).
MEPSPVMQIGNQVREMGPASMQIGRNIAAIHPAMAAQDSILREYLRVLIKRKWIVVGTLAAIFGASLVATLRITPIYDAV
GSIAINKPDPMLQNLRDPGNSGMDYYDPTDLDTEVRILHSDLLALQVIKQLNLDQMPEFGGHGAPPASSLALTTDAFEAD
SARANALLGAFKGGLHVVLEPNTRIIDLHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASDWLSRQLVDLQMKVE
TSQEKLVKYQKDHQILGIDEKQNITTAKLDELNKELTAAESARMEKESVFRLSDSVDTESAAAVANSGSAKGSGSTSGLL
DKLQAAKADLKIQIAQVSTQFGPAYPKLAELNNQLQEIDSQIQGETKKVGGRLRGDYLAALQRENMLRSALEEQKQQENK
LNESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVTAGLRSNNIRQVDIARTPAGPAEPNIPRNLGFALAFGLTSGIGLAF
LLEGIDNTVRTPEQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAASKEAVELITISRPQSQMSESYRALRTSLLLTSLG
APPKTILITSALPQEGKTTTSINTATVLAQKGTRVLLIDADLRRPSIHKTLGMGPRAGLSNVLTGGTTLQQATVRSTLLP
NLFILPAGTPPPNPAELLASSQMLDLLAELREQYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDI
LAQVNARVAGVLLNAVDLDSPDYYYYYEYQGKYGQRYYDEDMTGGDSVRAASGSA
>gnl|bykdb|A0A2V9R9V4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=800 residues).
MSDQKRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLPRYGEAEDFHLRMLWRIVRKRRWLIIGIASIITTLVTIDVFR
TKPLYEATTTIEIGRDNGARINSNGLFIQEEDYLNVTMNTSEVILKSLPLLEDVVVQLRLDQNPAFLASQKKSVWESLHE
IAGKIQRDDASAPPAVFTATAMKSKIEGNRSPEEVERLAPYVGMLEESLRVRPILDTRAMTLTFKHTDPVIAAGVANAIA
QRFVETSFDKKIEKFTSASEWLDRSTRELKSKIERSEQALADYTKTNNIYSTDGKATLVAEKLSRLHDLATRAETDRILK
ESLYEQVRQGRVAQIPEAFADTKTVELQRKLGELATTAAELSVTYGPKYPKMAEINQQMAAIRDQIAAGRVQLEEKLKAD
YERVVRDENALKAALEEAKAGAAQENQRAIQYSLLKQDVDTAKSLYTEFLQKTNQAYLEVAQQQSNIRIISPARVPKEPV
SPNRQRTILIGLLLSLSGGIGLAWLLERFDDSIRSVDDVNRYTQLPALAVIPVIGANKSLLNGRRRKDNTPELLALGSGD
KASAIMQRARLMEFDGRSPASEAYRALRTALLLSAAGNPPKTILVTSVRMEEGKTTTATNTAIALAQLGASVLLIDCDMR
NPSVHDVFGTSRTLGLSTYLVRNVEIDELTQDLPGENLRMISSGPIPPNPAELLSSERMKRLLAQLSERYDHIVLDSPPL
ASVTDAVILSTMVNGVILVVHGGRNSRQAVQRACHELSAVGARIFGIVLNNVDLRREGHDDYYYYSYQYSYSADAKRTKT
>gnl|bykdb|A0A2V9RQF1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MPANAQGLRESPDPLPVEVNRTTQHYAYPVLPSQDSVLREYLRVLIKRKWIVISSVTVIFGVVAIATLKSIPIYDASGSI
AINKSDPALLNIKDSANAPIEYYDPADLDTEVRILKSDLLALQVIRQLNLDKRPEFGGKGESSGNSLALTTDALQPDSEQ
TTALLSAFKGNLRVALQPDSRVVDIHFRSPDRQLAAHVVNALTSTYIEQNFKTRFESTMQASDWLSKQLVDLQLKVETSQ
EKLVKYQKEHGILGIDEKQNIITSKLDELNKELTAAESDRMQKESVYRLVQSGDPDTAASAALSAAGTAGTNSSTSGLLE
KLREQQADIRIQTAQLSTQFGPSYPRLAQLNNQLKEVEAQTQVEMKKITSRVRSDYLASLQRENMLRDALDRQKQQANRL
NESAIDYSLLKRDVETNRTLYEGLLEKLKEAGVTAGLRSNNIRNVDIARAPRSPAEPNVPRNLSFALALGITTGIGLAFL
LEGIDNTVRTPEQAEAISGLPSLGMIPLGSKSSSDSKSKRLSLASSREVVELVTQSRPQSQMAESYRALRTSLLLTSLGA
PPKIILITSALPQEGKTTTSINTAVVLAQKGTRVLLIDADLRRPSIHKTLGMGPKIGLSNVLTGNAPLQQAIVRSNVLPS
LFVLPAGPPPPNPAELVASSNMRDVLAELRDQYDHIIVDTPPTLSVTDAVVMSTRADTVVLVIRSGQTTKQALRRSRDIL
MQVNSRISGVLLNAVDLNSPDYYYYYEYQGKYGQRYYQEDEVKDLEESGAQVTQTSA
>gnl|bykdb|A0A2V9USA9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MDSGPLVPANSGVVREIPLTSPEFGRAAVPQVYPVLPSQESAAGEYIRVLAKRKWVIFSCVAAIFAVVAIASLKMTPIYE
ANGSIAINKPDSTLNFQNSATFSLDYYDPTELDTEVKILQSDLLALQVIKELNLDHSGGPNGRAPSSLELTPDPLQVDSA
HLSSVIGGFKGSLRVALSPNTRIIEVHYRSGDPQMAANVVNTLMQTYVENNFKSRFESTMQASDWLNKQLVDLQMKVETS
QEKLVRYQKEHEILGMDEKQNITTAKLDELNKELTSAESERMDKEAFYRLVESGDPDAIASSAGGIETGSAQSASALLES
LRAKQAELHIQTADLNTQFGPSYPKLAQLNNQLKEIDTQIQGEMKKIASKVRGQYMTALQRENMLRDALEKQKQEANKLN
ESAIQYNILKRDSESYRQLYEGLLQRMKEAGVSAGLKSNNFRIVDTARVPNGPIEPNIPRNLGFALVLGLMSGVGLAFLL
EGLDNTVRTTEQAQTISGLAPLGMIPLGSKGIREGSTGKRLALAASNEAVELITQVRPQSQMAESYRALRTSLLLTNLGA
PPKVIMVTSALPQEGKSTTSINCAIVLAQKGVRVLLIDADLRRPSIHKTLGMGPRSGLSNVLTGSTTLQQAITRTPILPN
LHVLPAGTPPPNPAELLASTNMKDVLAQLREEYDHIVLDTPPTLSVTDAVVLSPRADAVVLVIRSGQTTKQALRRSRDVL
MQVNAKVSGVLLNAVDLSSPDYYYYYEYQGKYARYYRDDEPSHDGDGEDVEETSPASSTSA
>gnl|bykdb|A0A2V9V3Q5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=779 residues).
MALGPLVPHNDGFREIQPAEPTELIKPIGPGLYTVLPSQESALREYLRVLLKRKWIIIACVVGIFAAVAIASLRQTPVFD
AVGRIAINKADSNLVTFKDSMPVMDYYDPTDLDTETRILQSDILALQVIRQLNLDKRPEYGGQSAPQPNLVADPLQNDSK
RTTALLGGFKGNLKVSLIPNTRIIEIHYRSTDPTLAASVVNTLAATYVEQNFKTKFESTMQASDWLSKQLVDLQMKVETS
QEKLVRYQKEHEILGIDEKQNIITQKLDELNKELTSAESERMEKEAIYRMTQTGDPDAVASAVTSAPVATLAGTGSSPLL
DKLHQQQADLKIQVAELSTQFGPAYPKVAQLNSQLKEIENQIQVETRKAVDHLRGQYQTALQRETMLRAALEKQKQEANR
LNENAIDYTLLKRDVDSNRQLYEGLLEKLKQAGVTAGLKSNNFRIVDPARSPNAPVEPNIPRNLLFALVLGVSSGVGLAF
LLEGMDNTVRTTEQAQMISALPSLGMIPLGSKSRNNGTGIGRLTLTSSREVVELVTQVRPQSQMAESYRALRTSLLLSSL
GGPPKVIMVTSARPQEGKTTTAINSAIVLAQKGVRVLLVDADLRRPSVHKTLGMGPRSGLSNVLTGNATLEQAISPSPIL
PNLFILTAGSPPPNPAELLASSNMKDVLDELREQFDHVVIDTPPTLSVTDAVVLSPRVDAIVLVIRSGQTTKQALRRARD
ILMQVNAHVTGVLLNAVDLTSPDYYYYYEYQGKYSQYYQEDPPDPPAEAQKQPQAASGV
>gnl|bykdb|A0A2V9V8F7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=832 residues).
MCSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCSGVGMDSGPLVHTNGHMIREVQAPYPVEFSRQLL
TGIYPNAPAQDSVLREYLRVLIKRKWTVLFCLAGIFIMVAISSLKMTPVYEASGSIAVNKADPGLVNFKDSGSMSIDYYD
PADLDTEVKILQSDLLALQVIKQLNLDKRTEFGGKPDSASSLNLAPDPLQTDSTRTSALLSAVKGSLRVSLVPNSRIIEL
HYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLVDLQMKVETSQEKLVKYQKQHEILGIDEKQNITTAK
LDELNKELTAAESGRMEKESVYRLIQSGDPDVVASAPVGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAELSTQFGASY
PKVAQLNNQLKEIDIQIQGEMKKMGGRVRGQYMASLHREGLLRDALEKQKQQANKLNESAIEYSLLKRDVETNRQLYEGL
LEKLKEAGVTAGLHSSNVKIVNAARVPMAPSEPNIPRNLAFGLLLGLTSGIGLAFLLENLDNTVRTPEQAQLISSLPSLG
MIPQGSRTGVEGKNENRLIVASSKESVELVTKSRPQSQMAESYRALRTSLLLSSLGAPPKIILITSALPQEGKTTTSINC
SIVLAQKGVKVLLIDADLRRPGVHKALGMGPRSGLSNILTGSATLQQAITRSPLLPNLFVLPAGTPPPNPAELLASSDMR
DLLAQLRDQYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDILMQVNAKVAGVLLNAVDLSSPDYY
YYYEYQGKYGSKYYQEEELDDSDEPKASSTNA
>gnl|bykdb|A0A2V9VYY4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=769 residues).
MALQPTRNNSDDFEALAPIDPLPVNGHQPLHTYFGEPHNALLHYWHVLTKRKWVVLPTFAIVFALSAIATLSETRLYQAT
SKVAIFPEVPNVLGFKDAENIAPDYEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESAMGEPSMQPDP
VQAAGLLGAFRGGLSVQPVPSTRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSEWLGKELADLQLKVQT
SEEKLVRYQKDHGILGVDEKQNIVTEKLGELNKELTEAETDRIQKEADYKLAMNGDPEMFMKTSPDGRGGSGLLDKLREK
EADLETQYAMATTQFGSGYPRVTELNNQLKQVRAAIEAEKTKLQQKMRDDYLAALQRENLLDSAFNKQKQEANKLNESAI
EYTVLKRDAETNRQLYQDLLQRLKEAGVSAGLRSSNIRIVDIARVPTQPISPNVHRSLVLGFLLALGLGVGLALVRETFD
STVRSMEEVRAVSTLPALGTIPLQLVTDERFRKRRLTISPDGERSGMLALVTYERPKSEAAEAYRALRTSILLSSFGAPP
KVILVTSAMPREGKTTISANSALVLAQRGSRVLLVDADLRRPGVEKLFGVRAHGGLSTLISGSSNVEEVILPSSEVPNLW
ILPAGPIPPQPTELLGSTVMKDYISRWRNEFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTRPALRRACDLLLQ
VNARVMGIVLNALNLHSVEGYYYYGTQYSNNYYSEESPNNKPKAASKIS
>gnl|bykdb|A0A2V9WI32 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=755 residues).
MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEEGFLLREYGRILKKRKWVVISTWLIIAILATVYALHMT
PVYDATGRIAINRENSVNLGFKDSDQGTIGADYEDYNIALETQIRILQSDALAFQVIKNLKLDNNPAFAESSLLDRFRRG
LKLNVVPRTRIVEIHYSHPDARLAAQIANILINTFIEQNFKTKFESTMQTSAWLSVQLSDLQMKVETSQEKLVRYQKEHD
ILGIDEKQNIVTSKLDELNKELTAAEGDRIQKESAYKLASAGNPEIFAKAEPSSLINQLRTQESDLRMKYAEATTQFGSS
YPKVMQLGNQLKQVEASIQAEDERIASRVQNEYLSALQREKLLGAALDVQKQEANHLNESAIEYNLLKRDAESNRQLYEG
LLQKLKEAGVSAGLRSSNIRIVDVARVPTSPSAPNIPRDIVLGLALGLFGGIGLAFVLESLDNTVRTPEEAQIISALPSL
GIIPLSTKQIARDRKNGHPRLSLGSRSSESADSLQLITFARPRSELAESYRALRTSIMLSSLGSPPKVILVTSALPQEGK
TTTSINSAIVLAQRGGRVLLVDADLRRPGVHKALGLRNTSGLSTLLTGGDGSQNAILSTEIPNLFVLTAGPPPPQPAELL
GSILMKDYLCRLRKEFDHIVIDTPPALSVTDAVLLSVEADSVLVVVRSGQTTKAALRRVRDLLSHVNARITGVIVNAFDL
HSGSSYYYQYDSKYYGRYYEEDPPQNGTSAAGKAS
>gnl|bykdb|A0A2V9WPZ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=798 residues).
MACWSALLGRNRMQDCCSGVGMDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQDSVLREYLRVLIKRKWTIL
FCLAGIFIMVAISSLKMTPVYEASGSIAVNKADPGLVNFKDSGSMSIDYYDPADLDTEVKILQSDLLALQVIKQLNLDKR
TEFGGKPDSASSLNLAPDPLQTDSTRTSALLSAVKGSLRVSLVPNSRIIELHYRSPNQELAATVVNTLATTYVEQNFKTK
FESTMQAADWLSKQLVDLQMKVETSQEKLVKYQKQHEILGIDEKQNITTAKLDELNKELTAAESERMEKESVYRLIQSGD
PDVVASVPVGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAELSTQFGASYPKVAQLNNQLKEIDIQIQGEMKKMGGRVR
GQYMASLHREGLLRDALEKQKQQANKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVTAGLHSSNVKIVNAARVPMA
PSEPNIPRNLAFGLLLGLTSGIGLAFLLENLDNTVRTPEQAQIISSLPSLGSRTGVEGKNENRLIVASSKESVELVTKSR
PQSQMAESYRALRTSLLLSSLGAPPKIILITSALPQEGKTTTSINCSIVLAQKGVKVLLIDADLRRPGVHKALGMGPRSG
LSNILTGSATLQQAITRSPLLPNLFVLPAGTPPPNPAELLASSDMRDLLAQLRDQYDHIIIDTPPTLSVTDAVVLSTKAD
AVVLVIRSGQTTKGALRRSRDILMQVNAKVAGVLLNAVDLSSPDYYYYYEYQGKYGSKYYQEEELDDSDEPKASSTNA
>gnl|bykdb|A0A2V9XGR9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQDSVLREYLRVLIKRKWTILFCLAGIFIMVAISSLKMTPVY
EASGSIAVNKADPGLVNFKDSGSMSIDYYDPADLDTEVKILQSDLLALQVIKQLNLDKRTEFGGKPDSASSLNLAPDPLQ
TDSTRTSALLSAVKGSLRVSLVPNSRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLVDLQMK
VETSQEKLVKYQKQHEILGIDEKQNITTAKLDELNKELTAAESGRMEKESVYRLIQSGDPDVVASAPVGGDSNSGNNPNS
GSPLLDSLRGKQADLKILVAELSTQFGASYPKVAQLNNQLKEIDIQIQGEMKKMSGRVRGQYMASLHREGLLRDALEKQK
QQANKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVTAGLHSSNVKIVNAARVPMAPSEPNIPRNLAFGLLLGLTSG
IGLAFLLENLDNTVRTPEQAQIISSLPSLGMIPQGSRTGVEGKNENRLIVASSKESVELVTKSRPQSQMAESYRALRTSL
LLSSLGAPPKIILITSALPQEGKTTTSINCSIVLAQKGVKVLLIDADLRRPGVHKALGMGPRSGLSNILTGSATLQQAIT
RSPLLPNLFVLPAGTPPPNPAELLASSDMRDLLAQLRDQYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGAL
RRSRDILMQVNAKVAGVLLNAVDLSSPDYYYYYEYQGKYGSKYYQEEELDDSDEPKASSTNA
>gnl|bykdb|A0A2V9XW18 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=787 residues).
MDLGPLAPLGTPTIREIQPSQNVDLVRPQDPRFYPPLASHESGAREYLRTLIKRKWIVIICLVTIFSVVAIATLKTTPVY
EAGGTIAINKPDTTLNFQNSATFSLDYFDPTELDTEVKILQSDLLAMQVIRELNLDRRPEIAGQAPPIPSPSLDLTDPLQ
IDPGRASSMIGGFKGNLRVTLSPNTRIIEVHYRSADPQMAANVVNTLMQTYVENNFKARFESTMQASDWLSKQLVDLQMK
VETSQEKLVRYQKEHEILGADEKQNITMAKLDELNKELTAAESERMDKEALYRLVDSGDPDAILSSANALEEAGAGGQSS
SALLGGLRSKEADLKIQAADLSTQFGPSYPRLNQLNNQLKEIDSQIQGEMKKIVAKVRGQYNAALQRENMLHTALDKQKQ
EANKLNESAIEYTLLKRDVDTNRQLYEGLLQKLKEAGVSAGLKSNNFRIVDSARPPTGPIEPNVPRNLLFAAVLGLASGM
GLAFLIEALDNTVRTTEQAQMIAGVASLGMIPLGSKSAREGPNPKRLVIASSKEAVELVTQVRPQSQMAESYRALRTSLL
LSNLGAPPKVIIVTSALPQEGKTTTSINTAVVLAQKGVRVLLIDADLRRPSIHKTLGMGPHSGLSNVLTGSTTLEQAISD
TTILPNLFVLPAGTPPPNPAELLASSNMRDVLNQLREQFDHIVIDTPPSLSVTDAVVLSPRADAVILVIRSGQTTKQALR
RARDILMQVNAKVVGVLLNAVDLSSPDYYYYYEYRGKYASYYREDSSGREHEEEEEVIEDAPSSSSA
>gnl|bykdb|A0A2V9Y2R7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=781 residues).
MDSPIVVRSADNLPGQRSLEILDQTPPSCQIPYSYNSYSASGHAINLLHYWHVLRKRKWAVLVTLIVVWVLSAVATMKQT
RLYEAVSQLAIFPENLNALGLKDGDGGSPGEDWDYNVTLETQTAILRSDALALKVIETMHLDKDPRFVGSTAASQPNPGA
QGLSELKPNNDEETTALLAAFHSGLSVRVIPRTRLLELRYIHQDPVLARDIVNKLAKTYIEENFRKRYESTTQTSEWLSG
QLADLQLKVETSEGKLVRYQKEHSILGIDEKQNIVTAKLDELNKELTEAQTDRIQKEANYKSAMVGDPTAFAKIQAGGTS
SLVDKLREKEADLNVQHAQATTQFGSAYPKVVELRNQLQEVRSGISVEQTRMQHRIRDEYLAAAQRERLLTSAFEQQKQR
ANLLNESAIEYSVLKRDAESNRQLYLSLLQKLKEAGVTAGLRSSNIRVVDVARTPMFPVKPDVPRNIKLGFILGLCLGVG
LAFVLESCDNTVRNMEQVSAISTLPALGMIPLQVSGNGNLRKRLKTVPAADGELQSPTLVTYARPKSQAAESYRALRTSI
LLSSFGAPPKVILVTSALPQEGKTTISANSAVVLAQRGSRVLLVDADLRRPGIGKMFGIRSGGGVSTVISGVEKFEDVVV
PFTQVPKLWILPAGPIPPQPAELLSSTVMKDYIARWRNEFDHIIIDTPPCLSVTDAVVLSPEADRVILVARSGQTTKPAL
RRACDLLLQVNARVMGIVLNALDLHSADGYHYYYSYGGRYAGHYYDDGSPQNGTSAVSKVS
>gnl|bykdb|A0A2V9YDK8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=783 residues).
MDSGPLVQTNGQTIREVQPVYPVEFGRQMLTGIYPTLHPQDSALREYLRVLIKRKWTIILCFSGIFIAVAIASLKMTPIY
EASGSIAVNKTDPGLVNFKDSGSVSVDYFDPADLDTEVKILQSDLLALQVIKQLNLDKRSELGRKPDDASSLNLAPDPLP
TDSARTSALLAGFKGNLRVSLLPNSRIIELHYRSPDKNLAANIVNTLAATYVEQNFKTKFESTMQAADWLSKQLVDLQMK
VETSQEKLVKYQKQHEILGIDEKQNITTAKLDELNKELTSAESERMEKESVYRLIQSGDPDVIASTTSVAGSNGGTGANS
GSSLLDNLRSKQADLKIQVAELSTQFGSSYPKVAQLSNQLKEIVAQIQAETKKIAGHVRSQYMASLQRENMLRAALEKQK
QEANKLNQSAIEYSFLKRDVETSRQLYEGLLEKLKEAGVTAGLRSSNVKIVNAARVPMAPSEPNIPRNLAFALVLGLTSG
VGLAFLLENLDNTVRTPEQAQIISGLPSLGMIPQGSKSIEASNQKRLTVASSKEAVELVTQARPQSQMAESYRALRTSLL
LSSSGAPPKIILVTSALPQEGKTTTSINCAIVLAQKGVRVLLIDADLRRPGVHKTLGMGPRSGLSNVLTGSATLQQTITR
SPLVPSLFVLPSGTPPPNPAELLASSNMKDALAELRDQYDHIVIDTPPTLSVTDAVVLSTKADAVVLVIRSGVTTKGALR
RSRDILMQVNAKVTGVLLNAVDLNSPDYYYYYEYQGKYGSRYYQEDELTEDKDGALTASSTSA
>gnl|bykdb|A0A2V9YHT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=754 residues).
MDSGKLIRAEDAGNGKSSLDFPPPLLPAGYFPATLPQPALLDYWHILVKRKAVVLITLAVVFALVAFRTYRTTPLYESTG
RVAIYHESQTLTGFKDSVPIDADDWDYTVAMETQVRIMQSDSLALKVAHDLGWDKAFAPANAGAIPLDSKLTPPQESALI
GRLRGSLQVSSIPNTRMIELRFSDPAPRETARVLNVFMDDYIQENIRAKYDSTMQATDWLTRQLSELRMKVESSQEKLVK
YEKDNDILGIDEKQNIITAKLNDLNKAYTDATNDRIHKQATYRLTLNSSPELLSQADPNTLIEQLRTREADLKTQYAQVS
TQFGPAYPKVVEVGNQLKQVQETIQGETRRIGGRLQSEYQAATQRETLLQEALNQQKREANRLNERAIQYTLLKRDLDTN
QQLYDGLLQRLKEAGISAALKSSNIRIVDSARPPVLPSQPDVPRNLLLGLAAGLIAGVVLAFGAEVMDSTIRTPEQVQIV
SALPSLGIVPMSISLSSQAQGRNGKGIVLRPGKRERVEMIAHSHPKSEIAESYRALRTSILLSSLGAPPQVILVTSALPQ
EGKTTTAVNCGIVLAQQGSRVLLVDADLRRPAVHHSLGIRSNGGGLSTLLAGQHSAEEVLVRSNQLSNLYVLPAGPPPPQ
PAELLSSALMKQWISTWRKHFDHVVIDTPPCLSVTDAVALSVVADSVVLVIRSGVTRKEALRRARELLARVNAKVAGVVV
NAVDLRSPDLHHYYYSGGGRGYKYYDDSTTQKNR
>gnl|bykdb|A0A2V9ZLH4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=782 residues).
MEPGSLIPSNGQPVRELQAIAPVEFSQQVGPGVYPPLPTNDSVLREYLRILIKRKFVALSCVVVIFLLVLIATLRMTPIY
DAAGSIAINKLDPSFINFKDSASASDYYDPADLDTEVKILKSDLLALQVIKQLNLDRRVEFGGKGDMPSPNALGITTDEL
QINSSRVTNLLGAFKGNLKVTLQPNTRIIEIHYTSPNKELAATIVNTLVNTYIEQNFKTKFESTMQASDWLSKQLVDLQM
KVETSQQKLVKYQKEHSILGIDEKQNIITEKLDELNKELTAAESDRMQRESLYRLTRSGDPDVIATATATGGTEGNASSG
STLLDKLRSQEADVKIQVAELSTQFGPSYPKVAQLNNQLKEIDVQIQSEIRKIAGKVRNQYLAAVQRESMLHDAMEKQKQ
EANKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVTAGLRSNNVKIVDAARVPQAPSEPNIPRNLAFALLLGLTSGV
GLAFLLENLDNTVRTPEQAQMISALPALGMIPLGSKRPNEDGSRRLAVAASKESVELVTQSRPQSQMAESYRALRTSLLL
SSSGAPPKVILVTSAMPQEGKTTTSINCAIVLAQKGTRVLLVDADLRRPGVHKALGMGPRSGLSNVLTGSADVQQTITRS
QVVPSLFVLPAGTPPPNPAELLASANMRDLIESLKRDYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSGKTTKQALRR
ARELLVRVNAKITGVLLNAVDLSSPDYYYYYEYQGKYGGRYYQEDEIALDTEDSSKATSTSA
>gnl|bykdb|A0A2W0AJ66 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=744 residues).
MTRYFELTGEPAPDSAAQTLVQTPPNLKPGLPNRYTQKVVEALEETFLGNLWRVVRSRKKIIAAFAVMVVSTVMTASFLM
KPRYDAVGRVLFFREDEGAGVLGFKGPGSSLPEDADERAAINTQIGILESDGLASQVIHDLHLENGKFDGGKIEPGNEDS
LVRAFHKNLAISNVRGTRLIEIKFRATDPRLAADVVNYVTKAYVDRNYSSQLYASNQLSQFLLNQLTDLKAKVEESQQKL
VDYQNRNGIFGLDDKQNIVTAKLDDLNKELTAAEADRMQKEATYRLTPSSQPELIAKSEPDNLVTKLRAQEADLQMQLAQ
ASVQLGPTHPKIRELSNQLAQTRRSIRSEVKRTRERMTNEYRMALERERMLRNALETQKQAADTLNANAIQYNILKRDVD
TNRKLYEDLLEKQKELGISATLKLSGLRVIDPAQPPKRPSEPNVPRNFGLSVGFGLVGGVLLAFGLAKMHEPISTLEQAQ
ILSPLPALGVVPLLEGSANQSLVEGNVPQTASKPELVSFLQPLSPAAESYRALLTSILLSRPTPPAVIMMTSALPSEGKT
TVAMNTAIALARLGRRVLLVDGDLRRPSVHRAMQLTSTIGLTALLSNSAPFEDAVIRCAELPNLFILTAGKVSLPEDTEL
LVARFKDLLEGWRGQFDHIIVDTPPVLPLTDAVRMSVEADSVILVVRSGHIVKDAFLRAQDLLLRVNAHLTGFVLNAAEL
SSSDFRHYYGYYSQHETNRPDAVA
>gnl|bykdb|A0A2W0AUU7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPLNPMQVVFRLLHKHLWTIAACTSLALSISLLYAVHQPRLYRATANI
AIDRDSNAGVSLNKTFASPLGDADDYSVSLETQIHVIASRSLALAVVRKLDLTHNAEFMRDANRQFASLREAAPDPTDIA
GEAVVSGLSVKTIKNTRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLSTQLNELRAKVEESQQKLV
AYEREHNIVMVDEKQNVVTSKLDELNKQLTAAEEDRMEKDASYQAIAAGSLDRLSESKSGDALQSLYLREAELKNEYAQA
TTTYGPNHPKVLELTNRIKAMDTSIQTELKRLQGRAELEYQVAARREQKLRAAFEAQKIEANKLNESAIQYGLLKRESEA
NRQLYDTLEERMKEAGVTAGLRSTNIRLIDPAGATGLPVSPNLRRTSCIGLFLGFLLSAAAIGIREGMDRALRDPAEVES
FTAMPSLAIIPQHHPSPRLLTPRVGEAPQIMCLTEPRTAAAEACRALGTSVLLASADLKSLLVSSPLPGEGKTMTAANLA
VVLAQQGKRVLLVDADLRKPGLDREFRIASTPGLSDLLSGSAGEEPVIQQIERVSGLSIVSAGSSQARTAETLGSARMRS
LMESWRERYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDLLNQANAPVLGIVVNGVSSRSAGSYY
YGYYPQLAKGYYGDSPQA
>gnl|bykdb|A0A2W0BGU4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MTNPLMKSDPATRRELVDYEIAPHPTPEPITIAPRYYPDPNASPEAGSLALYWNILLRRRWSILAVVFLATLTATLASLK
MKPVYKATARIEVEADTPQTQMLNDRYQQLQTDQDFLRTQIQVLQSDNLAWRTIEELRLADNRMFADESRVTESQAHKMK
LIETFKRQLSVELVPGSRVVLVGFESRDPELAARIANTQVENYSDYNFRQKYDATRQAAGKMEEQLDELKAKVEKSQRAL
VEYERQNAILSIGEKQNVVEQRLGEISTNFTQSQNDRIQKEALYNQVQTNPDQVPAIANNEVMQKLEENYANLRGQYVEA
LNQYGPNYPKVLRLDKQVKEASALIAAERGRIAQRIRNDYFAAARREQLLGATLAEQKKESGNFNRLLIEHDLLKGDFEA
NQQLYQRLLQRVKDATVIAGLSSTNIHIVDPALAPIIPVRPRTRLNIVLGLLVGMIFGSMLAFIQDSLDNSLKSPEEVEM
LIATRALALIPMKRLTRAERLLATNRSINARENGTAILNVAAQATSEQSEAYRALRTSVLLSVASRAPQTVLITSAKIGE
GKSSTALNLAMALAQCGSSVVLLDCDLRKPVLARLLGIQNERGMSTHLTGHDSINDVIQPYKEQPNLWLIPSGPIPPNPA
ELLCSEAMESLFGELRRRFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNILDGANARLLGVALNK
VHMRHDGYYGSYYSGYHA
>gnl|bykdb|A0A2W0BQL1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPLNPMQVVFRLLHKHLWTIAACTSLALSISLLYAVHQPRLYRATANI
AIDRDSNAGVSLNKTFASPLGDADDYSVSLETQIHVIASRSLALAVVRKLDLTHNAEFMRDANRQFASLQEAAPDPTDIA
GEAVVSGLSVKTIKNTRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLSTQLNELRAKVEESQQKLV
AYEREHNIVMVDEKQNVVTSKLDELNKQLTAAEEDRMEKDASYQAIAAGSLDRLSESKSGDALQSLYLREAELKNEYAQA
TTTYGPNHPKVLELTNRIKAMDTSIQTELKRLQGRAELEYQVAARREQKLRAAFEAQKIEANKLNESAIQYGLLKRESEA
NRQLYDTLEERMKEAGVTAGLRSTNIRLIDPAGATGLPVSPNLRRTSYIGLFLGFLLSAAAIGIREGMDRALRDPAEVES
FTAMPSLAIIPQHHPSPRLLTPRVGEVPQIMCLTEPRTAAAEACRALGTSVLLASADLKSLLVSSPLPGEGKTMTAANLA
VVLAQQGKRVLLVDADLRKPGLDREFRIASTPGLSDLLSGSAGEEPVIQQIERVSGLSIVSAGSSQARTAETLGSARMRS
LMESWRERYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDLLNQANAPVLGIVVNGVSSRSAGSYY
YGYYPQLAKGYYGDSPQA
>gnl|bykdb|A0A2W0BVQ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MTNPLMKSDPATRRELVDYEIAPHATPEPITISPRYYPAPNSGPEAGSLALYWNILLRRRWSILAVVFLATLTATLASLK
MKPIYKATARIEVEADTPQTQMLNDRYQQLQTDQDFLRTQVQVLQSDNLAWRTIEQLGLADNRMFADESRVIDAQAHKMK
LIETFKRQLSVELVPGSRVVLVGFESRDPELAARIANTQVENYSDRNFRQKYDATRQAAGKMEEQLDELKAKVEKSQRAL
VEYERQNAILSIGEKQNVVQQRLGEISTNFTQSQNDRIQKEALYNQIQANPDQVPAIANNEVMQKLEENYANLRGQYVEA
LNQYGPNYPKVLRLDKQVKEASALIAAERGRIAQRIRNEYFAAARREQLLGATLAEQKKESGNFNRLLIEHDLLKGDFEA
NQQLYQRLLQRVKDATVIAGLSSTNIHIVDPALAPIIPVRPRTRLNIVLGLLVGMIFGSMLAFIQDSLDNSLKSPEEVEM
LIATRALALIPMKRLTRAERLLATNRSINARENGTALLNVAAQTTSEQSEAYRALRTSVLLSVASRAPQTVLITSAKIGE
GKSSTALNLAMALAQCGSSVVLLDCDLRKPILARLLGIQNERGMSTHLTGHDSIDDVIQQYGEQPNLWLIPSGPIPPNPA
ELLCSEAMESLFAELRQRFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNILDGANARLLGVALNK
VHMHHDGYYGSYYSGYHA
>gnl|bykdb|A0A2W0C122 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=738 residues).
MDARELIKSNPAELSAQNTPASQGIHYGWARLVPLNPVQRVVRLLHKHVWIILGCTSLSVSVSVLYAMRQPRLYRATTNI
AIDRDSNATVPLNKAFASALGDADDYSVSLETQIRVLASRSLAEVVVRKLDLAHNAEFMRDANRQFASLREIAPAPESIA
VQALLSGLSVKTIKNTRVVEVSFTGRYRDLNARIVNTLVDVFIDDNIRSRYEAANRAAKFLSAQLTELRATVEESQQKLV
AYEREHNILMVDDKQNVVTSKLNELNKQLTAAEEDRMEKEASYQAIAAGSLDRIGENKSGEALQSLRLREAELKNEYAQA
TTTYGPNHPKVIELTNRINAINLSIQTELKRLQARAELEYQVASRREQKLRAAFEAQKVEANRLNVSAIQYGLLRRESEA
NRQLYDNLEERMKEAGVAAGLRSTNVRLIDPAEATELPVSPYLPRSSYLGLFLGFLLSAAVIGFRESMDRALRDPADVES
FTAMPSLAIIPQHRGSPRLLTSKVGEAPQVLSLTEPRTAIAEAYRSLGTSILLASRDLKSLLVSSPLPAEGKTMTAANVA
VVLAQQGKAVLLVDADLRKPGLDREFGIAGTPGLSDLLSGGAGEECVIHKIEGVANLSIVAAGSSPAMTAEMLGSDRMRA
IMESWRERYDYVILDTPPIIAATDAVRLSKEVDSVLLVIRSGQTPTDALARSCDVLNQANIPVLGIVVNGVSPRSSGSYY
YGYYPQLAKGYYTNSPQV
>gnl|bykdb|A0A2W4RYA1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=777 residues).
MPDINLDDLDDASRRGAAGDGQPPAGATVPSRAGAQHAHGLDEDHGDVHLRDYVRILYKRRWLMASAFLTVMVAVALYTF
TATPLYEARTRLLIDSDPNIVSFEGVVDQEQAQPDYYTTQINLLRSRLLARRTIEALDAWNHPLLVPERGALAVVREGVA
SVMRWFRSPEGGVPDPAVGQAGGQEPPETPEQTAVIDAFLRRVSVSPVRNSRLVDVSFESPSAAFSMRVANALAKAYVQE
TLDYRLSASRDANDWLMARLAEQRKAVEEAEAALQRYREQNNALSLQDSQNIVAQKLTDVNTEVTRARTERMRQESLYRQ
LQDALARSADLDGFPAVLNNQLVQQQKLELAALNQKKAQLSETFGDRHPEIVAINRAIELAQQKLDTEIQKVVASITAQY
EAAVAHENNLLAALAQQEREAQQLNAKAVEYRVLERNAQSARQLYDSLLQRAQETGVSGELRTSGIRIVDPAVLPRTPSS
PRKVLNLSLGFVVAVLGALGLAFFFEYFDNRLRTPEEMQAVLGLTSLAMLPSVPASSLRSGDPLMTGPVPAGFAEALRML
RTNLLFARADPDMRSVMVTSTGVGEGKSVVAGNLAVAIAQTGQRVLLVDADLRRPRAHGLFGLAQEPGLSNLLVGTAESR
ECVHETPVEGLYVLPAGHIPPNPAELLGSARFRRVLDSATRQFDWVVVDSPPVMPVADAAIVGHMVSGVLFVVHSEKTSR
HAANQALGQLARAGARVIGGVLNRVDLDRNPYYYSAYYSREYTRYYVPAERARSSSS
>gnl|bykdb|A0A2W4TLP2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=747 residues).
MAHLPPAHGGRAARRGGSSWHPTDYLRVLYKRRWVAIPGFLLVFLSGAIGSIRTVPVYEARTQLIIEKDARRATSINTVL
EDRDSWYQDDFYPTQYRILQSRTLASRTAAAIEGGLPERVPPASSLSFSLSSLLGGAVSAVADMFGPGPVPAAGGEEPAA
VESAARAALTSRIQGGIVVVPIRNSRLVEIKFQSPDPEFAARVVNAHAEQYIEQSLQFRLEATSQTNAWLNTQLEEQRRL
VEESERKLQQYKEQHNTVSVDDKQNIVVQKLNALNEQLVQARIERMNREVQVNAIRELRASGESLETYPAIMNSPVVQAL
RADIAAKEAERARLGTQYGPAYPAMRELATQIERARRDLETEVSKVAAAIEADFETALARERALQQSLDQQQRESLGLDR
RMLEYAALEREALSNRQLYENLMARAKETGAAADYRGTSIQVLDRAEVPRVPVLPRTQRDLMLAALAGLVLAFGLAFGVE
HFDSRIKLPEEIKTHLGLPFLGMIPTFPGGDESGEAPLLSADAPPAFAEAIRAVRTAVLFSSAEEGARSVVITSTGPHEG
KTVVSSSLAIALAQAGQRTVVVDGDMRRPRMHEALDRSQEPGLSNVLVGEAALADALRPTSVPNLTLLAAGHIPPNPVEL
LCSPKYADLIAELKKRFDWVVIDAPPVMPVTDAAVVANSASGVLFVVGAEMTPRQNAAAAVEQLRGANAKFIGAVLNRVN
VQRHSYYYSPYYRKEYGKYYQRAANRA
>gnl|bykdb|A0A2Z5FVL3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=731 residues).
MCILMTRRYTAVAEIQVQKPNSDSLTLDSNAASPAGGDTDPNSASMNLETQATVLESPALAMKVIEDLHLEDTSAFKPHF
TFTGWVNSLFSPPPPADPAGVALSAAPLRRDRLLKQFQENLEVKIIPGTRVIEVAFSSSDPNLAARVVNQLVASLVNYSF
QSRRTVDTEASKFLESQLAEMKADSDALEQKAVKLQKQTGVVQVAGSGDGDGQGQAYSSTLDQLQKATAAVSQAHTNVIL
KGAIYEVVKSGDPETIMGLPSNTALAGAASGMSNDLAVISSLRTREATLNGQINELLAKFGPAYPKVDELKADLTAIQNS
IKEEIQRMRDRARNEYVVAQQVESGAKQLYDAEKQRADEMNDKAVQYSMARQQADQSRSLYEKLQSRMKEAGVLEGFHSS
NITVVSPALAPSAPSRPNIPLYLAGSLATGLLFGCIMAVVVDLMDSKIADIHGLESLMGEAPFGILPSFAAKKKGLRLSG
HSFALPGREAIAALKDPHSAYVEALRALRTTLLSTRGGAPPQVLLVTSSTEGEGKSTLSSNLAVVLAQQGKRVLLVDADL
RRPNLHVLFNSSLEVGLSTILAGQLSVDAMGQAFLQVEAVPGLDILLSGPIPAYSAELLGSSKMRQLLDLWRGYYDFIIL
DGAPVLPVTDSVVLSSQVDATLLVARYQSTQQQSLDLSLRTLRAQLGTNRHIGVVLNGVERTADAYYKYYGFSNSTYYTN
TKRLGGGSEIS
>gnl|bykdb|A0A2Z5G3A3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=779 residues).
MKTLPSPQSIYTPIPETPLTISDMGALVVRRRAIIAGVTFAFLAIASLYCLLSTRRYMATGTIQIQKDSSDALRLESMMQ
GGAADEDALDENITLQTQTNILQSDSLALRVIEDLHLDKTPDFESKFNPIDMVLGIFSPGGASDPPGASLQQSPGRMSHA
LKVFSKNLTVTPVVGTRLIQISYVSSDRKLAESVVNALAQDLTNFSFETRYKATAQTSQWLTSQMADLRKQSEALQAKVA
DLQKEAGVYTVGDGGPDGKTQAYSSDINRLELATTALSGAESNRILTGAVEQIVKTGDPELISGLAGSPMLGAASSGVAS
SLSLIQGLRSQEAVLQGQMAEYSSKFSPDYPKLVDMKSNLQVIQAAIASEVARMGARAENDFKVAKTAEAQSQMSYKALK
KRADALNDKTIEYELTRQEATDSRTLYVSLLGRLKEAGLLEGLRSTNVSVVDPGRSPAKPTKPNIPLFLGGGLASGLFLG
FCAALLFDTTDTKIQDLDELELMLGGVPIGILPAFDRPATFLRLTSSSGLDRIDAVDPVTRNVIALQQPNSGYVEALRAI
RTSLYLSKGGSPPQVVLITSSIEGEGKSTLAANFAVLLARQGKKVLLVDGDLRRPKLHTTFDVAMEGGLSSILSGSSSEK
DSSQYSAPVTSLPNLKLLVAGAPPTEPTDLLSSTRMLEALAAWRREYSFVIIDAAPVLSATDSVILSGLVDTTLLLGRYK
YTDRQLLARSYRLLQMHGGSPTGIVLNGIEREAEKRYSCYGYSGSDLVTQRKGGEHANA
>gnl|bykdb|A0A2Z5G448 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=753 residues).
MQGPDPASERQQGTSVAGKPAGSDRQDFILTPADFRKILIKRQFIILACLATGLILGAVITFFTTPVFESTARIDINPDR
STNLGISDLLNSKAGGNDESTRLLTEARILQSDSVIFAVIESENLFAKKPFSKVFEKQPYVLGKPLTPAQRIPLIRLLRS
NLQVVVIPNTDLVEIHYRDPDPNQASRIAQAVVDQYLELDLRSRYEGTLRISNWLSGQLTELKAHAADAQRKIAQFQRAN
NLIGMDAEGGNLVSDSLRLVNEQLIQAEADRIVKEARYHLAETRNPELLVSVAPTTTLVSLRTQQAELLVQSAELKSKYG
FDYPRVREVEKQLTAVQTDIDAEISNLLKRFEEEYNAAVNTEALLKGRLEQVKQEAFRVSDSSADFEILKHEAQSTTDLY
DALQMKLKEASVTAGLNSNNVNLVDKAEVPAFAVAPKKRTNYGFGALIGLFIGIAAALFLETLDDTIRTSEDAEAISSLP
SLAVVPRFTTAAKEARSTYGQQAKPITPADSQFPSDLVSYLTPQTVGAEAFRTLRSSILLSSADNEARLILITSSLEAEG
KSTIAANLAISFARRDARVLLVDTDLRRGTLHLKFRLPNREGLSTLLVRESGSSAYQSPIDDLPNLFVLTRGPIAPNPGE
ILASRHMESLMEGWKTEYDHVILDSAPVLPVADSLSLAPGADSTIIVVRAAITRKKALLRVRSLLRRARARVTGIVVNDV
DLRLENYYTYSKQYGYDYATNYGGGYGETDAEK
>gnl|bykdb|A0A2Z5G7H4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteriaceae bacterium SBC82] (length=767 residues).
MGPRADVRERPITLGDLRHIFRRRRRVMVSCVGGCVALAVLVCVFCTRRYQAFGEIQVQKDSSDALGLDSMMGGAEDASD
ALDANITLQTQADLLESDTLALQVIEALELETTRDYQPRYDALGSIFRLLSPSGPADPLNASLENSPRRRTRALKIFDAN
LNVKVVSGTRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNFQTRFTATNQASEWLTGQLSDLKKQAEALQARVIALQRQSG
VVSLGVQDAQGRDQAYSVIVDRLQQATATLSQATSNRILKGAVYKIVQSGNAELISGLSANGIVSGSPTLSTSLGLIQSL
RMQEAALQGQIAQDTSKFGPSYPRLMDSRANLSGMESAIEDEVHRVAERSKNDYEIARREEDESRTEFATEKHQADSLND
KAIEYAIVRQEADDSRGLYEDLLKRLKEAGVLEGLRSSNITVVDPGRIPSTPKQPNIPVYLAIAAGVGLFLGVCGAFISD
SIDDKIQTIEEIERDLELVPLGILPHLGEPNWYRRPGGPSLSRARSPSSGVNSLAIFAHPNSPYTEALRGLRTALLLAKS
SAPPQLLLITSSVAGEGKSILSANLAAVLAQSGRRVLLVDADLRKPSLGDRLGMESRTGLSQYLTDERSPEDILEVGRLP
KLHLLTSGPVPPYPADLLGSLRMMEALDRWRGYYDFIVLDSPPVLLVTDPVVLASLADATLLVARYGMTNRLSLARSHRT
LMDQSTQDRVGIVLNGVSQGSPFHYEYYGHSGSLGYPEIHGGKHVDA
>gnl|bykdb|A0A317HKM4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=747 residues).
MSLDSHRPARSDPDSDDARGTGSPDTWGTDTLQIRDYARIVYRRRWIIFLIVVAGLIGGALYNWTAPRIFEAGATLQIEG
DTNILALDRPLVDQRDWMSTFLPTQVGILMSADLARTAHDELTSSEAALPPNERLSQVPTVAEIAAARSIGGVKDTRLVN
VGFRSTDPEIAARVANALARAYVRWNVEYRSKMTGEASAWLSRQVEEQRKLLEASETALQAYRRDHGADALVRTNQLGEE
RQNIVVQKLGDLQAAVTRARADTIEKDAQIKQMSALEADHKPLDTLPAIAANPFIQTLKGELTTSERELGQASKELGEHH
PTIIKLREAVQNADRKLQAEIAAAAHTIRNDFEAAQSREQALEAALDRSKREVQALNAKAVEYSALEREAASNREVLDKL
LQRSTEARLARELESTNIRIVDSAEIPTVPSLPRQTHNLMLAFAGSSSLALVLVFVLEVFNTRVTSVEDVKRHLRIPVLG
LMPQVPSKNGRVPLLVQGAPARLTELFQAARTNLIMAPELARPHILLVTSSEPGEGKTVTAANLAASLAGLHQRVLLIDA
DLRKPGLHQLFGEEQQPGLADVLAGKTTSRDFRQTKISRLWLLPAGTASRHPADLLGSERFSRLIDYLQKQFDWIVIDSS
PVLAVTDPCVIARVASGALLVVRSGRTSRDVASAAVERLDAVGANVVGAMLNGVVLDQPGRSYLPYYHREYPAYYCEQTG
SSWIPKLPDAAALQGDSTRAAAPPANS
>gnl|bykdb|A0A317I2L9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=787 residues).
MMSQDNRLMPMPAVERSLDKPLTDLNAARSYGPAANEPTQLRDYLFVILKRKWLILSLCLVVTSLVAVQMFRQPSIYEAE
TTIRIEQRKSNILQSDKLVIGGQLDPNFWGTQLKLLESPALARQVALTLDLQHNPNFFGGGSQGGFFASLRRILSGDQRR
TKAKPAEPTKLELVGESQLRDQPLSPEELAALEPYEDAIIGNEQVDGIVNTNLFVIKYKHHDPDIAQKVANTLAEVFANN
NLERSTTNSSKQETMLAKEIGELQFKVKHDQEVLFNYARENNLNPTGNQNLDVEGQRLNSLSGQLLDAENQRKTAQAIYN
SAKNASDPFTVPEVIKSTRIVALRERISAIKERRDALLVTYTPEWPEVRKLEASLKPLEAELQAAAAEAIQGLKAQYEAA
LAHEQSIKSMYNAQRGVTSQQTRAQIDMVSYTQTLETNKQYLNTLQQRLREIQASSGDRGNEVSVENYSRVPKAPIGPAR
IRNVMIAFLLSLVAGIGLAFLLDFLDDTVKSIEDIDRYVHLPALALIPASRSIGGRLKGMTSANVGPSESTALAMVDDVR
SPVAESYRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTAINTAFMLAQTGADVLIIDCDLRRPRLHAQFEVSNARGLT
TWLSGEKDLDGLLQSLPRNPNLKILTSGPVPPNPAELLGSEEMRRLLGTLSERFAHIIIDSPPAISFTDASILSTMVDGV
MLVVHGGRSSRAVVRRAKQQLLDVGAHIFGVVLNNVRQESHDYYYSGYYSNYYSSDADAGASTGETA
>gnl|bykdb|A0A317J121 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacteres bacterium] (length=755 residues).
MRHLNHDQPEPGNNRLPALPNSYFVQPGELTIEPASSSPGIDYWHLLRKYLILLSLFAVAGAAAGFFSVAFLNPVYQSRA
LLEVQAPTVTLFKNSGVSGNDEVSQVNIQTQIQLLRSSSFLRRVMERLQLETVPPPPVQNDIFSRLRRRLTTNTQDPMAL
MTSGLNVALATFDARPINGTRIIEITCDSTSPDIAANFVNTLANEYIEQNSQGRAQNLQQTSQWLSGQLEETRNKLQEAQ
QHLQEFVQSSGNLFVLQDNTLDNSKLRQLQGELSAIQADRIAKQAKYELVAKTSPEALPGVLEDINVRGYQTRIADLRRE
AAVLKTTLTPDNPKVKKIEVQINELQITLNKEVTAEIQRIKNDYDVALRREKLLSADYTKQASQVSAEATKASQYSGLKR
EVETLQQTYSAMLLQANESNINSSVPLGMGTIRLVDPSTPPAKPYKPRPALNIAFGTMAGLFLSVGIAFLWERMDKSVRT
PGHSRTLLNVPELGVIPSIEPRGSRPAWRLLLGRESRNAGEMVGSEVSLDTRVGFWDSAPASQLLADSFRVTLASLMLGN
GTRRPPRVILVTSPGAGEGKTTIVSNLGTALAETGRSVLILDGDFRRPRLHKVFDLADTWGLTNILEEGSAAPERFGLLT
TVPGLFVMPNGPKSGSISKMLYGSEIRRFFQMVREKYDIVLIDAPPILEVADGRLLAEFADGVLLVLRSGVTDRVAALQA
YQQLSEDQTPLLGTVLNDFKATRRSRQGYYNYAGR
>gnl|bykdb|A0A321LE75 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium AA13] (length=799 residues).
MSDERTDIERIKPEEMAFGRPGYPRAVGYPEAYATGSYGYGEADDRINIRAIWRTVRKRLWLISLIALIVTTIVTLEMFR
TKSMYKASTTIEIEKENRTLVKSGDVVISTDESDDAYYTSLVMKTKIRTLMSRPLLEDVVIHLGLDHNPQFMEVTRKKSL
VEAVQTIGSKFKQEVTSELPVLEPGVQIEGGIDRSPEESARLAPFVAVLSGNLSPEPLEDTRLLVINYSHTDPKLAATIS
NTVAAAFINRSFSNKTEKFTKTSDWLNTMVRERRAEVQKAEEELANYTREHNLFSTDGKEAPAVNKLAQLYTQVTTAEVQ
RKLKESLYQQVKGGNIDVATEAFTDSKLTGLQARLNELEVKARELDVKFGADHPRVVEIRNQMVTIQEQINRSRGDLEAR
LKAEYERAIRDETALKESLERAKIDAAQQNQDAITFNILRQNVETAKTLYTDFLQKQSQARVQVAEQHNNMRVIEPAQPP
GGPIGPNRMRGILIGLFLSLVAGIGLAFVLEYFDNTIKSVEDVNRYAQLPALGIIPAITSSRPKLLTAKGQGALGANGSA
PAAAGLQRAASTLATLDTRSSAAEAYRVLRTSVLLSTAGNPPKTILITSGQPGEGKTFTAINTAISLAQLGASVLIVDCD
LRKPSTHKALGIDHSHGLSNYLSRDVAIDGLIQKLPIPNLSILTCGPIPPNPAELISSEKMKNMLAMLCERYDHIVIDSP
PLMHVTDPVILSTLVDGVILVVHGGKSTREVLKRGRQELATVGAKIFGVVLNNLDLRREGYDSYYYYRYYGDYSERSVK
>gnl|bykdb|A0A321LPW6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium AA13] (length=797 residues).
MAQERVELERVSTARVALDAAPPPRYPALAGAAGTEYGLGYPEEYGRIHLLEVWRTIRKRRWLIAATVVIVTSIVTVEMF
RIKTAYQASAMIEIGKDVQAVQGPSAAAVQDDSDNFYPLVRIKTYMIELKSRPLLSDVAARLRLDQRPEFLAAEDRRGVW
SAIKSIGGRSALREAGESPPEQASDAADTDKQPGPGADANDLAALIRALDKNLSVEPIRDTRVIKVVFTHTDPKLAAEVV
NAVTQSFIARSFSTKAEKYNNAASWLDRSTRELQAKVQKAEQSVADYTRDHNIYSTEGKETLTTDKLSRLHDQVMRAETD
RLLKGSLYEELNMGRLDRLSEAFSDPKISELTKIRGELAATYAQLSVRYGPENPRVAESKKQMAEIDNQIRASRASLEAR
LRADYERSARDEVSLKGALDRAKTEAARQNQDAIQYGILKQDVDTAKSLYTEFLQKTNQANLELAQQSSALHVIEPAEVP
TFPVDAKRLQGVLIALFVSLCAGLIFAFLLEYLDNTIKTVDDVARFVRLPALGVIPMMTAGKRGLGPKRRAYALAAAGPA
ARALLASQAEIVECDSASSAAEAYRVLRTSVLLCAAGSPPRTILVTSGQQGEGKTTTVINTAVSLAQLGAKVLIIDCDLR
RPSAHKLFKLPNTAGLSTYLSREIDVEALIHTQELKNLSLLPCGPIPPNPAELLSSQKMKDLLSAMSERFDHVLIDSPPL
INVTDPIILSTIVDGVILVVHGGRSTRDVARRARQELVNAGAKIFGVVLNNVDMRQHKYDDYYCYYSKQYDSYGHAQ
>gnl|bykdb|A0A348UZU3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=731 residues).
MSENYVDPQSLETAEIDLRKYIDIFYRRRWTVISLTLIAVALSLIISFVTRPVYKARGTVMIEKEPNILSFEDIFQIETF
RDDYFQTQYKLLQSRSLAERTIERLKLWEKKEFSGGKNVTGEDLKNPVFRQKLVDKFLGRLEVKPIRMTRLVEVAFKAHD
PALASDCVNALFDSFVDMNIEARYETTEQATEFLSEQIAELKKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELNK
ALTEAQIERVRKESYYNGIKNASPDFIPEAMNNPLIQRLREEYLKLSREYAKMEEKFQPEYPEMQRLKAELDTARELLKN
ETQRLIRAAYADYQAALKKEASLKELFEQQKEEAFRLNSNAILYNSLKIELENKKNLLESLLKRQSETGVSARLKGLRTS
NIRIVDRADIPLRPDSPRKFRNLLLALFLGLFGGLGLALGMEYLDNTVKSAEDVERYSGWPTLGVVPIFDQDATLNGHYY
AYRSAEDEDGKKKRKEEKGETENEPRSIELISHFAPDSTFAESYRSLRTALLLSGPLSSLKSLIITSPLPNEGKSVTISN
LAVSLAQTEKKVLLMDADLRRPKQHRIFNLKNHDGLSNYLTMGLELKKLVKTTMVPSLYFINSGPIPPNPAELLGSERMK
ELLGRLKGSFDFILIDTPPVLSVTDSQVLGKMVDGLILVVQADRTPKEALRQTREIIDLLQLKTFGVVINALNLDNRSYY
HRHYYRHYYKH
>gnl|bykdb|A0A348V070 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=763 residues).
MDKITPTTPTTGARQTQQNLLEQILYYWHAVLRWKWTGLTVAVLIVALTLVYILISPHIYTASGTIWIDETQSVLPFEEL
SRLSGGINSQSHAMLLKSRSLAADVIEKMKLHSHPEFIAPKLPVKLQKEGVQPDNPVFKERLIDEFIESLNVSPLTGTKL
IQVSFNHRNPELAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQISALRKDIEEAEKKLAELGTAQGILPLSSAEAPL
IQKITEVNTALTAATLDRVNKFSAYNQLKALRPEELPESPSNPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEI
EATYDSLTREKENLIKTAYAEYQGALAKEQNLQKLLDDLKAQAYKANSTAILYNSLKIETDNKKALLEALSKRQSETDLA
SRLKDLQALNVWIVDRASPPVNPSFPNRRKTFIIGVLLALIGGAGTSLFINYLVATVKSSRDIAQATGWPTIGTIPAFEK
EFKPRGPRAEFRTLSGLLKGRPGILDKKKKKKHDTPRPKSVSLKTEEGAPENDKNNHQIELIIQREPRCIQSEAFRSIRT
SLLLSFDSPTRKALIFSSPLSKDGKSSVISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVDYTWGLTHFLSSIVDASEI
IRPTAYTNLFVVPSGVTPSDPLEVMFSEKMRAFITFLKQQFDFVLFDSPPVLAVSDALVLGKQVDGLILVVRAGQTPVNA
LKQARNKIEDHKINCLGVIINGVSLLEQEGYYARQYYHYSKPL
>gnl|bykdb|A0A350UEK1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=789 residues).
MSQQSPPPGDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLDYWRILRRRKGTLIIGAVAGLLIG
IASTLPRTPIYQAKTTLEIQSFNQNFMNMGNLQEVTEGSGPAGNMVDLQTQIKILQSDTLVDRVTAQLSNGTTPAEPAAP
GRLAAWRQALNLPEEAATGAKARAVEMAADTLKVRASGQTRIVEVLVDSTDPAVAASFANRLTAEYVEQSMEARWQSSQR
TGEWLTRQMDDLRIKLERSEDALQSYAQRNKLVFTGKDTNVDEEKLKQIQDQLTAVQGDRVSKQSRWEMASSAPAETLPD
VLNDTLMRGYQEKISDLRRQQQELLETFTPENQRVKRVAAQVASLEKSLEVERAQILRRIRNEYEEAMRKERLLQTDYDR
QTRLVTALGEKAIQYNILKREVETNRQLYESMLQRVKEAGLASALRASNVRVVDEAQPPERPYKPSLPLNAVLGLLAGGF
LAVGFVVTTEKADRALREPSDIPFYLGARELGVVPSAGRVEDGKKHRLLTGRSKKADAETQSLTLATNGLSEKLELVTLQ
RRLSATAESFRAVLTSILFSGNGHGPPRMIVVTSASPSEGKTTVATNLALAMAETGQRVLLVDGDTRRPRQHGIFEVPND
AGLTDLLKPGDGDWKKLIHESGAPGLWVLPAGPGVAAPSHLLYSKKLRAALEWFREEFDMVVIDTPPMLQIPDARLFGKL
VDGVVLVVRANSTTRDAALAARMRLREDGVTLIGTVMNDWDPQDSPGGYYGSYGKYSTYRQYYSNQAAS
>gnl|bykdb|A0A350UIQ4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=784 residues).
MPKPTPPSNPQGDSASANSRLPVKFEIVDAPPANSDPYYGGPQFDSDEEEGGLLEYWRILRRRKGTLVIGATVGLLLGIA
VTLPQTPIYQAKTTLEIQSFNQNFMNMGNLQEVTEGAGPSGSTIDIQTQIKILQSDTLLERVHSLMNPGEEVAAPAEPAS
TPSRISAWRRALNLPDVPENDARQHAIAMAADSLKVRASGQTRIVEVLVDSTDPAIAAQFANLLTSEYVDQSMEARWQSS
QRTGEWLTKQLDDMRIKLERSEDALQNYAQRNNLLFTGNDTNVDEVKLKQIQDQLTAVQGDRVSKQSRWEMASSAPAASL
PDVLNDSSMRGYQEKLSDLRRQQEDLLEVFTPETSRVKRVNAQISSLEKSLANERDQILRRIRNEYEEAMRKERLLQADY
DKQTRLVTVQGEKAIQYNILKREVETNRQLYESMLQRVKEAGLASALKASNVRIVDPAKAPERPYKPRLPLNALLGLLAG
GFLAVAFVVTTEKADRALREPSDVPFYLGVRELGVVPSASLLEEKKGRKLLGEESQSLVLTNVGLGEKLELVTVQRRLSA
VAESFRAALTSIMFSGNGSGPPRMIVVTSPNPSEGKTTVATNLAVAMAETGQKVLLIDGDTRRPRIHGIFEIENEAGLSD
LLKPDCGEWKKLIHQTPVPNLSVMTAGPGVAAASNMLFSKRLLSALEWCRSEFDMVVIDTPPVLQIPDARLFAKVADGVV
LVVRANSTTRDAAMACRMRLREDGTHLIGTVMNDWDPKDSPGGYYGYYGKYSSYHQYSRNQGES
>gnl|bykdb|A0A350UQT3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=698 residues).
VSRIDEEMWKIGAFILVVLIATAVISLRLTPVYESTATLYVDRQEAKGIVGQESQANVPSALDAESFLASQIRLLQSDSV
VRPVAQRFRLLESEQQLAKEGDQARAQDAPIVLRNLKVARPPNTYLLQVSYRSPDPQLAADVANQVAQSYIEHTYNIRIR
SSQSLSRFMERQIEELRVKMEDSSGRLAQMERELNVINPEEKTNILSARLLQLNTEYTRAQAERVAAEAGYEQTRSGSLE
SAQVSGQGEAIRRLLERQNEAAERFAEVKAHFGVNHPEFRKAQAQLREIQSQVDATRDNAIRRMQVEYEQAQAREKMLER
SVNETKAEYDTLNFRSFEYQRAKREAEADKNLYDELVRKIREAGINAGFQNNMVRIADAARPAWKPVFPKLTLNLLLAFL
FSSLLAVGAAILVDTLDNTIRDPEQVSRTLKTHIIGTLPSVKNTRELMLPAKLLTAGETHVEDPSARPKDRQFSTYEEAV
RTIRSSVLLTDFDRRLRTLLMTSATASEGKSTTAGHLAFAHAEQRKRTLLIDCDLRRPSQHKLFGIPLGAGLSNVLNGET
GWRDVLVRPANNEYLEIITAGPPSRRAADMIGQLLGPVMEEMARGYDLVILDAPPLLGFAESLQMASSADGVIVVTRAGE
TSRKAVAAALTTLSHLRANVLGLVLNQVKKHHADSYYYYGYYGKYYKRYQSAAQNAEG
>gnl|bykdb|A0A352EX26 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=819 residues).
MNPSNELIRKEPADTAIGRPADSNGIPHSYNYGVDPNAESEVHLLDYWRAVRKRLWLVIGIVILITTLAVINAAQKPDIY
SANARVQVDLENNGALVGKTPYYMGSMNDPVYFNTQLQILGSQALARRVVKTLDLEHNPDFFKGTQKRTTWQTVKMMAGF
DNNVPKPDQSKPNDVLQLRTTVAPTTSQEDLVEAKRLSPYVGAILGGLRVDPVKESRGLYKETRLIDIGYTHTDPEVASK
VCNAIADTYVFNNLEKKTESNASTGDVLQKRIAELQQAIRSDEERLVNYAKNNQIISLDANQNTVVERLAGLNKQLLEAE
NERKTAEAAFNAAKAPGAASALAEGDNKQAGDGENKLADLRQKRALLMVDATEEAPEVKEVDQQIAELERQVNDSRNRKT
NTLLTNLETQYRQTLGREQALRAAFQQSRSETVTQNEAAINYRIIQQEIDTNKTLLDSLLQRSKENDVIMASKPNNISVV
DYAITPAGPVGPNRMRTVALALFLSLGLGVGLALFLEYLDDTVHSTDEVERLLHLPALAVIPSANGMGRRKLLGGPGALQ
KRNGHSGNHELLMNVDSRSPLAESYRHLRTSLLLSTAGRAPRSLLVTSSLPGEGKTTTAVNTAVSLTQTGASVVLIDADM
RRPRMRSIFGFSERPGLSSILSSDVSREDTLAMISKDEVTGLHVLTSGPIPPNPAELLGSEQMRRLMTLLQAEFTHVVVD
SPPINSFTDGVLISSLVDGVLLVVHGGKSSRHVVKRARQLLHDVGAKVFGVVLNNVTLQSNDYYYYQRYYASGNYTSDLE
ADMPAPPPPASASSTLDLR
>gnl|bykdb|A0A352F3R7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=787 residues).
MAQDNRLLPVSALDRSIDRPLADLVPAKPYGTSGSEPTTLRDYLFVVLKRKWLILSLVLVITSLVTIQSFRAPSIYEGET
TIRIEQRPMSVLQTKEIVITGQNDPNFWGTQLKLLENPALARQVVLTLDLQHNPAFFGGQTQGGVFSSLRRIFSKPKKAT
VAPAAPAGLVVVGESEVTGDSLTPEQLAELEPYEDGIIAGEAVEAVTNTNLVKIRFVHSDPELAQKIANTLAEVFVNNNL
QRATAGSSKAEDVLAKEIASYQTKIKQEQEAQFNYAKNHNLPLTIDASSNLEVARLSTLSSQLLQAENDRKLIQAQLEAA
RREKDPFSIPDVNASARVDKLRDRISALKEKRDALLIVYTSEWPEVKKIDAQLKGLEAELAKAPPEIVTSIQRRYEAAVS
RENLLRRSYEQQKGTTTQQTRDQIDLIALTQGLETDKQYLNTLLQRQRELQVTSGDRSNEVNIATYSRLPKEPIGPQRLR
NIFIAFLLSLGAGIGLAFLLDFLDDTVKTVDDIDRYLHLPALALIPASRERGRLIGTGPSPEGPSDTTALALVHDARSPI
AESYRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTTINTAFMLAQTGAEVLVVDCDLRRPRLHAHFNAPNNKGLTNWL
SGETDIDNLMQTLPAQPNLKFLTSGPVPPNPAELLGSDEMRKLLGILSERFSHIVLDSPPAISFTDASILSTMVDGVVLV
VHGGKSSRAVVRRAKQQLLDVGAHIFGVVLNNVKLETQDYYYSGYYSSYYAEGEDKPEAVPGETAQS
>gnl|bykdb|A0A352F549 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=820 residues).
MKEPSDLSKALEIILKNSALEQSNGSSHNGHGNPPIVAYGEEASPEGEMHLRDYWKTIRKRLWLIIGLALIVGSVTALRQ
ARQPDIYQARARVQVGTQTYSPALGASRGESFYPENGYMEPEYFNTQVQILTSPTLLRRVAKNLDLEHNRTFLDGRVENR
STWRSLLTMFGFSQKQAEAPKNQNVLPDVNSSPAFASAGFNADDPAEVERLTPYAESLQGLVDVEQVKKTYLIDLRATHT
DPVVATKVVNAMADAFALWNMEVKTKTNTVAGSYLQKRIAELQSQIRSGEEQLVNYAQSHEILSLDASQNTVVERLAGLN
KELLEAENDRGLAEAAFRTSKLPGATEASAEVSDKQIAELKTRLGELRQKRAQLLLTDTEESPEVKDATQQIATLEKQLA
DTRGSAKQIITTNLEVNYRKAVEREKTLRDSFNKQRGETVAQNQAAINYNILKQEIETNKGLLAGLMQRSKENDVTMAGT
PNNIHVVDYAAIPKGPVGPRRMQAVTLAMMLATAFGIALALFLEYLDDTVKDSRDIESGLRLPSLAVIPIAGKSTQRFFP
ISRALQRTNGNGASPELLINGTGSSVQAEAYKHLRTSILLSTAGRPPKTLLVTSSVPAEGKTTTVVNTATVLAQTGAQVL
IIDADMRRPRLHQVLDMSNDDGLSAILSSEVSEADVLSKIRKYQDSNVYLLSSGAIPPNPAELLGSTQMKRLLEIVGESF
NYVVIDSPPIASFTDGVLISSLVDGVLLVVHGGKTSRQVVKRARQMLQEIGAKIIGVVLNKAELNAGNDYYYHYGYKGYY
SRADERSSQSESSSITVVPK
>gnl|bykdb|A0A352FLX4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=827 residues).
MNQSTNLSRTNTVPIGDEHIGLERTNGGHVLPGVMQGAYSYEREERGSRLLDYWRIVSKHLWLILGISVLIPTLVAIYVV
RKPDIYESQARIQVDLENANPLLGGMSKNSNVILNSETNDPAYFNTQLQILTGPGLLRSVAKTLDLEHNPDFLRETSSKN
KSTWLDIRGMLGLKAKTPPQSSTPDVLPQSSSSSSSTAAQEQAEAERLSDYVDDLQETLKVEPVKETRLTVRETRLIDIS
YRHSDPHLAAKIVNTVAQIFIDQNREKKTETSGSTGTYLLKRIAELQSNIRGKEEELINYGKNHQILSLDANQNTVVERL
EGLSKQLLIAENERKMAESAYKASLQPGAAEALAEGGINEKDVPSATRITTDSELKLAELKQKRAELLVENTEKWPAVRE
IDKQIAAIEKVMGDARRRATGVVTTNLATRYRQALATEELLRKAYDQQRAETLTQNEAAVSYRIIQQEIETNKTLLDGLL
QRTKENDVVMAGTPNNIRVVDYAIAGKKPVAPRRVLTVALAFLFSIGCGIGLAFIIEYLDDSVRSMEDVENLLRLPAIAL
IPQVGTVKPKRNLAASGKKGALVSSNGSGSGEVLLTNIEKRSPVAEAYRHLRTSILLSTAGRPPRTLLITSSVPSEGKTT
TAVNTAISLAQTGAKVLIIDADMRRPRLHSIFNLSNDSGLSALLSREASEAEIISAIQHDEASGLSVLTAGPVPPNPAEL
VGSEQMLKLLSVVADNFAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHSGKSSRKIVGRARKLLQDVGARIIGVVLNKVP
STGSNSYYYSGYYQHYHYGAETTADQQ
>gnl|bykdb|A0A352FRF4 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=798 residues).
MTQDERLVPARPARDLDRTLAELTQSKGYGGRYGGGSPAEVNLKEYLFVVLKRKWLIMSLVLIITSLATIQAYREPSIYE
GATTIKIEQKTPSILQSGNGGGIVIGQSDPNFWGTQLNLLHNEALARQVIVRLDLPHNPTFFGPQGQSTIFASLKRIFSR
DSVPKTSPTPAAGSVPLNEEALNNQEFTPEQLAALEPYEDTITANEIIEPQPQTNLVIIRYRHTDPALAQKIADTLAEVF
VANNLNLQESGTSKQSQDLGQEIAKYQGQVKQKQADVFNYAKQYELPLTDAPASNLRQQRVSTYSSQLLEAENQKRSLQS
AYEAAKTSPDPFANPEVQKDERIMKLREKISELKDKETGLLQKYTKEWPEVQQVEAQIAQLEVELKKAPTEVLASMKAKS
DAATTQLADLKTAYTKESGLTAQQTKNIIELASMRADLASDQQYLNTLFQKRRELNAVSGETGTNVSVSNPSRLPRAPVG
PARLKTILIALILSLVAGIGLAFLLDFLDDTIKSVDDVDRYINLPALALIPAVRNDRTRLRGGEAALAGPNDTTALAMVK
DIRSPIAESYRHLRTSLLLSSAGTAPRTILVTSSQPSEGKTTTAINTAFILAQTGAEVLIIDCDLRRPRLHAHFNISNAR
GLTNCLSGEASEIDSVIQSYAALPNLKLLPSGPMPPNPAELLGSEEMRNLLLSLREKFTHVIVDSPPAISFTDASILSTF
VDGVILVVHGGRSSRAVVRRAKQQLLDIGANIFGVVLNNVKIEKTQDYYYGGYYGHYKSSYYAAEEQPATDQGDATNT
>gnl|bykdb|A0A352FTJ9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=811 residues).
MNEATKLVKQDESRPVERRSDESQPYRGYGYGADAGDGEVHLLDYWRAIRKRLWLVIGVAVLMTTLAIIYVARKPDIYES
SSRVQVDLENNPMYAEKAAPMIVNPINDPAYFNTQLQILTSPGLLRRVVKTLDLEHNQAFLRPTAAQPHSTWKTIVKMLG
AGAEKKDTVPAPNVLPLTSAMAPAVSSDDLVEAKRLAPYVSALAAGLRVEPVRENRAGYNKETRLIDIDYQHGDPEVAAR
VVNAVAQTFVRSNLEKKNETNTTTSEFLSKRVEELQAQIRAAEEKLMAYAKSNQMLSLDANQNTVVERLAGLNKQLLEAE
NDRKMAEAEFNAAKAPGAASALAEAGAKEIEATDSELTKLRQKRAQLLIEATEEAPEVKEIDQQIDVLQKHLADTRARGT
ATLLKNLETKYRQAADREEALRKSFNQQKGETVTQNEAAINYRILQQEIETNKGLLDNLLQRSKENDVVLAGRPNNISVV
DYAIVPDFPVGPARLRTVMLAFLLALGFGAALALFLEYLDDTVHSTDDVERFLRLPALAVIPAMSSASAPRRLLSSAASL
QKRNGSNGSNPELLLNINGRSALAEAYRQLRTSVLLSTAGRAPKTLLVTSSLPGEGKTTTAVNTAISLAQTGASVVIIDG
DMRRPRLRSIFDLPERDGLSSILTSEATPEDMLRSVARDESSGLFVMSSGPVPPNPAELLGSDQMRKLLATLSEKFTHVV
IDSPPVNSFTDGVLLGSMVDGVLLVVHGGKSSRDVVRRSRQLLLDVGAKLVGVVLNNVSVRSHEYYYYYQRYYHQSYYTQ
ETAEEVAATRS
>gnl|bykdb|A0A353C9L6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=884 residues).
IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQDQRLTPLPKSADLRANASEYGSSYSSFYDEEVI
EGKRTVQQYFRIVYKRLPLIIAIVTIVTAAAAIYMYRQPTVYQATTDMIIEPRRPKVTSKDAININFGQDANYYQTQLML
LRNRDLVKQVVIDLGLYREPNLFGASERGILASLRSIFTGSGQNAEVPSALPVVSEPELLGEERPRTILSPDEEKRADQY
AGILFSGLTVDQVERTNLVNVRVKSTNQALAPKVADKIAEVFKLRDAERETQGAKNSAADLAKSIEELQNTIAQQEIDLI
AEMRSSGLPLQERGQDLSASRLSSLSETWLKAMESRRQLEGRYNAALTANSRGEGMNIPDLYENKIFQDTIRLNTERKAK
LQDQIRDIEKQIQETEAEKAELLVKYTPEYPEVGKKEAKIASLKETKDKTEREVSGIIDRDQKKIEKDAVTGALVSLRAQ
LDSKRREEAQALDAYEKEAALANVQGQAQTKLTTLKREIETKRNLLDTYTQRLKEKELEVESGAPDNIKIAANAGGAYPV
GPQRSRNILVAFLLSLAAGLGLAFLLDYLDDSVKTSEDIGRHVGLPTLALIPHYFGSEKRRLRLLAANGNGNGGAPSTGL
VTLEERHSPMAEAYRHLRTSLLFSSAGKPPQTILITSSQPSEGKTTTAINTAITLAQSDVDVVIVDCDLRRPRLHSHFDL
ENTQGLTNYLSGERNTQNLIKTCRDLPRLKVITSGPIPPNPAELLSSNEMRNLLQFLRGKYKHIIIDSPPAISFTDAAIL
STQVDGVVLVAMAGRSSIHLMRRFKQRLGNLGARIYGVVLNGIKSGSVEYEYYGAGYYDYYRKSEVDTATPLMDDARNIH
NTNG
>gnl|bykdb|A0A357F267 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=838 residues).
MEQDQRLTHLPKAVDLRANGGDYGSGYSSFYDEEIADGRRSLQQYFNIVYKRLPMILTLAIIVTAATAFYMYRQKSVYQA
TTEMLIEPRKPKVTSKDSININFGNDANYYATQLQLLQNADLMRRVVVDLGLYREPDLFGDGDRGFFAAVTSIFSSTKEE
EKEKEADSLPIVSDTAESPSPSSALELTPEEEKRVQIYAAMLRGGLSVEQRERTNLVNVSIRSTNPDLAARVADKVAEVF
RDQDAERETQGAKNASEDLGRSIDELRETIAQQEIELIEYMRSSGLPLQEKGQDLAATRLGSMSETWLRALEARRQLESR
YNAAVSARARGEGMNLPDLYENKIFQDTMRLNTERKAKLQDQIRDIDKQIQQAETEKAELLVKYTPEYFEVKKKVERIAA
LQETRAKTETEVTQIIDRDQKKIEVDAINGALVSLKAQLDAKRKEEAQAQAAYDAEAARANIQGQAETKLTTLKRGIETN
RNLLDTYTQRQKEAELAIASGRPDNIKIAARAITPKSPIGPQRNRNIFVAFMLSLAAGIGLAFLLDYLDDSVKESEDIGR
HLGLPTLALIPHYFGSEKRKHRLAAANGSEAVASTALVTLDERNSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEG
KTTTAINTAVTLAQSDVDVILVDCDLRRPRLHSYFDLDNTHGLTNYLSGERNTDNLIKSCRDLPRLKVITSGPIPPNPAE
LLSSNEMRNLLQFLRGRYKHVIIDSPPAISFTDAAILSTQADGVILVAMAGKSSIHLMRRFKQRLGNLGARIYGVVLNGI
KAGSMEYDYYGSGYYDYYRKSDADSSTPFMDDAADTKD
>gnl|bykdb|A0A372IRG7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. 4G-K13] (length=755 residues).
MQGSAIAPQGQQELHPPGGVPPHESPAFTPADFRKIIIKRKWVILFCVLVGVGIAFYHIFTTIPQYEAISRMSIDFSRST
NIGIEDIIESKLSGGEESDQKLQTELRIMQSDSVVMDVINSLDLYHRKPFSDMFAKQPYTGHLTPLQRYQLIRAFQSSEK
VIVETGTQIVEIHFQNPDPEVAAKVVNAIVQAYMERDLRSRFEGTTRVSNWLSQQLSTLKSQVQSSQQELSDYQKKNNLV
GLGPTGTSLVTDDLRTINDQLAEARADRIVKEARYRMAQTRNPDLLVSVSGGVLGSLRSQEADLMVQKAQLQSKFGPEYP
KLREIDRQLGSVRSDIQTEITNLTQRFQTEYDAAVKTEGLLQQRLDDTKQQAFHENESAAQFEILQHGAESASELYDALQ
MKLKEAGITAGLNSNNIDVIDTAMIPPYPVLPQKRQDATFGFLGGLIVGLILAVFLESMDDTLRTSDDAEAVSLLPALAV
IPHFQPFSKKAINAKDEAADRNGSLAKVSPDLLAYNEPQSIVAEGFRSLRSSILLSAVDREPKLLLLTSGFAAEGKSTCS
SNLAVSFAQRNARVLLVDTDLRKGTLHMKFRLSNRTGLSTYLSRESKEESFEYPIPGLPNLAVMTRGPIAPNPGEMLASR
MMEDTLARWRQEFDHVILDSSPILAVSDTLSLAPQADAVLIVLRSGITRKKALSRVREQLRRSGARVLGTIINDVDLRLE
NYYTYSRRYDYGYKGYKGYGSAYGAGYAGGKDGEE
>gnl|bykdb|A0A372IT17 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. 4G-K13] (length=765 residues).
MTSPTHILERDAMAVYDEWTVADLLSILRRRRRIVLGMVFALLLLVTLYCLLITPLYQATGEIEIQREPSGAFGLDNGVL
GDTSHEASDALENSMSIETQAGILESDTLALHVIRALDLESTQNFFPAKKRGLTIPGWIFFWRSPLEPRSVPLEEAPNRR
YVALRIFARHLTVQPVTGTRLIEIRYSDPDPALAARVVNRLVQALADYTFQSRLAQTSESSSWLAGQMSGLKKQAEALQT
KAIGLQSEAGMYGDNGSHDVVLAQLENLNQALSQAELNRILKEAIDHTAQSGDPELISGLTASAGAEETGGLQHSLELIE
TLRSRESTAKAELAQDETRYGAAWPGMQERQAQLTEIQKSIHDEVRRVGERAHADYEIAQRAEDTAREEFEKQKTLAAQM
NDRRIAWTLARQEADESRRLYDQLFGKLKQAGVLEGLHTSSFSIVNPARIPPGNHPKSPNLPLYYAAALGAGLFLGCAGA
ITCEFTDRSITSLTEVERLTGAPLFSVIPLLEPSFHLPRLLRGGGSSGVTAAASWELQGTGSASGSPFSESLRTLRASLM
LSRSSAPPQVLLVTGTRDAEGKSTIALNLAAILAHQGAQVLLVDGDLRRPALHRYLNMPESPGLSEALAGSAAPPEPQPL
TALPSLALLHAGRKPPFPSELIASRRMEELLGGWRHQYDFIVLDSPPVLPFADALVLSQMSDATLLVARPGVTAKPAIAR
SYRALSLQMAQNAVLGVVLNGVRETSAEYYEYYGYKGSRYGGTRT
>gnl|bykdb|A0A399WK13 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=825 residues).
MKETRNIITTTSPEPVELQRPPDPAIPTTGRYPGYSATPQGEGFQLIDYWRAVRKRLWLVVGIAVVMTTLATIYIARKPN
VYRAKAVVQVDNEQVNPDLVTTDRARPISNADPSYFNTQLQLLWSESLLRRVVKEHNLDANKEFQAAAKASSGSMLGRLL
RSVGLASGDKQKQEESVPIDPNSTLASADEIAEAVRLTPFVEVIRRNLSVDPVRESRATVKDTRLIEISYSDTDPDLAAF
VANAIAETFTNQNQEKRTGTSRKTNDFLQERIASLQSDIRRDEEKLVEMTQNAGILKTSDDSTIVMDRLSGLNKAMLEAE
NARKNAEANYFEIAKSPERLSAMAEAEMARFITEQQNNIRQFQSDTLKKISDLRQARALKLQEYQEGAPEIKEIDAQITS
YQNSIDNAVQKFQNDLDKYRDSTKKTLLYNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLALLKQTIDTNKGFL
ENLRKQVSSNDVAAQGSDNNITVTEPAVPSNIPVSPRRLTTVLGALFLSTLFGVGLALFLEYLDDTVRSTEEVESLLQLP
ALAAIPTIDSMPKRRLQLVAENGEPADDNLGSELLIHADPRSSLAEAYRQLRTSILLSTAGHAPKSLLITSSLPSEGKTT
TATNTAISLAQTGASVVIIDADMRRPRLHSVFGISNADGLSTILSNDLSEAEILNIITQDESSKLHLLTSGPVPPNPAEL
IGSDQMAKLLKMLQGHFTHVVVDSPPIASFTDGVLIASMVDGVVLVVNSGKSSRQVVRRSRQLLLDIGAKIIGVVLNNVN
LRSQDNYYYYQSYYTRDNYRSDDEA
>gnl|bykdb|A0A399WNU1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=817 residues).
MQSNFQVVKRNSRQDPESLDFYDQDDLYPESYYGDSIQEPTEKQQLFNLLSILKKHWLLVLSITLIGTFLVIVYEAQKPD
FYEASVRVQVNNESNPAAGEGTASSIILNPGSDPTYFATQLQIIEGPGLIRRVVKNLDLEHNPTFFRPGKDQDTTVWQNV
ARMFGLYSQPVRNQAESAPPAKNTLDLKTDTDADLDSQAEQLAPYVGFIKRNLEVSPVKDSRTATKETRLIRIEYRHYDP
VIATKLVNAIADTYVLQNLEQKVQSNASASDFLQKRVAELQAKIRTGEESLINYAKSNQILSLDANQNTVVQRLSDLNTK
LSQAENDRITAEAAYKAALNNPLAGTTAQAKDARTAGLESQLTTLRQQLAQLKVDYTDEWPEVQKVEKQIAGIEKELQSN
RKRSADTQIASLLQTYREAASRENELRSNFDAQRSAVLNQNEAAINYRIIQQEIDTNKSLLNSLLQKARETEVVLNGTPN
NVHVVDRALVPGAPSGPQRTKNVVIAFFASLFGGIAIAFGLNWLDDTIRVPVASQAQLGAPIVGMIPQSNGHRRSNHFLA
KFNRHRNGDGDPDPAESRSAYADSFNNPLIAEAFHQLRTSLLLSTAGGSPKTVLVTSGEPSEGKTITSLNLAKSLAQLGG
KVLLVDADLRCPKMHLINNIDNSCGLSTLLTAEEVDQDLVDRAVTKSSEPDLDILPSGPRVPNPASLFASTHMKGLIERL
SATYSYIVIDSPPILYFADSVILSTQVDAVVAVARVNFSSRDVLTRARQKIQDVHGNVVGIVLNDIQLNNFKYYNHTYYR
QLEPPDLDQGDGNVLHL
>gnl|bykdb|A0A399WUJ8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=846 residues).
MDQDQRLTPLPRGLDLNQPHGELPAAYTAYYDHESQSGQRTLRQYVRVITKRLPLIGAIAIVVTAAAAFYSFRQPSIYSA
STEMLIEPRKAAPTDAININLGGDETTYYNTQLQLLQNPDLMKKVVLALGLQRDPDLLGQSDRGFFATIKSLFSGPAKAQ
APQGTLPVLTGTENADPTAAQLSPEESARANQYAAALSGGLRVDQTERTSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDA
KRELEGTQSAYDELTKSIADLKVTIADQENKLTEYMRSSNLPLQEKGADLAASRLQTLSEQWLSAADDRRKLEARYNGAV
TASSRGQGQNIPDLYENKVYQDTVRLNTERKAKLQDQIRDIEKQIKDAETEKAELLVKYTPEYVKVKQVEEKIVSLKNTK
QQTESEVSQIIDRDQKKIEKDAVSGALVSLRSQLDAAKRREDQLLNAYEVEAERANVQGQATTTLTTLKRALETNRGLLD
TYTQRQKEQELSLAAGKPNNIKISNRAVVPTSPDGPKRARNIFIALLASLGAGIGLAFLLDYLDDSVRTSDDVSRALGLP
TLAMIPHHGINEKKRLSLRGIAGESNGKSTAASTALITLEDRHSPMAEAYRHLRTSLLFSSAGKPPQSILVTSSQPSEGK
TTTAINTAVTLAQADADVVLIDCDLRRPRMHSHFGLSNTQGLTNYLSGEKSTENLIKAAPGLPHLKIITSGPIPPNPAEL
LSSNEMRNLLQFLRGRFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQFRTRISALGARIYGVVLNGIT
SESVEYDYYGTGYYHYYQHRTDDATPIMEDMGPSEPPRDQGSSFRP
>gnl|bykdb|A0A399Y5V2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=574 residues).
MTESHATTLELRDYLGILRRRKWFIILPTVVILVAAITASLLTTPIYEASADVLIQSNKRSSVIADVAMPAEDPARELQT
QIQVITSRPVAEETAKRLQLNVPPEAIQARVTAQVLGQTSIIRVRARDASASLARDIANGVSATYIDLRRKSALDSFAQQ
ANDLQQKVDEATAELQQRDAELADAISKTRGEKTSDTGSQALVATLTNRREQAAAVQSFWKTALDKLQIQSNLQTSSAET
VAPATLPTAPVEPKLSRKVIFALTIGILLGAGIAFLVEYLDDSLRSKQDAEKAFGAPILGMIPRAQSWNDRRSAMLLSVK
DPASTTAEAYRSVRTNLQFSLLDSGSRVVLVTSPSASEGKSTTAANIAVVLAQSGKSVIIVDCDLRRPRVHKFFELRNTE
GVTTAILAERPLVDLLQRPRIAGAPPSLLALTSGPIPPNPADLLGSARVSELIETLGTLADYVVIDSPPIVPLSDAAVLA
PKTDGAIIVAKAGQSSRRASAQAAEKLDAVGAELLGVVLNEVTPNFGEPGYYYDYYYYYQSYRPIPEKQGSKRGGGRRSK
DSGGARAAQTAGSR
>gnl|bykdb|A0A3B9MEU8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=789 residues).
MMSQDNRLLPVSALDRSIDRPLADIAQAKPYGVSGADTTTFRDYLSVVLKRKWLILSLVLVITSLVTIQSFRAPSIYEGE
TTIRIEQKPMSVLQTKEIVINAQSDPSFWGTQLKLLENPALARQVVLTLDLQHNPAFFGGQSQGGVFASLRRIFAKPKKA
SESPAVSSGLTVVGESEVTNGSLTPEQLAELEPYEDAIIAGETIEPVPTTNLVKIKFMHSDPELAQKIANTLAEVFRNNN
LERSTAGSSKAEDQLAKEIAKLQTQIKHDQEAQFNYAKNHNLPLTAEAGGNLEAARLATLSGQLLQAENDRKMIQAQLEA
ARKEPDPFSVPDVNSSARVEKLRDRISALKEKRDALLIVYTPEWPEVKKIDAQLKGLEAELAKAPPEIVTSIQRRYEAAV
SRENLLKRSYEQQKGTTTQQTRDQIDLMAITQELETNKQYLNTLLQRERELTVASGDRSNEVSIPTPSRLPKTPVGPQRL
RNIFVALLLSLGAGIGLAFLLDFLDDTLKSVDDVDRYLHLPALALIPSNRDRGRLIGISGGPPSAPSDTTALAMITDVRS
PIAEAYRHLRTSLLLSSAGQPPKTILVTSSQPSEGKTTTAINTAFMLAQTGAEVLIIDCDLRRPRLHAHFGAPNSKGLTN
WLSGETDIDALIQTYEQHANLKFLTSGPVPPNPAELLGSDEMRKLLGILSERFTHIVIDSPPAISFTDASILSTMVDGVV
LVVHGGRSSRAVVRRAKQQLLDVGAHIFGIVLNNVKLETQDYYYSGYYSSYYADGDKPEEVPGEPAETR
>gnl|bykdb|A0A3B9MK99 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=771 residues).
MCIRDRVISVLVLITTISVIHVARKPDIYQASARVQVGLENNADLVGKTPYYFGPTNDPVYFNTQLQILGSPGLMRRVVK
TLDLEHNPDFFKGTIQKRSTWQTIKRMAGFASADPPDVTAKPKDELQLRPAVAAATSQEDLVEAKRLAPYVGAVLGGLRV
EPVKESRGLFKETRLIDLSYTHIDPEVASKVVNAIAETYVYNNLEKKSDTNMGTADFLQKRIAELQQQIRSDEERLVNYA
RNNKIISLDANQNTVVERLGGLNKQLLEAENARIEAESKFNAAKVGGAATALAEVDAKQVNETEGKLADLRQKRALLMVD
ATEEAPEVKEVDQQIAELERQVKDVRSRKSVTLLTNLETDYRQTLAREQALRKAFEQQRGETLSQNEAAINYRIIQQEID
TNKTLLDSLLQRSKENDVIMASKPNNISIVDYAVTPDGPIGPNRSSTVSMALFLSLGLGVGLALLLEYFDDTLRSSEEVE
RLLQLPALGVIPSANASARRRLIGASGALQKRNGHSDSPELLMNVDGHSPLAEAYRHLRTSVLLSTAGRAPRSLLVTSSL
PGEGKTTTAVNTAVSLAQTGASVVIIDADMRRPRLRSIFGLSDRAGLSSILSSDVSEADMLEMVSTDEATGLRVLTSGPI
PPNPAELLGSDQMRRLMATLQSQFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVRRSRQLLHDVGAKIFG
VVLNNVALQSHDYYYYQRYYGARNYKSDGDDDIEPTSHARRNGSHNTLDLN
>gnl|bykdb|A0A3B9MLP9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=818 residues).
MKEPSDLAKALDIILKNSSLEPTNGSLRNGYATPPIVAYGEEASPEGEMHLRDYWQTIRKRLWLIIGLALIVSTIAALKQ
ARQPDIYQARARVQVDTETYSPALGASRGGSYYVDNTYMDPEYFNTQVQIISSPTLLRRVAKTLDLEHNRTFLDSHVDNR
STWQSLMRMFGLGSNPKNSAVAENGALPDRGNQPLTTSGLSLEDPAEVERLAPYVDSLQGMLDVAQLKKTRLIDIRASHT
DPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQKRIGELQSQIRNGEEQLVNYAQSHEILSLDASQNTVVERLAGLN
KELLVAENERSLAEAAYRASLAPGVTEANAETSDKQVAEFKTRLAELKQKRAQLALTDTEESPEVKDVNQQIAILEKQLD
ETRGSARKIITVSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYNILKQEIETNKGLLEGLMQRSKENDVTMAGT
PNNIHVVDYAAVPKGPIGPRRMEAVFLALVLALVFGVALALFLEYLDDTIKSPGDIESGLRLPSLAIIPIAGRSAQRLLP
ITRALQRTNGNGSGPELLINSRGPTLQAEAYKHLRTSILLSTPGRSPKTLLVTSSVPAEGKTTTAVNTATVLAQTGAKVL
LIDADMRRPRLHHVFGLSNNEGLSAILSSETSEAEILAKINRYLETDIYLLSSGAIPPNPAELLGSAQMKRLLDVAGETF
AYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQILQEIGAKIIGVVLNKAEVRSSDYYYYHYDYKGYD
SQPDDETTESKSSSIVAK
>gnl|bykdb|A0A3D1ASD2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacterales bacterium] (length=734 residues).
MSEMRLDRSNLPALPSTYSVSHITAEPEARETTVPLTHYVWVLRRHKWKILGFVLACCIATLLVSTRLTPIYAATATVDV
DRQMPTNVLGQDSGRAPVNDADEYLATQINLIKADSVVRPVVQKLRLREVDGNDLMENTSEARSAAAEDAPVRLKRLEVI
RPPNTYLLQITYQSANPRLAAEVANGVANSFLQHSFEIRFKSSESVSQFMTKELEELKAKMERSSDALAKFQRDLSVVNP
EEKTSILSARLQQLNTEYTNAQTDRVRKEAGFNAMQSGQMEAALISSQGQSLKKLTEAYDEAQSRLADVKLHYGINHPEY
RKAQGQVAELDRQLQTAKTSITEQVAIEYRTATQREQMLKQELARTKSESDALNARSFGYEELKREAEADKKLYDELIRK
IKEASINANFQTSNVRIADSARPPLKPVFPRTRLNVLIAFLFSTILAIGAAVMSDVLDNTLKDPEQIARTLKTQVIGTLP
SMKSWRARLGPIAKGGAKAELVPLGELGDRYASGYDEAVRTLRNSILLTDFDRRLRSVLLTSASPSEGKSTVAAHLAVAH
AEQKHRTLLIDGDLRRPSLHKFFDMPMNAGLSSVVLQSANWREVVVPAENVAGLDVLPAGPPSRRAADMVGNRLPQILEE
AALEYDLIVLDAPPLLGFPEPLQMAVNVDGVIVVSVAGQTSRKAVASVLSTLHRLRANVVGLVLNEVRKEMSDSYHYYGN
YGKYYRAENEKRAS
>gnl|bykdb|A0A3D4VGU2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacterium sp] (length=759 residues).
MDTLDPQRQSGSAIASADEKTVAPQSTINLSDLRKLFLKRKWIILICVLAGIGVALYHVETATPQYEAVSSVSIDMNKST
GVELTSLASSSGGLQSQDRVETQLHIMQSNTIAWNVIKTLKLYNKPPYSGVFKKAGYHGTVTPSQKLALLNTFKGATQVV
LVPETDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLSQQIISLRESVNKSQNDLVQYQREHNLLSV
GQQGSSLVDANLETINSQLAQAEADRIVKEARYKMALTRNPDLLVSVAPNTVLTSLRSQEANLLVQQADLQSRFGPRYPK
LEEVRQQLKQVRSDINKEITNLTQRFKAEYDAAVQTQNLLEARLENTKQQAFKQNESSAQFEILKHKAQTSSELYDALQL
RLEEAGITAGLNSNSLEVVDHANLPVIPVTPQKKRTVVFGFLGGLIAGIAISLLLESLDDTLRTSEEVESIGHLPALAIV
PRFVSGAKRKTAYGSYGAEKRPKEPVAEKEDQISRDLLTLLEPQSIVAEGFRTLRSSILLSSVDREPKAILLTSGLAAEG
KSTCAANLAISFAQRPARVLLVDTDLRKGTQHLKFRVSNRVGLSTYLSRESGEESIVFPLPELPNLGVLPRGPVAPNPGE
MLASRMMADTIQKWRSEWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTRELLRRANARILGSVVNGV
DMRLENYYTYSRGYSYGYRSGYESAYGAGYGVEDTDDKG
>gnl|bykdb|A0A3D5SQ87 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Blastocatellia bacterium] (length=818 residues).
MKEPSDLAKALDIILKNSSLEPTNGSLRNGYATPPIVAYGEEASPEGEMHLRDYWQTIRKRLWLIIGLALIVSTIAALKQ
ARQPDIYQARARVQVDTETYSPALGASRGGSYYVDNTYMDPEYFNTQVQIISSPTLLRRVAKTLDLEHNRTFLDSHVDNR
STWQSLMRMFGLGSNPKNSAVAENGALPDRGNQPLTTSGLSLEDPAEVERLAPYVDSLQGMLDVAQLKKTRLIDIRASHT
DPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQKRIGELQSQIRNGEEQLVNYAQSHEILSLDASQNTVVERLAGLN
KELLVAENGRSLAEAAYRASLAPGVTEANAETSDKQVAEFKTRLAELKQKRAQLALTDTEESPEVKDVNQQIAILEKQLD
ETRGSARKIITVSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYNILKQEIETNKGLLEGLMQRSKENDVTMAGT
PNNIHVVDYAAVPKGPIGPRRMEAVFLALVLALVFGVALALFLEYLDDTIKSPGDIESGLRLPSLAIIPIAGRSAQRLLP
ITRALQRTNGNGSGPELLINSRGPTLQAEAYKHLRTSILLSTPGRSPKTLLVTSSVPAEGKTTTAVNTATVLAQTGAKVL
LIDADMRRPRLHHVFGLSNNEGLSAILSSETSEAEILAKINRYLETDIYLLSSGAIPPNPAELLGSAQMKRLLDVAGETF
AYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQILQEIGAKIIGVVLNKAEVRSSDYYYYHYDYKGYD
SQPDDETTESKSSSIVAK
>gnl|bykdb|A0A3E0NV31 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=759 residues).
MDRESYFNEDLRRHGGGGVGPGARRGDNDPSEGIKVRQLIESIRVRIFTVVLVWLLTVVVMVVHVWTQTPLYRSTATLEI
EPKQNLLPYQDLSARGGDQSNIETQITLLRSGNLLAKVVERLELTTRPEFVRSVDRGFFLDAAEAGLDLIKNGFRPRRRG
EALSEAGALRRLQENLSIAPVGNTQLVRVSYSSPDPDLSTDVAGAIALTFIETTLQTRYDATRRAVKFLEDQLAELENEI
EDSQDQLLAFARSRDLDVDGESASSRRVGDLARLQTEAEAEAARLRSYVDTLRAGRTEGVPDTAKTQELRALEAQIARQE
QELAALSARYGPEWPSVRQTRSELAELRRDLSAAGGRAADAVLQQYRAAQRRADSFAAQIRAERRSSDRESEAAVQLEIL
ERKTQTNKQLYDGILQRLRETDIVAELQKEGIRISIPATRPNSQYAPNKTRSTLFALGIGLALGIAAALGLEFLDQTVKS
SDHITESIGLPVLGTVPSIGKQEGNWLAAKLKLPRRKPSRTPPKLLEPKGDRRSNIVRESYRSVRTSLLLSSASEPPRTI
LVTSALPAEGKSTTVANMAISFANNNARTLIIDLDLRKPALAPLFEVDSENGMSKFLAGRAEFADLLQQTKHKNLALVSA
GPCPPNPTELLGSKRMRWCLGVASEHFDVVLIDSPPSLELSDALTVSPYVDGVVIVARAGQTPREAVRRTSLRFQRAGAR
ILGALINGADLRNPDYGYYYSGYLSRTYDYHYAGTSADG
>gnl|bykdb|A0A3E0P0A3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=751 residues).
MNLRQRTVAPRESDEAFAGSGDDLKLIAEYGSILLRGWKVLIAFAVLGLALGIARYLSAPVVYSATSQIQIERRAPNLLG
GQMFAQPWWNPEFFPTQEQLLKGRGLAEAVTRDLALWNHRYFGGAVDRSSYVRPGEPVTADDDAVVVARLASRVRSGLSV
QQVSGTQLFNLTYSTGDPEIAMMLANGYAEAFIETGKASSRADAAQASSDIQAEISSLEAEIQELEADLVSYTQSSDIVA
PNEETNVTLQRLTAANSAFLEAQRRRIEAQAEYNELSNRPADDLAETLSGGLVSSQRAELIRLQREYDTKLETYRPDFPT
MVELKTQIDEARRQLNQLIEENSRQAVTAARARYQQALQTERSLEREYEAMKEETRRYQSASTALQNLTGDIAAKRETLD
RLRRSQSQANISASSGNQAIVTQTERAVLPTSPVSPSLRRHLPFGVALGLLCGVALVLLIDFLDRSIKSPEELERRLGLP
VLGVVPDLNRRGSSRRVYGARAPAKRVDRGADLAIDLLPHSQPRLPASEAYRALRTATLLSKADEPRLLVVTSTEAQEGK
TATALNLAIVMAQLARRTLLIDGDLRKPRIHEALGISNRVGLVNCLVHQTELENVVQATPVPNLWVLPSGPLPPNPSELL
SSGHARELFAQLRQQYDTILIDTPPVLAVTDAVTVAVRSDGLLLCVRSQRAPREAIQRCVEQLTRAGAPMLGTVFNAYKA
RPGRYGGRYQSYGYGYGYGAYGDVELQDDVA
>gnl|bykdb|A0A3E0PCJ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=831 residues).
MRESRDIVRNPRTESAEVERPFEAVAPITNYGYARYRNEDLREHSPLFEYWRIIRKRLWLVLGITVLLTTVTAIYMARKP
NVYMASATVQVDLEQANQDLVTPDRRMPVMTSDPAYFNTQLQLLNSEVLLRRVVKELNLDTNEAFRKDSAEGSGSALRGM
LTALGLASDDSKKEDVVEEVPLASNTELATVEEMNEAVRLAPFVDAVQRDLIVDPVRESRATVKDTRLISISYRNQDPNV
AAFVVNGIAEVFTRVNDEKRTGVNSKTNEFLKKRIGELQSEIRQGEERLVDLKKNAGILKTDENTTIVTQRLMGLNEQLL
EAEEQRKNAEAQFNAVRDSPSRLSALAEEQMARYITERENDIRRFVNDTQKEITALRAKRQKMLVEYVERAPEIQEIDRE
IATLMNEIADFRDKNDKALQQYRKTVGETILENLKTRYLQTKEREDKVRSAFNAQYNEAQGQNQSEVTIKLLEQDIETKK
GFYANLENQQKGNDLAGAGTENNISVAEIAIPPERPVSPRRLTTVAVVMMLSLLFGAGLALFLEYLDDSIKTTEEAETYL
QLPALAAIPTVEASSKRRLLLVGVNESEEPEPGNALLISNDSRSSTAEAYRQLRTSILLSTAGHAPKSLLITSSLPAEGK
TTTAVNTAISLAQTGAKVLVIDADMRRPRVHSFFNLGNAEGLSTVLSSDLAEKEILNLVKKDEASGLYLMPSGPLPPNPA
ELVGSEQMKRLLVTLEKNFTHLVIDSPPIASFTDGVLMASLVDGVIMVVHSGKSSRSVVRRSTQFLHDIGAKVFGVVLNN
VDARSNDNYYYYQSYYHRDDDPDDPEAADEA
>gnl|bykdb|A0A3E0PCN7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=813 residues).
MQKNKQLALRPKEEGQETIVYGDYEGDYFDSSYYGGAPAPSERQQLMAAIGVLRKYWLMIVAITLLGSLAAVVYVAQKPD
YYTATVRIQVNNENNPAVGNDTSSSVILNSGSDPAYFATQLQILEGPGLLRRVVRTLGLEKNPEFLQPNQGEQSTVWQNV
LKMFGFYQTKSMTPVEFADKETEDALQLSLDSNEQPSEPEKLAPFVNSIRGNLSVNPVRDNRTAAQETRLIEVQFTHFRP
EVAAKIVNTLGETYVRQNLEQKVQTNASAGEFIQKRVAELQSKIRAGEQNLLSYSRNNEILSLDPDQNIVVQRLSDLNGK
LNQAEMERINAEAALSAAQQDPMRGVTVASKDARTTSLEQELSTLRLQLEQLKVEFTEEWPAVKEVRRKIAAVENELKGT
RKLSADVQLSDLQRQFREASSRENELRRNFEAQRNAVLNQNEAAINYNIIRQEIATNKTLLDSLLQRARETEVILNGTPN
NVNLVDRAQPPSAPQGPNRSRAVLMAFVASLIGGIGLAFVLNWLDDTVRADDNFELHEGVSVLGMVPGADRRLGNGFVGS
LIRKTQTKLVGENFYSLDRFARPVMVEAFNQIRTSLMLSTAGGPPKSVLVTSGQPFEGKTINSLCLAKSMAELGKKVLLI
DADMRCPKMHLINDLSNTTGLSTLITADYLSDERIDNAIRKEVDYCLDVLPSGPRVPNPANLLGSIEMRSLLDRLGARYS
HIIIDSPPILYFADSVILAANVEAVVIVSRANFSSYEVHSQAKKKIEEVGGNVVGVILNDVPISEYKYHNSYYYRQLEEF
EDEQANNGSLHLE
>gnl|bykdb|A0A3E0PHB0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=856 residues).
MESNDRLLQIPEIQERRSKKSLQTAPQDYPPAYSPFYDDEALGDSRSIREYFNIVYKRLPLILAATIIVTAAVAFYMFRL
SDQYAAAATMIVEPPKPKATDSQSVILNFGYDQNYYNTQLQLMRSEDVMRDVVVKMKLYEKDSLYGGKSRGIFETLGAMF
TGGPKNSEEAGALPVVDSVDGETVDQINLTPEQSQRADKYTAALVNSLVVEKVEGTNLVKLTMNGSDPELIRRVADTLTE
VYKDRSIMLATKTQVEAHKELQNSIEKLKKTIEDGEQNYIGALRESNLPVGDGKGAELSASRLSTVSSQYLTAIDERRKL
EAEYSAAVQAKNPYALSDASGGVLASQLRQTKTERKAKFDEQVRALDEKVKTAESELAKLRVKYTEQHWKVKEAISLIAS
LKEQKNQLEDESKQIIEDESKTLEKAVQKEITSALAAKLNTARRREAQLAAAYEQESAKANQQGQKETMLTTARREIENN
RGILDRLLQREREMELSINTSAPDNIKVSGKAQVNRTGPQRTRNILIALFISLAGGIGLTFLLDYLDDSIKSSDDIGRSL
GLPTLGLIPHQKMMDRGKKQKLLTGGSNGRGPSTEFVALEDNRSGMAEAYRHLRTSLLFSSAGKPPETILVTSSQPSEGK
TTTAINTAITLAQSGAEIVIIDCDLRRPRLHSLFDLENTHGLTNYLSGERNTDNLLKPYPKLPNLKVITSGPIPPNPAEL
LSSNEMKNLLQFLKGKFAHVVIDSPPAISFTDAAIIATLVDGVVLVAMAGKSSVHLMRRFKHRLLNMGARIYGVVLNGLK
PNSVEYGYYGYGYGYDYSNYYQKDDSTPLMEEVAAEELGEGWIEEIDDEDQNGSGK
>gnl|bykdb|A0A3M1PY35 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=742 residues).
MAASEPYRREPPTGGEWDLDALRRVLWQRRWLVAAIALEVLLVGAVVTFLRTPLYEASARLIIEKTMPRVLDSEDVVSAP
VGFFDTERFYQTQYLLMRDPAVLERALDNDGLRELLLASLRPEDEEDLAAWEPPDDGDLVEMLGAGLDVAPLEKSNVVRV
SYRHRDPEIAARIVNAVVRAYRDFFVESGTDARRGASEFLDRRIEDAQAELLELERRLAEERRRLGPVLARGSDEMGSER
LVALDQALTEAKRERAAAEARVEALDGAEPLSIEAVRSDPLVVRLREELASREQRLEELRTRFGPDWPEVRELSRAIAEA
RVRLAERAAAVFEEAVGAARADLELARTREARLQALFQQELAATDALQRRAQDYDRLYREYEQKRQVLDRLLARREEIGI
AKDLRSILERQVSVVAPATPPERPAVPRYRLDLALSALLGLFLGIGAAFAAEARDNKVRSVEQLGELGGLPVLGSVPHVE
GPPRPRLVFSRKRREGASPVVAPGAHSVEEAFRTLRSSLLLSHPGGPPRVLMVTSALPGEGKSTFSANLARTLAAFGDRV
VLLDADLRHPRLHRAFKAPRDRGLANVLAGATGLDDVLFETRYDNLALVPGGPCPPDPATLLDPERVRAVVRALRERHGA
EFVIVDTPPTLVFADAYSIVPAIEGVILVARALRTPKDAVREVCEALRKIKAPLLGAVLNDEAGDDASGSYYRYRHYKRG
YYAKARAAAAEDAGKEKKRSAS
>gnl|bykdb|A0A3M1Q0S9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=763 residues).
MTESSEQREFNLRDYWQIVVRRRWLIVTCVLVATVAALVSSLLATPVYRATCTLAIERTGVRVLRETLSSAEPSWLDYQN
WYNTQYQIMQSDEVLRRAVDLLDLMNTGLPGQDDSRENRFFSAIRKLRTTVVRTLSRTQVPIEEDDPYAPYVKTLRGGLS
VEPIRDSQLVTISFVHPDRVFAARVANALAEAYIRFSLAAKLDIAAQSEAFLVDQVRSLKEDINRRRLELHEYAMRHNIV
TGDANEVSLQNLQDLRNRRVEAEADLEDKRARYQVLTSASPDSIDEVRQHPTIAQLSAEVARLERDYANKRVLLGERHPD
VQQIATELAAGRERLASETERIARQVREAAKIDYEQARRRAEGLRRLYEETEQRVSELQQAFVEYEARKAEIDRKQATLR
ELLDRKNQMTLSASLAEDRALNIRVIEKATPPRMIFKPKKKLNVALGFLFGLFLGIGAAFVMEYVDNTIKTPDDVRDVLQ
LPVLGMIPAQEPATRRERRRSASRGEQAAEIEDPSLISARAPLSPVAEAYRELRTAVLLAMPDHPPRTLAVTSCQPGEGK
TTTAINLATTLAQLGRRVLVVDTDLRRPRCHQILKASTGRGVSTYLTGMSDLPALVQTSDLERVAVIPAGPIPPNPAELL
DSERFRTMVRELEGFEDFDHVIFDSPPVLSVVDPLLIGRQMDGTILVLRSAYTSRDAGRLGVEKLRSGRVPHVLGVVLNA
VHVEHVPYQYRYYRSGYKQAGTDSAQARRGAKGARRTAAGGRG
>gnl|bykdb|A0A3M1S4R8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=822 residues).
MRESRELISTRSAGREELEPRWQSPSYYPSYKSFSEGSAKIFEYWNAIRKRLWLIVGLVVLVTTLTAIYVARQPNVYEAR
ARVQVDLEQGNPQLQVSDRPTLLPNPDPAYFNTQLQLLTSDSLLRRVVKEMNLETNKEFQEERNRQQASTWRAILRSIGL
AREETKKTRDLEEVLAGMNLATAEEINEAVRLAPFVEILKKNLRVDPVRVSQATFKDTRLIEISFQHTNPELAALIVNGI
AEVFVKQNQEKRTGTNKRTNDFLAERIATLQSEIKRDEMRLAELKNNAGILKKDEGQTIVIDRLAGLNKQLLEAENIRKI
AEAEYMAVKDSPEKLRALAEEKLQRFITERENDMRSLNNETAKKIAELEAEKAKLLIEYQESAIEVQEINRKMEALKSTV
EKAQEKNREELEKYRARTAKEILTNLQTRYEQAKAQEDKIRRAFEEQYRKAEGENRAAIDIKLLEQNIETNRGFLKNLIE
QQSSNDVVAQGTTNNISVVDLAIPPDTPVSPRRLLTVMMALFLSTCFGVGLAFFLEYLDDTIKTAEDVENYLGLPVLVVI
PSMNAAQKRRLLLVGSSDNEPAFKNRSELLIYDNSRSSSLSEAYRQLRTSILLSVAGHAPKSLLVTSSLPAEGKTTTAVN
TAITLAQTGAKVLVIDADMRRPRIHSIFNISNREGLSNLLSSEIKRDKVLDSVYFDMSSRLYLLPSGPVPPNPAELIGST
QMSTLMEIFQKEFTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSRQIVRRSCQLIQDVGAKIFGVLLNNVNLSSQ
DNYYYYQSYYYNSYYKKEEEEE
>gnl|bykdb|A0A3M1SIV3 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=829 residues).
MEKDERLLPLPKELEANKNAITYQEEGPRYFASYAYGDDILEKKFNPRDYLLVIHKRLPLIIALVLVITTLTALYMYRQP
SIYQATAILLIEPPKPKIQSKDTININFGYDLNYYNTQEKLLESPELMKEVVVKLGLYRTPDLIIRRNSGITALFKSIFE
SEKDKQEQIVLPVINESDFQKSLDNLEAKLSPEEKEAVEKVTASLLPGVDVVQEERTNLFSINVANSNPELAAILANTIA
EVYIERTIRRETEGMQKSLEDITKSIDQLQENIAELENQRIAQMRESGLPLAEKGQELTAGILRSKSEEWLKAEADRRKL
EQMYEAALQAANRGEIFSIVSRETPNSEFISTLRANIIAKKNSLDARLSEIDNKIKAAESERAALLARYTPENPKVKQIE
ATIQKLQEGKEKIRQEESAQIEQESKQAEERAKKEILTGLAAQLNSARKREAKAKESYLREVEKANQQGQAAMSLTDLTQ
KIETSRSLLNTYVQRQKELESAISSSRPDNVAVSTKASKPDSPIGPPRNRNILISLIVSLFLGIGLAFLLDYLDDSVRDV
DDITRHLNLPTLALIPEAQEKKKVKSLGSEINGNTSAALITLRETSSATAEAFRHLRTSLLFSSAGRPPQTILITSSQPS
EGKTTIAVNTAVALAQAGADVVLIDCDLRRPRIHQHFSLKNSVGLTNYLSGDQELQDLLKSPEGLPKLKIITSGPLPPNP
AELLGSTEMKALLTYLKTNFKHVIIDSPPAISFADAAILSTLVDGVVIVAMAGKSSMHLLKRFKQRLNSIGARIYGVVLN
GISSTSPEYGYYGYYYGYESYKHDYEENK
>gnl|bykdb|A0A3M1VMP2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=737 residues).
MPAMTVPGVGPGGDWDLAAVRKVLWQRRWLVAAIAAEVFLLTALVTFLRTPVYTASARLLIERTTPRVLDTEDVVPMVWN
EYEIQRFYQTQYLLLRDPAVLRDALDRYGVREALAPELTEPGEDGEEPKPPTDDQIAAYIRDNLDTEQLEYSSVVRVSFT
HPSPEIAANVVNAVVDAYRDFFVRTGVDARRGAADFLERAIQEAQAEVLELEAKLAQARRQAPPTVPEREDEPGSTRLSR
LEQTLTEVKAERAAAEARLAAYQEATPSGIPEVNANPQVQRYRQDLAELRRELAELEGKVGPNWPRLVELRAAVKETERN
LENEMEAIYRQALESARAELALRRESEARLQRLIEEEQARAAQLQLATGELEALRSLYKQKREALDRLLARREEVAVTRD
LQSILERQVHVVDRAKPPKSPSAPRVKLNLALGLLLGLLLGVGGAFGAEALDVKLRTASQMREITGLPLLGSIPRASAPP
RPRLVFSRKGRSRSRPVIPEEQMDVEEAFRALRSSILLAQPQHPPRSLLVTSALPGEGKSTIAANLARTLGAFGRKVVLI
DADLRHPRLHRVFRVPSERGLTNLLASHDPADGFVVPTRYANLHLLPGGPCPPDPATLLDPDRFREIVGELDERLGFDFV
VIDSPPVLVFADALNLVPVVEGTLLVARALSTPKDALRQAVDQLAKVNARILGTILNCEVTEDVTGSYYRSYRYRKGYYR
RPAEEEGERASARDAAG
>gnl|bykdb|A0A3M1VZ38 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=748 residues).
MIQQDPQNQEFNLRSYWQILVRRRWLIGTCVLVTTVAAAVSSFLATPIYKATTTISIERRGVRLLNTSLTATEPSWLDYQ
NWYNTQYRIISSDAVLRYAVKQLDLENRPTLLGEQADEEPSPFSLGGLRAKILSVIGRGAPETGEVDPLRPYIKQLRAGL
SVDPVRDSHLVEISFVHPDPRIAAEVANAIAYGYLRFTLDRKTRIAKQSKDWFVERVAELKREVSDLELALQDYAAQHQI
VLGQGEDVTRRNLSNIQERYTQAKIKLAEARARLDTVRSTRPESLQEVLENPVVRELRSRVSALESEYREKLVQLGEKHP
EVQTVKAKLDSSREHLQEQIAAIAASAIDSAQAAFEQARREEQQLAQLLADATREASEADRAMIEYEARSLELERKKATL
NELIAKENEMEQSANLGDTAHNVQIIDEAVPPEIIYRPKKKLNILLGFLLGLCLGIGGAVLAEYIDNTIKSPDDVRDILD
LPLLGMVPAPRPVKKAHGEEPVRCDPAVITAEMPLSPAAEAYRELRTAVLLATPGHPPRDLTVTSCQPGEGKTTTAVNLA
IALAQLGRQVLLVDSDLRRPRCHDVLGVEKDRGVSTFLTGLNDLDPLIQQTRIDRLSLIAAGPVPPNPADLLDSPRFAEL
VETLRERGEFDHVIFDSPPLLSVVDPVLIGRQTEGVVLVIRSGYTSREAGRLGKDKLEKGRATILGAVLNAVETEHVPYQ
YRYYRYAADDESRPRRRGRAARAGGQRT
>gnl|bykdb|A0A3M1WQW8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=749 residues).
MSERDERTHLPAPADTGAMDRNVVTRLYPIGYGHERYGTAVERDVHLLDYWRIIKKRKWIVLGVLMMVVTVVAIRMYRAR
PIYQASGKVIINQQTPVPLANRQEALPYSSNDTQYLRTQINVLQSRTLARRVIEELSLDRQPEFAGLARIRDATLRDKLM
VDRFLSGLRVELIRDTRIVKVTYESPDPQLAAQIVNALMDQLIEYTLMARFESTRQAREWLNKRLTELREKLEQLQEELV
RYSREHEIIQLDENQTIAIERLTDLNRRLVEAEAERIRAETLYRLSQEADVDTLPPVMSNPIVQTLRQRLADDRRRLVKL
QQQYTDEWPEIQSLKGEIAETEQQLAEIEKQILAKIEADYKAARTREENLRAELMAQRAETLRQNERAINLSIKQQQVEA
SAELYRSLLQKMNDVDLLSTLTTTNIQILDRAQVPTTPARPRKLFTTGVSGLVGLLLGIVLALFVEYLDNTVKSTEDVDR
LLGLPSLGVVPALESLERKKRLALPRWSRERRTTKPILILDDQRRSSFAEAFRSLRTSVLLSHAERPPRTILFTSSSPGE
GKTTTAVNTAISLTQTGARVMLIDGDLRKPGLHKMLSINHQPGLSTYLTRGITIDSVIVPNRIDNLWIIPSGPVPPNPSE
LLSSRKMREAVKVLSERYDFVILDSPPVSTPDALILSTMVDGVILVIQCGETPRELVQRAKQSLEDVNAKIFGVVLNRMD
VGQDGYYYYYYRYYYADEDPRDESPMVEG
>gnl|bykdb|A0A3M2BZG9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=801 residues).
MKMIPSSEQPLPRPAVRDDFLAYDAAPATATPVPPMPGDAGELDVAKYLGALQRRWPLILIFCALAAAYSLVRYSLTTKM
YQATAVIQIERRQLATIAMGGATNWLEEWWNLEYYPTQYRLLRSRGMAERVIQNLHLLQDPTFTGRSADLLPGAADATTV
DDDAAELARQAMRLQSGLVVNPIRDTQLVELTYRSDKPELAARIANGYAQAFIDWGIETRTSTVSRASTLLTSQIEELSR
EIEKLRTKLASSAAEANLVLDPDGEAIIERKKSLETTLNRAVIDRLDKQAIWDELRNLTDAEVANSLISSQITQLRSEVD
KLERQYRKALQTFRDDWPSVTKLKEELEGKRAKLTALVSAEVNQRRDLARTAYQEALRKEQNVEEELRKLTDEISAYSSS
ALDYTTAKLELETKQRLFNDLLKKQSEAEVASSFHDAKESNVRVVDYAIVPSAPFRPVLRKDLTTALLLGLLAGVGLILL
IEFFDRTIKSPEELEKITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYGYGYGYGYGYGYGYYGAEGRKRRKLKGASS
DEPEPDRQIELLPHRKPRLAVCEAYRSLRTALLLSSAEELRSVAVTSAEPGEGKTATTTNLGVVMAQLGRSVLIVDCDLR
RPRMHQVFKTSNRLGVVNHLTGTERAEDLVLPTAVPNLYLCPSGPIPPNPSELLASERMRELLATLRSRFDFILLDTPPA
LPVVDAAIIGQLVDGIVICARAGVLVREHARACRERLRYQRIRLLGTVVNRFNPSGASRYARQYYYADYGSDEQLPASTA
A
>gnl|bykdb|A0A3M2D491 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=832 residues).
MNKERDERLLPLPKEIQEYELTSRYYPSYGGSTELVEQRFDPREYLIIIYKRLPMIIALVVIVTSLVAFYMYRQPSIYEA
RAVLLIEPRRPKIQSKDTININFGYDMNYYNTQEKLLESPELIKEAVIKLGLYRNPELFKGQGRGVIASIKSLFSGGSDE
PSKTQSLPVLSENNDEGFSSEEIKLSPEERLRVERITASLAGSVDAIQEERTNLFSVKVVHTNPELAARLANAIVGVYID
RAARREVEGTRKSLEDLTKSIEELKENIAQLEQQRIEEMKSSGLPLAEKGQELAASILEQKSTEWLKAEAERRAIEQQYR
TAVEVAKKGEILSVASDNKFIITAREQQLKLKKDSEARLEDIEGQIEKAEKEKAALLARYTEEHPSVKQIEAQIQQLRET
KEKVKNEVEKKLELESKLLEQRAQKELLTALSAQLNAAKQKEEQARASYLAEVERSNQQGQAGMRLKTLTQAIDTNRELL
NTYIQRQKELELAISSSRPDNISIATEATKPDAPIGPQRNRNILLAFLASLFVGIGLAFLFDYLDDSVRTVDDVTKHLGL
PTLAIIPEATASKKTKLLPAGEKEQSSSVALVTLSSKQSPLAEAFRHLRTSLLFSSAGKPPQTILITSSQPAEGKTTTAI
NTAIALAQSGADVVLIDCDLRRPRIHEHLSLSNKTGLTNYLSGDQSLEGLLKPIPELPNLKVITSGPIPPNPAELLGSDE
MKALLNFLKTNFKHVILDSPPAISFADAAILSTIVDGVVIVAMSGKSSMNLMKRFKQRLISIGARIYGVVLNGVKPSSLE
YSYYGYYYGYYGYYGSSEKDDDVFEEKNGKEG
>gnl|bykdb|A0A3M2D6Y5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=826 residues).
MRKTNELIVREAQENTEVEFRSQPFVSSGNYYSAATRDSAGSLKLREYWNAIRKRLWLIVSIAILVTTLTAIYVARKPNI
YEAKARIQVDLEQNNPQLQVTDRPALLSNPDPAYFNTQLQLLTSDSLLRRVIKEMNLDTNKEFQEEKNQQRASAWRAFLR
SIGLVREERRKEDTKIDEITPGMNLASVEEMNEAIRLAPYVEIIKKKLQVEPVRESRATFKDTRLIEVRFQHTNPELAAL
VVNGIAEIFAKQNQEKRTGTSKRTNDFLSERIASLQAEIKRDEMRLAELKNSAGILKKDEGQTIVIDRLAGLNRQLLEAE
NARKIAEAEYNAVKDSPDRLKALVEEKLQRYITERENDMRALNNEATKRIAELEAEKARLLVEYQESALEVQEINRKIDA
LKRTVEVAQEKNRKDLEEYRSRTAKEILTNLQTKYEQAKAQEDKIRKAFDEQYRRAEGENRAAIDIRLLEQNLETNRGFL
KNLIEQQSSNDVIARGTENNISVVDPAIPPDTPVSPRRLLTVMMAFFLSIVFGVGLSLFLEYLDDSVKTVEDVETYLGLP
ALAVIPTIGVSQRRKLLPVGTGEENGSQGKAGSEILIYNSSNSSLSEAYRQLRTSILLSVAGHAPRSLLVTSSLPSEGKT
TTAVNTAISLAQTGAKVLIVDADMRRPRVHSIFNVQNREGLSNLLSSEIKADKVLDKVQFDSAAKLYILPSGPVPPNPAE
LIGSKSMLNLMEILHNEFTHVVIDSPPIASFTDGVLIASMVDGVIMVVHSGKSSRHVVRRSKQLLQDVGAKIFGVILNKV
DVNSQENYYYYQSYYYSSYYKKEEEK
>gnl|bykdb|A0A3M2D9H8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=616 residues).
MLPRDYLFLAKRWAWLLGVGVLIGLIGGLIYSLVQEPVYQATTKVMVLGAPQSNLSDILNQNTELLSQTFTELLVTRPVL
EAASERLGYYISSSQVRVQQVRGAQLIQIVVEDSDPQKAAEIANTLVTVFLEQNAKIQSNRFSASEESLQAQIQQVEAQI
ADLQKQLAQSSEQSSEKRLQDVTNIISGLQAEINQLQADIVRLESDHETVLGVNALGQPARVTPTLTVDQQIELTQKRSR
LDELKSLLNIYQQIYVNLSFSPASQSSQNGTNNQLQAALVLYQQIYANLLSNYEAIRLARLQSTPEVVQVEEARVPSRPV
RPQTATNVLLGGILGLILAGGIVFLIEYLDDSIRNGETVTKNLDLPVLGYISEMNGKLPREDYPPHVVAQPRSPVTEAFR
SVRTNLEFVEIDRPLKTLLIGSPGPDEGKTTVAVNLAIVMAQGGNRVLLMDTDLRQPQVHERLRLPNRLGLSDILREHST
LDESLHHLTTEGIDVLTSGTLPPNPAEVLSSERMATLLSEVATRYDKVILDGPPFLISDAIVLASRVDGVLLTLRARSTS
QSVTLEVLEQLDRVKARVVGAVLNRVQDSVSNHYYHNLKSYAYIAKESDELTLLED
>gnl|bykdb|A0A3N1JHC1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella sp. GAS466] (length=739 residues).
MRTPAGKLRAIAPAETPGPRLPSAGTLDPFRSSTVYGTPEEQIDYLLLLRRHRFAVMMIFALCLLGGLLYAFFVPKSYKA
QTVLEITGINQDFMNTRDADPYANGVTQDSYLETQIMLLKNEVVADRVAMVMAPRVPPSLASNDAGREGVVRNMVMDAKA
KEEGMSNLIRITLIGPDPHLAADTANELTNQYIQQGQNARLAAASETGVFLTQQLEGAKKKLQESGEALQEYARASGIVL
TSETQEPVAAEHLREIQQGLAQAEVDRANRQSAVEMARNASVDSLPQVADDPTMRDDRAKLTELHRQLAEMSTTMTPSNY
KVQKVESQIKELEEEMQRHRFTIVKRLSVEDDTAARRQQLLKQQYDRQLAVVTDQGSKQVRFNMLKHEVDVNEQVYQSML
QKAKEAGVIAALRAANARVVSPAKASLIPTSPKLSICIFLAVLLGGVFSLLYILISERRDNSVRNPGESEQYVERPELAV
IPRDRLIAKKSKAHPQMRLNGAGSKDVHPILEHWKEADKTFLTETYRSAGASILFSRNGGMAPKVLLVTSPHPRCGKTVT
IANLAISLAEGGRRVLLIDGDLRRPALPQLFGVQNIEGLSNTLDEAECADPNSLIQTTAFPGVSILTSGTTKGNIVRLLH
SSRLASVIGTVRNGFDFVLIDAPPLLGLADARILSKFTDGVIFICRAGQTNTDDLAEARRLLAEDGTYIVGTILNDYDLR
NEKSSHYSSYLTYVGNSSA
>gnl|bykdb|A0A3N1K1G7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella sp. GAS466] (length=750 residues).
MGPKETPPVAGAPDLSPSAFSSTATDTTLSEAIITLRKRRWILIVAVLLGLIYGVYKAETQPKLYEAYGRIQVRSGSSNE
YRVTAVQGYAGDAQSSRMLTEIAILQSDSLMLTVARELNLSNNSEFLEVKGPLPHTNLDDAAVRQSTVHRLQSNLHITLV
PKTDIIRISYSSRSPKLSADVVNKVISTYIQRSFETRFASTQRVSQWLQGQLDDLKQSVETSQEQMMELQKRLGILGFDP
SHNQISSSLEDLSKAAGEARIARIIAESRYRILSGMDPNTIEGSIETTPGTAPGELNTLRAQIAVARASYAQLEATMGPN
HPQAKAQKAQIDELAKEIDAEQSRLLLQAKQNYVIARANEDQTAAVLEAQKTDAYKLRDDLVEYTLRQREFESNRTLYEG
LLQRLRTAGVQAGLESLEIDVVDQALPPANPVLRPQSTIILTMLFVGLIAGIIIAFLMESLDTGLRSIAEIESITELPSL
AIIPRARRSSAEQAGNLTTAQRNISVLTQPKSQFAESFRALRTSLLLSTTGHPPKFILFTSATPSEGKTTTASNLACILA
QADTRVLLIDADLRRPNVHHRFGLNGKVGLTTVLTGATTLEDTVQHIPDAPNLDILPSGPVPPFPTEMLSSEAMNTLLRH
CGEVYTHVVIDSPPILSVTDGVILAREADAVVLVVRHGKSSKHVVRRARDLLLRSGAPITGIVLNAVDLNSPEYYGYYGY
SGYSYSSVDSESWESQAVGDSSRKAGGTER
>gnl|bykdb|A0A3N5M5V0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=776 residues).
MGDLIRREPSSFADPTIRMQRTGNYQWGPDEDSLDVRRYFQILRKRKWLIVAVVTTVLVLVAVQSFTTTPLYRATARIQI
DPESENILPYKDVYEGPERYLSSEVYLQTQLEILQSRALARRVVDRLNLANDPRFEVPVREGLVTSQLGSVKKAMSGLFS
KSDSGAAAANRESMPGMAENRAVIEKVLSRLEVTQVPNSRLVEVGWVSPDPSLASAVSDTLAEEFIEQNLQTKFEANTRA
TAFLKKQLQDMKGNVEKSEGDLYRYARENNILNINDRGSIVLQTLEDLNRQMTTVEGELIGKTAEFQAVRDATPEDFPQS
LRTPSISLLEERLFGLQQNLASLSAQFGNEWPAVVQVRQQIREVEQQLVREKRETIRRAQSEYKVAVNRQQMLRRALQKQ
KAEANQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETGISAGMRTSNIHIVDHAQVPTAPYSPQRAADLALGFGVGLLI
AVGLAFLMEYLDNTLKTPEDMEQSLGLPSLGVIPAISDLPAGGSRLLAEKSTSGADKTELPARIAPTRFRVWEAYRSLRT
SILLSHSGKPPKVIMVTSSIPGEGKTTTVANTGIVLAQTGARTLLIDLDMRKPALAGTFGFTGNQGISSYLSGNADLSSQ
IRQTSYPNLFLLPSGFRPPNPAELIGSERMEAGLRLLGDYFKYILIDTPPLLSVTDGLLLSPHVDGVVLVIKGGSTPKET
VKKASNHLMSVGARVLGAMINNVDMDTPEYTYYYRDYYDDRYNSDLSSAAGSPGAV
>gnl|bykdb|A0A3N5PCI5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=748 residues).
MSDTQQPPSEHDAVTSRAEPQWQLEDVFAVLYKRRWIALFTFLIAAAGVVTYTMSVTPIYEAHTQLLLQQRASIVTFEGA
ADPQANERGYLETQHRLLRSRSLARRVIDALNLWDLGRAPADGNAQPAGTFAFLGQWRSWLGRAVGAATGATSSQEKEPG
SVRETVAESIAIDRLLANLRILPVRDTRIIEVRYESPDPELAARVVNTLATTYITHNLEVQSQASKEATTWLAEQLAEQR
RKVEVSELALQKYRERENSLSLEAGQNIVVQRLNSLNASVTQAKTDLIAVESLYRQLAASQRDQGALDTFPLIRSNGVVQ
EIRGRLANLQRERMQLASNLGAKHPEMVRVNSAIEAAERELDSEVAKTVESVRQEYLAALSREKELTAELDAQKSRALAL
NRQGIEYGVLLREVESNRQIYQNLLQRSNETAVSKDIQGPDIQVVDAAEVPRRPVRPDTRSTLMIGLLLSGILAVAIAFI
REAFDSRLQTPSAVRALGIPFLGMLPYVGKRALKGRSLLLTHGVPAPYAEACRALRTNVLASAGGGTTGRSLLVTSAAPG
DGKSIVAVNLAVALGRSGGRVLVIDADLRRPVLHQVLECEQRPGLAEVLTGKRKPSEAIVATRSPGVWLLPSGAGIASPS
EQLGSRRFSEFLARVGESFDWVIIDSPPVMAVTDPSVMAHLASGVLFVVNARHTKQRVAQAALDQLETAGATFAGAVLNA
VTLDRDHYYNSRYYLPFYGDYLTDKRSA
>gnl|bykdb|A0A3N5XQP8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=828 residues).
MADLAKQSRQGMQERGGGPRLFEPSPSSRDRSTVRFYWEAIIKYRRFVLLVLFLVVALVALETFTATPLYRASVRVEVDA
EPAKVLPYQEIYQVAMDPRSMESDLRTQYSILQSRTMARGVIKRLNLTNERLLQLREKSGVISETLRQVMRAVRGVIDRL
IDEGGPGGQNDPTEYMIDRLLSDLQINPVLESRLMDVSFSSPSPKFAAMVANAWVEEYIEQNFQSKLKTTEMATKFLAEE
LKELRVKVEQSERDLNDYARTKGIFTTEGSQNEVTQKLNDLNTEITRAQANLIAEQSQYDQARAASATRVPTNLRSSVTE
QIEARLSALRQDYARLTSQFGPEWPEVIQAQRQITQGEQELKQERERALEEAQGRYRASLQQYSQLSRVMDRQRQLAYRL
NSDLVQFNTLKREADTNRQLYEGLLARLKQAGVEAGFRSNNIQIVDRARTPLNTWWPRRTMNLALAFLGGLFLGLGLAVT
LHLLDNRVHSPEDVLALHIPALGIVPKSQELTNGANPLVLALPEQVQADHRSASDQDRMGSALARSAALDSPMWEAYRRL
RTCLLLSHPDQPPVRILIASAMPGEGKTTTAAYTGVVLAETGAPTVLIDLDLRRAGLTGLFEIENKWGMSVYLSGHSDLE
QEIQPTGVPNLSILPAGLRPPNPAALLSSKRLPNALERLTKQFRFIVIDTGPLLCYTDALIISTVVDGVVLVGRADQTPI
RNLKLASEQLTGVGANLLGVLVNGLDVTEFGYGAYGGYYPYGDQHRTHSWTRFFTDWARVQTLWNRMRVRNGSSNGTRVA
PRKASRSRGSKARSQNERPSESGPDLTL
>gnl|bykdb|A0A3N5YNR8 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=772 residues).
MGDLIRREYSSIPDPSIRIQRNTEYQWASDDDSLDIRRYFQVLLKRKWLIGLVVGAVLLLVGLQSFTTTPLYRATARVQI
DPESASILPYQPLNESAERYLSSEIYLQTQLEILQSRALARRVVDRLNLANDPRFSVPVREGVVTSQLSWLKRTVSNLRP
GRSDAPKTGADESGAGRDKNRDVLDTFRDRLEVAQVPNSRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNLQTKFEANTRA
TEFLKKQLQDMKGKVEKSEQELVQYARENNIVNIGPDRGSIVLQTLEDLNRQMTTVEGELIGKTADYQAVRDATPENFPQ
SLRTPSISLLEERLFGLQQNLASLSAQFGSEWPAVIQVRQQIQEVEKQLQREKKETINRVQSEYRVAVNRRQMLLGALNR
QKSEANQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETGISAGMRASNIHVVDHAEVPETPYSPQRAGDLALGLGVGLF
LAIGLAFLMEYLDNTLKTPEDMEQSLGLPSLGVIPAMADLPAGSSRLLASRNESGDSKTGLPAPISPARFRVWEAYRSLR
TSILLSHSGKPPKVIMVTSSVPGEGKTTTVANTGIVLAQTGARTLLIDLDMRKPALASTFGYNGNQGISAYLSGNGDLSS
QIRQTNYPNLFLLPAGFRPPNPAELIGSERMESALRLLGDYFKYILIDTPPILSVTDGLLLSPHVDGVVMVIKGGSTPKE
AARKAGNHLSSVGARILGALINNVDMNAPEYSYYYRHYFDERYNTDLSSAAG
>gnl|bykdb|A0A3N6A5T6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacteria bacterium] (length=794 residues).
MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVEVPHLRDYWNVVLKRKWLVLTVLVTVVVGTAVQTMTTTKVYRSTA
RVRIDPESTNILPYEDVYQAADQGIAMETYLQTQFKILQGRTLAERIVKQLQLHENPSFNAETSGGLLTDSLAGLIGGTI
ALLKGRQPETPDSAENRLDKDEADLSADVDRFLGSLQVQPIRGSRLVEVSYASHDARLAATIVNTLADQFIEMNFESRYQ
ATTKATEFLQKQMHELKVKVEKSEEQLVAYARAHNILSLAGSSSKEGDRSQNIIMQKLADLNQEMTKVEAQMIERSAEFD
AVKNATVQDFPDALVTDNIRQLETTLADLEQKLANMTSHYGPVWPEVVQLKREVNEVNTQLVREKKRAIQRARAQYQVAV
DRRNRLQTALVAQKEMADQLNENSIQYNILQREVETNKQLYEGLLQRLKEAGVAAGLKSSNINVVDRGETPRRVYRPRTA
INLALGLILGLMLGVSMAFFIDYLDNTIKTPDDIEKTLDLPSLGVIPAFKMFETPVGTRLLTAASTQSTDASVDAVLQGS
QDMRSRVWEAYRSLRTSLLLSNSGKPPQIILVTSALPAEGKTTTALNAAIVLAQTSARTLLIDLDMRRPKIGSHFGLNGH
QGMSYFLTGNSDLTSQVRKTSVPNLFVVSAGYVPPNPAELIGSDRMDKALKLLRDYFQYVVIDSPPILSVTDALVLSPKV
DGVVMVVRGGETPREAVRRASEHLNQVGAKILGVMINDVDIRKSEYRYYYKYYYDSKYYSGYGYGGDKEDAGKS
>gnl|bykdb|A0A3P0X3W6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. EB88] (length=730 residues).
MSSVYNNKPRILPASAPPSQIAHYTGPQAAAEPDELLPMQHYMWLLRRAWWKIALFVVTCTALTAVACFLMTPVYEATVR
LAVDSKVPASVIGQDSATPNISDVEEFLTTEIDLLQSDAVLRPVAKAYHLLPRDKKGKEFLPAGSVTLPGLTITHPASSL
LLKITYRSKDPRKAADVANAVAHSYIDEAMDMRLHSSMNLSGFMAKQLDDLKANMDKSAEALTTYQRQLGVIDPEQQTSI
LSARVAQLNSEYTEAENDRIRKQTAYQGVKSGNASAIDISTQAEQLTRLQQQMQDAEQAMAIVQTHYGPNNANYKVAANT
LAEVTREYQAARDNTGRRIQTDFAQADTREKMLAATLAAAKAQSDALSLKSLEYQQLKRDADANKTLYNELFQKIKEAGI
NSGFQNSSIRIADEARPQNAPVFPKKGIFIFIGFFLSGVIAVAATLLSDMMDKSVRDPEQARRSLQVEVLGILPDVLQLK
PAGRQLLLKSGSDVPAPVAGKQPLDWSRTQDAYTEAIRTMRSLVLLERTREKLRSVQVTSAVAGEGKSTCTAHLAIAHAM
QGRKTLLIDADLRRPSQHNHFSLPNEEGLADVIMDGRSLADVLHTIEGIENLHVVTAGASAMRAAHLVGNKMAALLTDAE
QDYDLVLIDTPPMLGLAEPIQIACSVDGVLLITQAGETNQDAVAAAIGTLNRLDVRILGLVLNKVRREMSSTYQHFGVYG
QYDERVLNAS
>gnl|bykdb|A0A3P0XH15 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidipila sp. EB88] (length=751 residues).
MEGPAVQPERQVAAGPQLAPEQAIITPSDIRKILIKRKWLILAGIVVGLAFAAVYILTTIPQYEAIALIDINEGQQSNIG
ISELVQQEQGGIEADLTRTATEIAIMQSDTVSLDVINSLDLYHKQPFAQVFVRQPYNGKLTPNQRIEMLSIFKGSTKIAT
KPGTQLVEVRFRNQSPAVAASVSNAIVDRYMDRSRRARYEGTTRISEWLAKQLEPLKNQVTESQDALSTYQKQNNLIGVD
SNGSGQDLTIEDMRVANQQLSEAQADRVVKEARYRMAMTRNPELLLSVAPSATLSQLQQQAAALTVQQAQLQSKFGPEWP
RVKEVQGSLVQVRKAIDVEINNMQQRFQVEYETALSTENLMRKRLEDAKQQAYQQNRSSAEYQILRHGADSASDLYDALQ
TRLKEAGITAGLNATQIDIVDRAVTPALPVFPVKRNDAAIGLAAGLVLGLALALFAETIDDTIRTSDDAESVVGLPSLAV
IPHFEPAQKKGVSAAGTAAAEAERERMARVSPDLISYTEPQSYVSEGFRTLRSSILLSAVDREPKLILLTSSFATEGKST
CAANLAISFARRSARVLLVDTDLRKGTLHMKFRTSNRFGLSTLLVRENEESSYENPLPDLPNLTLVTRGPVTVNPGEALA
SRSMEELLQRWRSEYDHIILDSSPVLAVADTLSIAPQVDACFILVRSGVTRKKALLRTREQMRRVNSRVQGIIVNDVDLR
LENYYTYSKRYNYSYNSTYGAGYGGGMDAEQ
>gnl|bykdb|A0A3R9WF43 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Edaphobacter aggregans] (length=771 residues).
MDRSPPKVSITKKEHRSFLAEMQTRAHLAPVNASEYESLSGLLRVLRRRWRSAVLVAVVIALLGTVAVLLMTPRYSATAT
IEVNREDHEEASGPRTDTPSDSADDLKAEVQTDTSILQSDGLVLRVIKDLDLAKKRPFLGAIVRGEADKPLEDAPRTRER
MVKLFRKNLKVDSPPDTRLINVTFENPDPTVAALAANSLAKTFIDDYLERRHRSTSQASYWLQKELDDLKKQVRDSEQRL
ADYERTTGLAGVQVSGSTSGDGTSSVSVNSHNTVLDRLFTLNQEMTSAEANRISSEAVYHLVKTQNPEVVLGLGSMSIAS
GNGSSSGALTADGGVDLLRSLRTQEASLRREYASYATKYGEKNPRLLQLQEQINAVDAQMQTEMARITKRAENAYQYAKD
NENSIKGQFEKQQHEAIQLADNTVQLQVLAQEAYSNRALYQNLFSKLQEASLSSGVRATRIDVVNEARPAGTPSSPDYPK
YLTLVAGIGIFLGISSAFVRESLDESIRTPLDIEAASHLSILAYIPTKSRAETVTAGTVGECALITNPYSPFSESFRTLR
TSILHSHSVTRLQTLLVTSPHGGDGKTTVAYNLAVAFAQQGSRVVLLDADLRNPDLHRLFGCENSPGLGDVSAADTHIEV
SNLIQHSSIKTLYILPAGNRPDLPSEFFSSATFDAVLEMCTNRFDYVVIDSPPILRVTDATIIAKKVDGIITVLRSQATT
RSMASSVAQILIRTHAPALGFVLNGVHNPSLDGFHDYSYLREKGSETHADA
>gnl|bykdb|A0A428MDU2 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Edaphobacter aggregans] (length=749 residues).
MGLENPQQPGPGAPETNPTGFSTTVTDTTLSEALITLRKRRWILITSVVLGIAYGVYKAETQPKLFEAFGRIEVRSGSSN
EYRVSAVQGYASDTAASKMLTEVAILQSDSLMLTVAREMDLSNNPEFLEVKGPVSHTTLDDAGVRQSTVHRLQSNLHITL
VPKTDIIRISYTCLSAKLSADIVNTVIATYVHRSYQTRFDSTQRVSQWLSGQLDDLKQQVQTSQERMMDLQRRLGMLGFD
PSHNQISTSLEDLSKAAGDARIARIVAESRYRMLAGMDPNTMEGSIETTPGTAPGELNLLRGQVASAKANYAQMESTLGP
NHPQAQALKAQIDELEKEIDAEQKRLLLQAKQNYVVARTNEDQTSAALEKQKSDAYKLRDDLVEYTVRQRDFESNRTLYE
GLLQRLRTAGVQAGLESLEIDVVDQALPPASPMLRPQSTIIMTSFVFGLLGGIVLAFLMESLDTGLRSVAEIESITELPS
LAVIPRSRRAGVSEAAMSTAQRNISVLTQPKSQFAEAFRSLRTALLLSSAGHPPKFILFTSATPSEGKTTTASNLACILA
QRDARVLLIDADLRRPNVHHRFGLNGKVGLTTLLTGASKLKDTVQNIPNVPNLDILPSGPVPPFPSEMLSSEAMDAFLNH
CGDLYTHIVIDSPPILSVTDGVILARRADAVVLVIRHGKSSKHVVRRARDMLLRSGAPITGIVLNAVDLSSPEYYGYYGY
SGYSYSSVDSESWESQTVSASSNGAGGRV
>gnl|bykdb|C1F294 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Acidobacterium capsulatum] (length=759 residues).
MDTLDPQRQSGSAIASADEKTVAPQSTINLSDLRKLFLKRKWIILICVLAGIGVALYHVETATPQYEAVSSVSIDMNKST
GVELTSLASSSGGLQSQDRVETQLHIMQSNTIAWNVIKTLKLYNKPPYSGVFKKAGYHGTVTPSQKLALLNTFKGATQVV
LVPETDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLSQQIISLRESVNKSQNDLVQYQREHNLLSV
GQQGSSLVDANLETINSQLAQAEADRIVKEARYKMALTRNPDLLVSVAPNTVLTSLRSQEANLLVQQADLQSRFGPRYPK
LEEVRQQLKQVRSDINKEITNLTQRFKAEYDAAVQTQNLLEARLENTKQQAFKQNESSAQFEILKHKAQTSSELYDALQL
RLEEAGITAGLNSNSLEVVDHANLPVIPVTPQKKRTVVFGFLGGLIAGIAISLLLESLDDTLRTSEEVESIGHLPALAIV
PRFVSGAKRKTAYGSYGAEKRPKEPVAEKEDQISRDLLTLLEPQSIVAEGFRTLRSSILLSSVDREPKAILLTSGLAAEG
KSTCAANLAISFAQRPARVLLVDTDLRKGTQHLKFRVSNRVGLSTYLSRESGEESIVFPLPELPNLGVLPRGPVAPNPGE
MLASRMMADTIQKWRSEWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTRELLRRANARILGSVVNGV
DMRLENYYTYSRGYSYGYRSGYESAYGAGYGVEDTDDKG
>gnl|bykdb|E8UZE1 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus saanensis] (length=732 residues).
MKNPGIPDEVAARSSFSAVGLPEIYRLLKRRKWLVLLIFLVFVAASALYTLRLPKRYEALCKIDIDLSTPKSVLALDSQS
TASVATEQKMATQLSILESQSIAWKVIEELKLDANPVFSGITSSATPKPLNSLTDQERYSLIRRFQSGLGVQLERGTEIV
QIRYKSTNPALAATIANTVAAKYIQRNFETKYNTTHETSAWLQDQLETLRHQVDADQKNFEEFQERTGLLQTGEGHNAIV
DRLSQLNSDLSKAQADRIMKEVTFRESMVSDADQIVPTTTFPGLTSLRAQKITLESQYASLSSKYGDSYPRVAQIKSELA
EVNRTITTELRRGRNQLELEYKLASENENKLRAATEAQKQQIFSMNEDALHYSILQGQVASGRALYQDLTRKLQEAQITS
GLSSDTISVIDPALTPNIPSEPRRALNMEAGALLGLVVAFAVVFLIENANATIRTGEDIYRYSGLPLLSIVPHLSPAQRN
MKLGKKEVAGTADSLGLEPRVLQFPQSHFAESFRVLRSALLLSHAGNPPQLIVICSAWTKEGKSTITINLATVLAQMNRK
VLLVDADLRRPSLHHKLGLPKTEKGLSNLLAVSQSPPLVEYLHPAAVFPGLDFLPAGPLPPSSSELLMSPRMSELFEEWR
KAYDFIVVDTAPLLAVSDTTALVATADTTVVVVRDDATRKQSLQAVRDTIVSVRGRVAGVVLNDVKTSSEAYYAYYGNQD
GGAAYYAEAENA
>gnl|bykdb|E8WVF6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella tundricola] (length=753 residues).
MSSDNPYSNPGPGMSQAQQPTFVAPSNDTTLSEALITLRKRRMVLIIAVVLGTLFGFYKSVTQIKPYEAYGRLEVNTGAS
NQFKLSPFSGLGDDPQQKMMSEIAIITSDTLLTTVAKEMNLANNPTFLSVKGPIPHSSMEDPRVRQTIVGILQKNLKVTL
VPKTDIIRIAYSSLDPKLSADVVNKVIADYQQRSYETRFDSTKRVSQWLSGQLDDLKRQVETSQEQVLDLGKKLGTLGFD
STHNQIASSLEDLAKASGTAKLARIIAESRYRMLNGMDPNAIEGSIDAGTTATTGGATNGLANLRSNLATARATYAELTA
TLGPNHPQVKAARAQIDEFQHAVEAEQNRLLTQAKETYLIAKANETQTTAALEAEKQDAYSLRDAQVEYTLRLREFESNR
TLYEGLLQKLRTAGVEAGLESSEIDIIDQAVPPSDPQSTPQSTIILTYFAVSLVLGTLLAFLLESLDTGLRSVAEIEAIT
ELPSLSIIPRARRATPEQLAAMSTVERNINVLTQPKSQFTEAFRSLRTALLLASTGKEPRLLLFTSATPSEGKTTAASNL
AVILAQGGTRTLLIDADLRRPNVHHRFGLNGKLGLSTILSGQTTLENSVQTLKEVPTLDILASGPVPPFPTEMLSSASMA
ELIRHASEIYTHIVIDSPPILSVTDGIILSRQVDVCVLVVRHGKSSKHVVRRARDLLVRSGAPIAGIVLNAVDLNSPEYY
GYYGYSGYSYSSLDTAGWDAKSESGKTRKRDDR
>gnl|bykdb|G2LEI9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Chloracidobacterium thermophilum] (length=863 residues).
MPQEHPNNNVMLAPTAAELDLATPTVQDRMRRRGSYQYTLPQEDAGQPIRQAFLTILRYKFTVILCVVLTMTVTGLALSR
MQPVYEASSHIEVAPEKELYSSSGRIAFVPYSVDPDYLNTQIRKISSPSLLVEVVKTLKLDRDPKFLATGPTTLSAALLD
LIRSPRGPRKPPQSETKSAELPEASPTPATTEDELQRYAPQIGRLASGLQAYNVPRTRLVRITFQHHDPETTKAVVNTVA
EVFARRNVSDRLQQGSSQKEFLSSTAARLQQEILEEERKLTEYLRTRKIVSLKPEDNPEVARLTGLNQALLEAEKERLRA
EERYQASLTQPIDSLDEMQSDPELQKLRGKISELKQRRLELLGTYTELHPDVVQIDQVLAQAENELKEAKANTLVRIKTA
YENAKRREEELRARVEKQRNEVVTQNGDGVMQRMMQDNIDNKKKMLQALQATTKDTEINLRMDLNNITVVDRAGTPGAPI
SPRVSYTLSVAFFLSLFGGVGLAFAREYLNTRIKSVEDVDRLLNLPTLGLIPQVSPKELSKSSGYYSYGGETRALAKLAD
GRPLPADFNVGLSAFALSASPIGEAYRQLRTSILLSSSEDVRNRIILITSSQPGEGKTTTSFNTAISLAQTGASVLLIDC
DLRRPQLQKLFDSYGQERTFQPGLSRYLSGQCKIGEIFTPSPIPYLTLITCGQMPPNPAELLGSQRMRSLLAYAVEKFDY
VILDTPPMLSFADATILAAMADSVILVVNCQRSKREIVKRTCRKLDETNTRVLGVVLNGMTQEQSSYYGYDYYGYSSYYR
YSQAVTVNGDGKASGPKPPPSASEVFEQLKVALDEQQAADDRVPPAPDASPAGNSSNNGHKAG
>gnl|bykdb|G8P085 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=740 residues).
MRVQTTQPDTEGKLDQRSLTEADSASALSLGDIAQMLGRHKWFILACIVIGTVVAVVYVKSVTPIYEATASIRIDPGRIG
SLGLADLTGTQADSAELIATEMAIIKSDAVAIDTMHSLSDEEFREYAGPNAKQLAIPLGAISLSPAQEEMLSHFKSQINV
LQVPSTQLVTISFRNPNPQVAALLANRLIEAYLRQTFDSRYGSVTQVTKWLSSEMDSLRERAAEAQKKLADFQEKNNILM
LGGGSSGSSKDGGGESPSPSASTVTDRLTQLNNRLTVAQGDRIVKEAQMRAAENGNTAVLAAMFPSANLAALQSQQATLY
GQYVQLSTKFGQNYPPLAQVKDQMQKTDAELERQSSIVKNRLKQEYDTAVAIQSSLQQQYDEQTDKAYALNRKAAEFAVL
YAEGSSSRELYNTLQYKLQQAGVDAGLQSVNTMRVDTARAPLIPVEPKKLVILSFGLVLGLFAGVGSAFLREALSDKLQS
VDQIERALGYQLLAIIPHISIAQRTDNKGDAPAFDASQMLVAYNSPLSVNAEAFRNLRNALLLSSIDRPAKMLLVSSTIP
GEGKSSTTANYGVVLAQKGARVLLVDADLRRPALHSKFGVENKRGLSNLILGDDTAEPFTNPLPDLDNLFLLTAGKKVAL
PSEALGSNKFYSLLQQWEQEFDYIIVDSAPLLIVSDSLPLASWADALILVTRYNMTPLGALKRIRDVLRHTNAQVAGVVI
NDMAVTQTGYYGGYGSGYYN
>gnl|bykdb|G8P0Y7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Granulicella mallensis] (length=779 residues).
MSTGRMRGEFAEPVRHDSPRLASLQEMYRPPAREHSISDYWHILLKRKWIVIVSVAIVLITTALISLHTTPIYEAVTKIT
ISPPTSNPLNFKDNNSSSSALEDPQAGINTQVKILQSDTMAELVIHRMNLDTRADFAGRAQTQSNGGIAVSQSPAEESFR
LESLIRKLQGNLTIQQIPDTTLVQVGYSDPSPALAAEIANGITAAYIEQNVKSRYDSTMQAADWLSKQLADMQIKMETAQ
AKLVQYQKEHAIVGTDDKQNLTTEKLDELNRELTSAQADRIQKESLYNVAKRGDPSTLSVILQDPILSALRQRQSELQTR
YAQLDTWAGQSYPQMREITSQLDQLNKSINEQVKNSVSRIHNDYQTAVNREQMLQEALGEQMGIADQLNQNAIEYKILKQ
EADSNRQIYDGLLQQLKEASLAAGLTSSNTRVVDRARLPRYPTKPNIPRNLEFALLVGLVVGIALAFGLEALDATVRTPE
QAETTSGLPVLGVIPMQPVFDKAGTNAARSRLLNKMPGTGTGPQPLISYLEPRSEIAEAYRALRTSILLSSVSHPPRSIL
VTSSVPEDGKTMTSINIAIVMAQQEKRILLVDADMRRPSVHTAFKIKGHVGLSNVLTGGAKVRDAIQSTVQPNLFVLPAG
LVPPHPSELLSSSLMRDLLKKWCEEYDHVIIDSPPVITVTDAVLLSVETDAVLLIIRSGQTTAAHVRHTCGLLHSVNADV
LGVVVNAADLGSPDYYHYGGRSGYYAANKMKSQEMKPGEARDLDQNPESEHDETLHTSS
>gnl|bykdb|I3ZEU5 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Terriglobus roseus] (length=753 residues).
MPPATNQPVPTDPASPTGFTTTSADSALSEALAVIRKRKWILVACAVIAILYGYYTASTQPIIYTATGRIQIHEANSAAT
QLMGSVGSQETNLENELGIITSDSLLLNVARNMNLINNPDFMGIRVGKVRDINDPAVRTDVLQRLGNSVNASIIPRTAMI
KITCTASRPQLAADIVNQVINAYQQRSFETRFESTKRVSQWLSGQLDDLRQQVETSQEQLIDLQKRLGVLGLGFDATKPP
TTQLAVSVDALSTASVSAKVQRILAESRYRVLASSDPDLLESNLDVAGGQSELSKLRSDAAETQASIAELSITLGAKNPK
IIALRAHQREVQREVQAEENRLLTEAKQALVAARANEDQTTSALEQQKQESYRLRDDLVEYTLRQRDYEANRTLYESLLS
KLRAASIQAGLDSLEIDIVDQALKPAGPSMTPRSTILLRTVLIGLVAGLMIAFTMESLDTGIRSVAEVEQITQLPSLAVI
PKVRRLSSDTGSMSVAQSNIGVLATSKSQFSEAFRSLRTSLLLATTGHPPKIILISSSTPGEGKTTVATNLAAILAQRET
RVLLIDADLRRPNVHHRFGLNGRVGLSTVLSGGSTLEEATKNVAEIPNLDVLCSGPVPPFPTEMLSSEAMHDLLLHCCTL
YTHVVVDSPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDLLSRSGANVTGVLLNSVDITAPEYHGYYGYSGYS
YSNIDSESWESGSTGTGDGGPRNSAAGQGEDKA
>gnl|bykdb|Q01X01 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacter usitatus] (length=559 residues).
MECARTLYRRKATVLWITFFAVIAAALISVAQPRMYESQASIQVQGVNENFLNLRDIFPTAAPSADSAVYVQTQAEMLQQ
DALLERVVKKLRLEDRPEYQRSSSLWDRLRPGTSQAPVTRTAVDEVRKNLQIISSRGTSIIRIVAEAREPQLAADLANTL
AQTFIEQSIEARQRSAQQTFASLSGDLKEIRNRALQTESDLNAYGRGKRAAGRAEGDGNREFYDAMARRANEASVASTLR
QSNVRLVDPAQPATHHHKPNVPLNLLFGLFGGLALATGYVMLQEQTNSALRSPGDAGAYLTLPELGAIPRAAKRKFAVLG
FLSESNGKSQVERASLEQPASHVSESFRATLASILSSSHNGDHPHVLVVTSSRPMEGKTTVVSNLGIALAEIGNRVLLID
GDLRRPRLHKVFDQANSWGLSDLLREKNAIEDLPLDVLVKKTAVPRLSLLPSGTGTDNIFGLLCSGRMARLLPRFRQEFD
YVIVDAPPCLEFADARIISRYTERLLLVVRADYTDRKTAQAAVQRLLLDGISVMGVIFNYWDPTVNDLYSYAQYHQDIA
>gnl|bykdb|Q01XL7 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Solibacter usitatus] (length=772 residues).
MNDHYEPESNGSGPHGLPVGPDVRMLPSPSDGWVPEPTKISYWKIAWGHKFILLLCIFAGALGGTAYVILKTPEYAAAST
VELIGFNQSFMNMSQVDPQAGTDMTTASASNIQTQTRILTSRSMLARVAERMSLEMTPIASTPTTFFTKLRAHIPFAQKE
PLEQMKEAVRTAAFTVSARGVGATRLIELRCQSPSPEVAANFLNTLAAEHISQNLAIRSSATQRTSQWMDSQMEEAKSRL
QTAGEKLRDFVRQSGMDFFPEQSTLADSKMKVLQGDLAAIQADRIAKQARWEMAKNTPIDSLPDVLSDPTLLGLKSRIVD
LRREMAQLTATLTPEHYKVQKIQAQISELQQTLDKEKTGLLKRLDNDYQEALRREKLLSGAYNAQTHAVGAQADKASQYA
MLKRDAEMAQQVYNGLLQQANQAALIALVPASNIRVVDAAVADNIPSSPTPMRDIPTWSLFGGALCYGLLWFREVLRRKR
LTQLFESPGHTRTILGVPELGVIPSATIDRPKKLAAAQRALNGATSIHPLGTLVEDGQKTLEFATWQNKSSILAESFRQT
LTSILRAQPKGECPVYVITSGGPGEGKTTLSANLAIAMAMIGQRVLLIDADLRRARLHSVFGLDNCPGLSDLLTSTESLE
EADLAPYLSPTKVDNLRVMTHGLAQVGTPATLFFSPRVKELVKKLRGQFDYILLDTAPVLLFPDARLWGRHSDGVVLVVR
AGVTTREGATSACQRFAEDGIAVLGTILNDWTPKEGSPSHYYYHSYEAYGQK
>gnl|bykdb|Q1IJZ6 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Koribacter versatilis] (length=774 residues).
MDSLFRKSELPPLGVSEQSTTNAGLEDEDLSLRQVIRILRKRKNLILGAAGACLACALLLSFVMRSYYNSSATIEIQKDQ
DASLGSALDTLASTVGGGSGDTKTEVQTQVAILQSDDLAIETIERTGFEKHIGSYWHLFPSGRVTSEQGLPLRNAPRQRE
AMLKKFGKALTVTPIPDTRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVLTRRNASTTQASEWMSAQIKDLNQQVEAAQQK
LINYEKESGLIAITATDPKNPAAAPVLHIPALDRLTALNQDLVTAEASRVTREALYRLARSGDLDRLTSLGAESLTSPTD
QAQAAMFTNLQALRQRQSQLKQQMASAVQIYGARNPHLVDVDKQLSDVDSQIKGELKLIVDRTELDLELARQSEDALRQA
YEKQEQEANKINDSQIRLAVLQQEADSTRQLYETLYGRLEVSKLDEGIKSTNVAVISAGLPPAKPSHPDPLVNGIVGLGG
GLFVGLILAFVVETLDDSVATTTDAEELTGIAVLGVIPIVNENPRVLRAAGRAKANGSNGSKPGRPTAMVYEQAMATEAF
RSLRTTLLLSQAGSAPKSLLLTSSLPGEGKSTTTYGLGRCFGSLGTRVLLIDADLRRPTLHKHAMKENDRGLSNLLTSVA
EPSDFIQKDSSAPNLDILCAGPIPPNPAELLASNVFSDLLKRVVLEYDLVLIDSPPAMLVSDAAIISSRVDGVVLVARAG
IITRAALGKAVEVLRRNKAPLRGLVLNAVNTKGTDYYYSHGYYGYDSYGSNGNA
>gnl|bykdb|Q1ILD9 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Koribacter versatilis] (length=756 residues).
MSATNLATRKDLLPQNGKGARWQPSESDGQKIDFDGLFRIIVRRRKLLAAGVLLGILLATAYCILKTRRYEGEATVYVHP
EGSDVLGSMPDLGLSSGMDWNSQLATQIKILQSDALAWDVVKRLRLDQKPPFAGDKLYTEGSGTWYSHHGLRSLPNEPLS
NIGNARRQQLLARFQLGLDVTEVPRTGIVQLRFRSSDPELAAAVVNELAEAYTEHNFQVAYESTIKASDWLAKQLVELKT
GIQSSEQQIADYQKTHKIIGTDENNNLTLATLDDVSKQYTDAQADRIMKEAKYRLAKSGNPELIGMLVPDSVLPVLRTQE
ADIQNQLSQATAIYGPNYPRVVELKKQLAQVNASLAKETRDIEARFSSEYEASLNTENKIKGNFDQHQQEALSKSQNFSE
YSRLRREVDTSRDIYDDLLRKLREAGVMASLKAANIDVVDAAPVPIKPVEPAMKLAMALGLIGGLFMGFAGVVVAEAVDQ
SLKTPDDVELITSLPVIGVIPNTAVGRSSNGRPGRTAVKQEAMGIDVLTRPNSQFSESFRTLRTSIMLSFPSRPPKSLVV
TSALPGEGKSTISMNVAGTLVQRGARVLLVDADMRRGRLASRAGAQEGDGLTECLSGLRRWTDVVQDASGIAGLRILSAG
VRPPNPAELLSSDKLKEMLEEWQKNFDHVIFDAPPALVVTDAVVLALLCDAVLLVARSGVTHRSALRRSYEMLLHDGIRV
AGVILNMYNPAGDYGYYGSNYYSYYHEGEGVKADRD
>gnl|bykdb|Q1ITG0 [Bacteria] Bacterial tyrosine kinase [Acidobacteria][Koribacter versatilis] (length=743 residues).
MEKFSQIENVQGASRTSWADVQEDREADLLHVLYVLRRHLQMIIGVTAFGVLVAILFCLFMKPRYEGMADLNVHPEESAA
LDMGALGDLATGAGGLDWSSKLETQARILKSDTLAWDVISQLRLDQNEAFATKSLFGRSLQTPVGKDVSSVDEARKSKLL
TRFSKALRVEAVPKTQVIEIRFRSTDPALAAKVVNTLTSSYMHHNFMTRFEATMQASAWLQQRLTELKNNVEESQRKLAE
YQSKANIIGTDETDNLAVSDLTDVSKQLTDAESDRIMKEAKYRLAQTGNPELIGTILPDSVLPVLRSQEADLRNQLAQYS
TKFGSNYPKVIQLNNQLAQTDASLKKEIRDIEERFRTEYESAKRTEDQLRASVENRKKEAFSQSAKFSQYDILKNEVASG
RSLYEDLLRKLNEAGIAAGLKSTNVDVIDPSAVPQLPVLPNVPLFIALGLFGGAFLGVCSAFVKESIDQTISSPEDAEEM
AGISTIGLIPHFSMEGLNALATENQSVLARVPLAADRPQSKLAEAFRALRTSLLLANAGAPPKVIMITSAQPGDGKSTVS
VNISAVLAQSGARVLLVDADLRRGVLARNLKVMPEGGLSECLAGRKSWRDLIIPVNGVANMWVLPAGHRPPSPADLFTSN
KMEEILNEWRGAFDHVVIDTPPVVAVTDGVVLSQKTDAVLLIARASRTGRHPLRHARMLLAKVRANVVGLVVNDFDAKAK
YYGYSYSYDKYYVEDKTETTVNN
>gnl|bykdb|A0A010NGT7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nesterenkonia sp. AN1] (length=458 residues).
MELREYLRIVHRGWLIIVLATLAGIGAAATFSLLQSPQYEAETRVYVSTDSASTVAELGQGTTYTQQIVQSFVEVTTTPR
VLQPVVEELGLDQTPAELSDSIAVSTQADTVLLQITAVAEDPVVAAEIANTVTENLISVVGEITPGSSGEASSISVEVLQ
EAVAPESPVSPRVPLNLALGLLIGLSLGVGIAVLRDVLDTRIRGEHDISATTETPVLGGIAYDSEAQKRPLVVQVDPKSP
RAESFRTLRTNLQFLEVGESRRSFVITSSIQGEGKSTTVANIAITMQEAGQRILVIDADLRRPRIADYFGLEGAVGLTNV
LIGKADLDDVVQYWGPHDLAVLPAGDIPPNPSELLGSPSMDALLRFVEDQFDVVLIDAPPLLPVTDAAVLATRATGAIIV
VVAGKTHRQQLKGAVTSLENVGAKLFGVIPTMLPTKGPDAYGYGRYGYAYTYEEDGRA
>gnl|bykdb|A0A011U0Z3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. MRS-1] (length=463 residues).
MTLHDYFSALRKRWALLLVLTILGAALGYGYGTLQTDTYRAQSSVVIVPARGDTTSELVQGSNYVQGLVATYTVVATSPV
VLDRVIASLSLDTTSRDLARIVSVSSPLDTTVLEIAVTGADPGQITRIANAVSTELADAVENLSPRTTSSGPAVRVEQIS
PASEPRSPIAPNTRLLAVIGALIGLLAAAVIAILRQVLTTRLVSRADIAEVTDIAVLGQIPVNTTGVPLAVAVRDTASGS
LAEAVRTVAASLRFANVDGEAKVVLVTSPESGDGKSSIALTLAAIAAEQDQRVLLIDADLRRGTVADVTGFEGAVGLTTV
LLGDVTVDDAAEAWGESGLRVLTSGATPPNPGQLLASGHLRQLLAQVREEFDLVVVDSPPVLAVSDALWLAPAVEGIIVV
ARSRRTKREALARTLAELEATRTRIMGIVLNDVKRVASSPYYERAEVPHAGRSTWFLRGRRRG
>gnl|bykdb|A0A021VVD9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinotalea ferrariae CF5-4] (length=524 residues).
MEFQDYVAILRKRWVSILVVALAVVAAALAATLAATPSYQARSQVYVSVRSGGTTADLVQGSNYTQRQVKSYSDLVTSPL
VLAPVIEELGLDTRAEVLALAVTATPVVDTSLINISVTDEDPGRAAAVADALAASLAVQVNELEPPTADGQSPVLISTVR
PAVEPSAPASPSPTRNLALGLLLGLAAGFGVAVLREMLDTKVRDEDHVAQVTESAVIAAIPHDDSAVNDHLIVQSNPMSL
VAESFRRLRTNLQFLSAEEQPRALIVTSSLPEEGKSTTAANLALTLADSGARVILVDADLRRPSVANYMGLEGTAGLTTV
LIGRASLEDVVQPWGAGHLHVLTSGQIPPNPSELLGSQAMAHLLGQLVQRYDHVIIDTPPLLPVTDAAVLARLTGGAIVV
VGAHKVHRHQLEEGIRSLETVNARVLGIVLNRVARKQSETYAYDYSSDPSQTPRSVSERRSDAPPPPRRSTKAASAEGLD
LTGTRLPAQGVAGLDAALGGRGGNRWPGEPLGEPSDQAPRHSRA
>gnl|bykdb|A0A022KTD5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium muris UCD-AY4] (length=512 residues).
MTIEDFLRLLLRNALLLVLLTVLGAAAGYGFSYTKAPVYQASALGFVRGAAGSDPVNSTQGQYSKAQFFLPLFQTRAVGQ
TIVDELGLEASPDAVAGSLGTTLDPNAPIITVTARASSPEEASAIANASIEAVAAEAEKLEPGTGSQLVPYQTALTPGAP
VSPDRIRYAAVGAAAGLLAAMALAVLRNRNDSRLRTVDQLADEVNVPVLGVLPDVKDFSRPKSGILPEPKTFQAREALRK
FRTNLRFVDVDNPPRSIVVTSSAPAEGKSVVSGNLSRVIAGTGQPTLLIDADLRRPLVAKQFGLDGSVGLSQLLAGAVSV
EDVVQPIPGTRLSVLPAGQIPPNPSELLGSRRMHELIKELSRTHFVVIDAPPVLAVTDAQLLSRHADGAVLVAVTGRTRV
EGLRRAIDSIHNVSGKVFGVVLNRASTSRLKRIAYGDAEYGYSAYGYGSKRYAYGSAAGLETGPEAELEVPDDVISAPVP
ETLAADEDPATEHGHRARGGKRAAAPDEDGRK
>gnl|bykdb|A0A022L4I4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. UCD-TDU] (length=450 residues).
MGESRVSLRVIASSLRKFWWMVVLFGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDAKAAAELADAVAEQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGAVLGLAIAALIGVLDTRMRTEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPSEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTVPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A022LGD7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium flaccumfaciens UCD-AKU] (length=469 residues).
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGASVTDLSQGNTFSAARVKSYEELAVTPQ
VLGQAAKQLGLPGGGGLGRVVTAESKRDTVLISISATDESPTQAAAIANAVTEQLVKVVDQVENEGAATDGLVHLSVFQP
ATAPSTPFSPRLAVNIAIGVLAGLALGIAQAVLREVLDTRLRSFEALRRLTHASVLGEFAMDETIAKEPLVSFDNRYSTR
AEAFRQLRTHLTYTNLDGDAQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
TRQVALDDATQQVGADTPLHVLAAGRVPPNPSELLSSSRMVDLVRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRRSSRARRTPEDH
>gnl|bykdb|A0A022LH22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium flaccumfaciens UCD-AKU] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVEGTDPVQAANIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSTPVSPNVPVNVALGLLVGLALGIGISILRETLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIIA
VASGQTLKGQLAAAVASLANVGAPISGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRASKKLGVLRR
AGR
>gnl|bykdb|A0A024GZV1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudarthrobacter siccitolerans] (length=487 residues).
MELSDYLRVLRRNWITIVACTLLGLIVAGAVSLALKPTYTAQTKLFVAIQSSGSVAELQQGNTFSQARVQSYVETVGTPV
VLQPAIEKLGLNITPAELSGKIEASADFNTVIISIAAVDTSPVQAAAIAQAVSDSLVSAIEKLEGSLENGPSPVKLSVIT
PATAPSAPSAPNSQMNLAFGLISGLIVGVGIAVLRSTMDTKVRGEADLRRVTEVPILGGISYDVDAAKKPLLTQAPTQSP
RAESFRQIRTNLQFAHVSHESKAVLVTSSLPGEGKTTTATNIAIAMAEAGQSVLLIDADLRRPRVDDYLGLDRNVGLTTA
LIGAADVNDLLQPWGEQSLYVLTSGQIPPNPSELLGSAAMASLIGRLEQAFDAVIIDAPPLLPVTDAAVLAQQVGGVVVV
VGASRVSAQDLQKSMAALKMIEANVLGAVLNLLPAKGPDSYAYSYYNYDSVPMKPKVSAARAAKTMPSEFDALLHGESPE
ARRRVQN
>gnl|bykdb|A0A024QWT2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium neoaurum] (length=486 residues).
MNIQDFLKLLRTRWISICVVALTTVAAATAVTLLTTPQYQANTRLFVSTTTHSSVSEAYQGNKFSQERVGSYAELIMGRT
LAQRTIDKLALDMDAETLQAKISASTKLDTVLINVEVMDESPVRARDIANTLSDEFVQLVRELETPESGAPSDARVVVEQ
RASIPENPVTPKATRNIAVGLLLGIALGIGLAVLRDLLDNTIKSREVLEEISGTGVAGSIPLDKERAKDAAISFDVENSG
ISEAFRKLRTNLQFLAVDKKPRVIVVTSSMPSEGKSTTAINIALSLAEADHNVVLVDGDLRRPMLHNYLDLVGTVGFSTV
LSARATLDDALQKTRFPGLTVLTSGPVPPNPSELLGSQAAKNVLTELRSRYDYVIVDSTPLLAVTDAAILAASADGALIM
ARYGRTKRDQLAQAVGSLRDVGATLLGAVLTLLPPRGASSYSYSYGYGTTAAKDPNPEPGGEVDVMPLRDKITPRNRGHR
APRTET
>gnl|bykdb|A0A031FRH9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oleivorans] (length=472 residues).
MAETAPWSGHWLLSALRKFWWGVAVCAVVGATAAFGLSALETPQYQSTSSLYFALNQGASASDLNQGSAYTQNQMLSIAQ
LATTSRVLEPVIEELGLDTTPRDLARSLDVSIPQDTVILRVTSTTTNADRAAALSNAVAAELADVVLQISPKGAEGAPTI
TAETIDKAVAPSSQSSPNKPRDALLGLLIGALLGIAAALIFSAADTRVRNEDILARVSGTPVLGVITRAPLLAHRAAGVA
QEPMGRSAEEFRRLRSALTYANVGSRVSTLLVTSGSPGEGKSTVAVNLALTLADLNHRVLLIDADLRRPQVHVFFGIEDA
VGLTSVLLKMHDFDTAKYPFRSSTLDVLPSGGTPPNPAEILASQAMADLLEESAARYDFVVVDAPPMLNVADASLLAPSV
DGVLFVVDATKTRRPNAAKSIKLLEGAGARILGSILNRARHDKKAGDYYGPVTPGRAAINPAPAATADAARD
>gnl|bykdb|A0A031G2F4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=463 residues).
MNVIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSTAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IAAEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANRALVATADVANELDPTSNVKVTAMEDALAPAAPSSPDRV
RHLLYGLGAGLVLGLIVAFLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVVLQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMRDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVIRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAAAGTAGDTSRR
>gnl|bykdb|A0A031G3E4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=465 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGAVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHDKYLQGTGKGGKKSRRAARAKKG
>gnl|bykdb|A0A031GRT8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=463 residues).
MNIIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSSAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVKVTAMEDALAPAAPSSPDRV
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSLRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMKDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVIRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAATGTTGDASPR
>gnl|bykdb|A0A031GSP3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=447 residues).
MDLQQYLQTFRKYWRSILTVLSVCVGAALAFTFLQTPKYSSTSSALIAVDTAASPGELSSGALYAERQVSSFVALADSAL
VLDPVIDELGLNVTPQALRSRVSVSAPAGTSIVDVTVTDADAGRAAEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
PAAASSRPVSPRPAVNLALGLIAGVVLGLGQALVRRLLDSRIRTREDLEEITDAPVLASVVRHKGSDQTKDGAAPTRGTA
WASGESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSTNLAKVLAETGARVLLVDADLRRPQVGARLGLDDELGL
SDVLTGRADLNDVLLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
VARAGVARQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
>gnl|bykdb|A0A031HPL6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=463 residues).
MNIIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSSAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVTVTAMEDALAPATPSSPDRV
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMRDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVVRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAAAGTAGDTSRR
>gnl|bykdb|A0A031HPS9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAAEVDRNSPLEVVPLSDARVPSAPVSPD
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEVTGAGVIGAVPENASLTRTGEEAMDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTIASNLARALALAGERVLVVDADLRRPRQHDLFKVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLELASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYAYGYGYESTYHKSHEKYLSSGGSSAKKGRRSRRKARTRS
>gnl|bykdb|A0A067LK66 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter cf. michiganensis LMG 26808] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSSNVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDQYGLDVTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGESLKTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A0A067LLP2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter cf. michiganensis LMG 26808] (length=462 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDATPQELARAVTVTTPQNTVIMEISVTEPSPSDAADIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPENQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTTAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASSRMEDLVGLAKASYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQTGRAGRAAGKAPVAG
>gnl|bykdb|A0A076JNF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RSIVRASSLGSVPMDASLDNKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A077MB29 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera jenkinsii Ben 74] (length=530 residues).
MELRDYLRIARLHYKAILTFIALGLLTAWLVTLFTPRVYAATASGMVRSGVAESPAEESLGDTLAKSRAVAYVDVAKSRP
VAQKAIDKLGLDTTPDALISHITVTQPVQTATIKVQARAGSPSGAQQLADTWVVALTEQIKELEDPAGKGSSIRMIPVEN
AALPGGPVSPNPVRNLALGFLLGGLAGSAYALLRSRIDRRIRDVDTVTRQFGVTVAGAIPASEILRRNEEGHVPVVFGGR
GDSKRSQVVESFLKIRTNLQFMDIDNPPRVIVVTSPLPGDGKSTVSANLAIALAEAGESVILLDGDLRHPVVAESFGLLE
GAGLTDLLTGKATLDEVAQHPAQTPNLTVVGAGSIPPNPSELLGSNVMRQLLQTLRRNHMIIVDAPPLLPVTDAAVLTAN
ADGALVVITAGKTLDTQLDGALTSLEQVNGHVLGVIFNRIESGFASGYGNYGGYGYYGSYYGHDEAKGKGKEAKAPAAPT
PDGYDGPPPVARFPAPAPPPPGSLADRIDAGDVDTPAPAGATASDARPAD
>gnl|bykdb|A0A083X494 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum 17-1B] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAVELSSG
ANYINSQIQTYPQLIKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNDPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNIAIGLVSGIVLGIVVALIKDLLDTRVRRDSDVTAVIDAPVLGS
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVAEAYDYVIIDT
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLVMNYGEMEKPQKGGYYYYGDESDDNGRKRQ
IQHKKSEKMKKD
>gnl|bykdb|A0A083XFV9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. infantis EK3] (length=472 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTANDMSYGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTVTNPTNTFMVDISAEVGDPQQAADIANSVAKNLTDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQAAILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVDQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELRSTATALQTAEVPILGFVFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKG
>gnl|bykdb|A0A083XXD1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum EK13] (length=476 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKGVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKKNYYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A086DVG5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium sp. MLB-32] (length=476 residues).
MELRDYIRILRKSWVLIVLLTLVAVGAASTYSILQTPTFSATAKVFVSTQSTGTTSELAQGNSFTVQRVKTYSDLVATPI
VLLPVIGSLDLGITPDALATKVTASAPLDTSIIDITVTDTDPVRAAETANAISASLTSVVAEIETPVGADAVSPVKLTRA
QQATVPSIPVSPNVPLNIALGALVGLALGVGIAVLRETLETRIRNQRDVEQVTDSPILGGIVFDPKAQERPLIVHVDPRS
PRAESFRTLRTNLQFLDVGRTERAFVVTSSIEAEGKSTTGANLAIALADSGSRVLLVDADLRRPKIADYMGIEGAVGLTD
VLIGKAELKDVIQPWGRAQLFVLPAGHIPPNPSELLGSARMTHIIGELNRAFDVVLFDSPPLLPVTDAAVLAKNVGGALI
IVAAGRTHKNQLKGAIAALTNVGTSVSGLVLTMLPTKGPDAYGYGNYGYGYGSDLDAETAAAPKGKAGPRRTRVQA
>gnl|bykdb|A0A086DVZ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium sp. MLB-32] (length=484 residues).
MELRDYIRILRKSWVLILLLTLVAVAGASVFSIVQTPKYSATSKVFVSTQSSGTTSELAQGNSFTVQRVKTYSDLVVTPI
VLLPVIGKLELGITSDQLASRVTASAPLDTSIIDITVTDTDPVRAAATANAISVSLTAVVQNIETPDQAGAVSPVKLTRA
QEATVPSVPVSPNVPLNIALGALVGLALGVAIAVLRETLETRIRNERDVEQITAVPILGGIVFDSKAQERPLIVHVDPRS
PRAESFRTLRTNLQFLDVGRADRAFVVTSSVESEGKSTTGANLAIALADAGARVLLVDADLRRPKIAEYMGVEGAVGLTD
VLIGRAALKDAIQPWGKGQLFVLPAGHVPPNPSELLGSARMSLLIAELNSSFDVVLFDTPPLLPVTDAAILAKNVGGVIL
IIAAGRTHKNQLRGAISALDNVGAPISGLVLTMLPTKGPDAYGYGHYGYGYGYGYGEETGAETSPSSAPASARPPVARRT
NLRK
>gnl|bykdb|A0A086ZQ72 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium boum] (length=470 residues).
MTIADLLQAVRKHLVAAIATFVVVVGLVAAYTFLTPPKYTATAQLFATYAAQSETQTSSDMNSGASYLSTQIKTYPQLIK
TEAVLRPVIKDLDLDMTTSELAARVTATNPSNTFMVDVSVEDGDAARSAAIANSVAKSLSQQVTSSLYTDESAKSPIQLT
LVQKASTPQSPSSPKTTLYLASGIVLGIICGIGIALLLDMLNTKVEGATDVRELTHASSLGSVQRSALLEESRPVVIAQT
SSKEAEEFRRIRTNIAFLAPNTKEHGHLLVISSTRPSEGKTTISANVAAAIAEVGKSVLLIDADLRHPSVAKKLGIEGQV
GLSHILSAQATPRDVVQKYWKQNLHVLPAGKRPANASVLLNSEIMTDMVEQALTQYDYVIIDTAPLSVSDDAVVFGRMAD
GMILVVGRGVADKKELEEEAMSLKEADVPILGFVLNYADEKKHSDKNGNYYYYYYEDSHNEHGTGRHGSK
>gnl|bykdb|A0A086ZSZ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium biavatii DSM 23969] (length=496 residues).
MVAEKSEPIQGQAPVEAVEQRDGGVTLMDMLRIIRKHLISAIITFVVVFAAVCAYTLLVPPKYSATAQAFATYNQTVANS
EDISSVNNASSYISNQIKSYPTLTTTEAVLQPVIDDLGLNVTVAQLGQQLTVTNPTNTAFVNITVEDDSPQQSATIANEV
AKSLQSVVQNSLYDSSQKSPVKLTIVQQATEPTSPSSPKVALNMAIGLVVGAILAVFVALIRDLLSTKVQESHDLQEIID
APIMGRIPDDESLKQPVPVIVSAPSSSIAEEYRRVRTNLSFTSPVEGSNARLIVISSVSPNEGKTTTSVNIAATLAENGA
SVLLIDADLRHPSVADKLSLEGNAGLAHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSKTMKELIRQALTQY
DYVIIDTSPMIVANDAAVFGAMGGGIVLVSGRDVTDKRELRDIASQLDNLGVTVTGFVFNFAKETKKTSSYGNYYYDDDD
STQHRKGKRRSSSKKK
>gnl|bykdb|A0A086ZYI3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium biavatii DSM 23969] (length=482 residues).
MTIADILQTLKKHLAAELVVLLVVLAGGFVYVSRQTPQYTATAQMFASFNHNVSSGDSKDTPTPGFTQIQSESDYVTSML
GTLPTLVTTPAVLDPVIDQLKLDTTATALASRITIGTSSSYFVNIAVNDTDAQRAADIANAVGESLKTQLSDDSYSSEKT
YVLSYLNLSVVKEAVAPGAPSSPNVKSFMFKMALIALVAAACVGMAIDVLDNRLRQMADLQRIADAPVLGTVMKDPEFRA
DKPVVVANPSGSASESIRRLALNLAFISPDRTNRSNVIVITSSGANEGKTTIAVNLAAALAENGAKVLLIDTDLRKPSVA
KHLGLDGTVGLSHLLTGQVSSSEAIQQYWKPNLHILPAGEQTTNPSILINSNAMKTLLDKVSGLYDHIIVDTTPLRVAND
AAVFAKDGARMLLVASQGVTIKRQLRDAVQELAMIDVTVVGSVFNQMQARKGGDDYYYYYSYSGKGKGHKGLELPSFGKD
KS
>gnl|bykdb|A0A087A7B6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium callitrichos DSM 23973] (length=495 residues).
MNEPEEGQQDGLTVMDLLMAVRKHLITAIVTLVIVVAAVAGYTFTRTPQYTATSELLATYRTSASSNNGGAGSELNSGAN
YLTSQIQTYPQLVKTESVLQPVIDDLGLNTTVTELAKTVTASNPTDTMLVDISVQNDNPKDASNIANAVAKSLKEQVTST
LYSDEGDKIVSPVNLTVVQQAYAPASPSSPNIKLYLAVGVFGGLILGIVAALIKDLMDTRVRQDSDVTAIVDAPVLGGLT
RNDAYDDKAPVIIAHPASREAEEVRRLRTNVAFVLPDEKFSNVIVVTSAGPAEGKTTTSVNLATAFAENGSKVLLIDADV
RNPSVSKKLDIEGTVGLTHLITNRVSSQDAIQRYWKPNFHVLPAGKQNLNPSILLNSRAMKALIVQVAGAYDYVIIDTAP
MQVANDAAVFAKDGPELLLVAGVGVTEKKQLKQTEQELETLNIKAAGVAMNYVEAEKPQKSGYYYYGDDADGKGKKSQHG
SAKSDAQTKADDKNS
>gnl|bykdb|A0A087ADW7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium choerinum] (length=470 residues).
MTLSALFGILRKHIITIIVTFAVVLGAAIGLTAMSPVKYSTTSQLFATYNDSSDGTANSSEQNSGSSYIMSQIKSYPALT
TTQSVLQPVIEELGLHTTVGQLKGEISVTNPTNTAFVNITVTDGDPAQAADIANSVAKSLSSVVENTLYASGSRSSVKLS
IVQPATAPSSPSSPKWKLNILIGIVGGLILGVFAALLKDVLSKRVQDDDEVGEYLDAPIIGRIPEEELLKGTKPAVVSEP
GSPVAEDFRRVRTNLTFMAPVDGTNCRLIVVTSTGASEGKTTMSVNVAAALAENGAKVLLIDADLRHPSVAKKLDLDGSA
GLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASTLLNSPIMEELLNNAMEQYDYVLIDTAPMVVANDAVIFVRRGG
SLIMVCRRDHTLKRDLRDISEELTTLDLSTTGVIFNCARDSKKSLEHTNYYYYYSSRSTDHRKKRRFSLK
>gnl|bykdb|A0A087ASS3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium gallinarum] (length=488 residues).
MDQNQMEQEEGITLGELLQIIQKHIVSAIVVCVVVFAAVAAYTFLAPKKYEATAELLAMSGQGAISGDANASQYSSIGSY
INTQIATYPQLVKTEAVLAPVIDDLGLDTTVAETAELITASNPAGTFMVGITAETEDPALSQQLANAVADSLSEQVSTSM
DTVSKDQAPVSLSVVQQAALPEGPSSPNVPLYLAAGLVVGVILGIGFAIVREMLNTRIDTTSDVRGILGSSAIGSIPDDQ
ILLKQQPVVVAQPGGPIAEEYRRIRTNISFLKTDRVSGEGQLIVISSVSPSEGKTTTAVNVAAALAEDGAKVLLIDADLR
HPSVAKHLGIEGHAGLAHVLSGQMTPKDVVQSYWKPNLHILPAGKRPANASILLNSDTMEALVRQALTQYDYVIIDTAPM
TVSNDGVVFGRLANGIVLVTGKGITEKKDLQETAETLKTASVPVLGFIFTFADPKKSHAGNYYYYYYEDGTKRSNTKRKG
GKNTKRRQ
>gnl|bykdb|A0A087B589 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium cuniculi] (length=474 residues).
MTFSDLLAIIRKHVITIAITFVVTVTAVCAFTAVSPVKYTTTTQLFATYNDASGSQANMSEQNNGSSYIMSQIKSYPALT
ATQTVLQPVIEELDLNTSASTLGETISVTNPDNTAFVNISVTGTDPTQTTDIANAVARSLSNVVEKSLYATGSRSAIKLS
IVQPAVRPTAPSSPKWKLNVLVGIVGGLVLGVFAALLKDVLSKKIEDEDELGEYLSAPIVGRIPEDELLNETSPAVICQP
GSPIAEDYRRIRTNLSFIAPVDDTHCRLIITTSTGASEGKTTTSVNVAAALAENGAKVLLIDADLRSPSVAKKLDIDGSA
GLAHVLSGQASVKDVVQRYWKGNLHIMPAGPKPPNASTLLNSPVMVELLNNAMQQYDYVIIDTAPMVVANDAIIFVRRGG
SLIMVCRRDRTLKHDLREINEELTTLDLSVTGVVFNCAKDNKKGSGYGNYYYYYSSNDSDTDKKKGHRLRQRKK
>gnl|bykdb|A0A087BBC7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium magnum] (length=482 residues).
MVGRDNHHNDLTFIDLFHIVLKHLITVVIGFIVVFGLSCVYLLVKTPEYTATAQAFTTYSDTSNVNENYSSLGSAASYIS
TQVKSYPTLITTDVVLQPVIDQMHLDESIATLAKTITAVNPTNTAFINISASSEDPHEAAKIANAVTDSFQNVVQSSLYM
DNKQSPVKITVVQKAMVPESPSAPKTPLVLLIGIVGGLIVGIIAALLKDVLSRKIQDDSELTTYINAPTLGRIPEDEAVN
SNTSVIISEPGSSVAEDYRRICTNLSFIAPISGTNSRLVVVSAVGANEGKTTTAVNVATALAETGSAVLLIDADLRNPSV
AKKLDIDGSAGLAHVLSGQASVKDVVQRFWKANLHIMPAGPKPPNAAQLLNSPVMSELINNALHQYDYVIIDTAPLVVAN
DGALFAKQGGGLVMVSRRGVTLKKQLSETAAELANLHVDVTGFVFNGAKLDKKLAGSSYYYYTSSSDSQSKERHSSHSKD
KH
>gnl|bykdb|A0A087BEI6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium merycicum] (length=493 residues).
MSSEEMTEGQPSSSDNQMRKVYTFADLLATIRKHLIAALVACAVVIACVGAYVFLAPPEYTSTAQVIATFNAAQENGEST
DISQQNTGGTYISSQIKSYPTLTTTEKVLSPVISKLGLNESVSELAKQLVVTNPSNTAFVNISAKSGDAQRSADIANAVA
ESLRTVVQQDLYGGSKGQSPIKLTVVQKATVPQSPSSPKKGLYFAIGVVLGIIVGVFAAVLKELLSTKVEETSDVRGIVK
ASALGSVPKNEVLSGTRPIIITEPNGPVAEEYRRIRANIKFLQADKVPDRGQLLVISSTSPSEGKTTTVINVAAVLAENG
AKVLLVDADLRHPSVAHHLGIEGSVGLAHVLSGQMSPVDVVQSYWKPNLHILPAGKRPANASLLLNSDMMKMLIEQALMQ
YDYVLIDTAPLAVSNDGIVFGSWAKGVVLVAANGICRKKDLEESMDALRTAKVPVLGFVFNFANPKKEHKNAYYYYYEDG
ARRSTPRRNGRKH
>gnl|bykdb|A0A087BEY8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium magnum] (length=502 residues).
MASMSDEKGTYAATNANNKEQHDGLTLIDLFHVLFKHAITAIIGFVVVFGCACVYLLMATPQYSATTQTFTTYSDTSTAD
DNYSSLGSAASYISTQVKSYPNLIKTDVVLQPVINQLHLDISVNGLAGMVTATNPSNTAFINISVTSSDPQQAAQIANAV
ASSFQNVVQSSLYADGKPSPVKITVVQNASVPSSPTSPKTALVLLAGIVGGLIVGIVAALLKDIFTRKIQDESELESYIN
APVLGRIPEDEEIGKDASVIVSQPGSVAAEDYRRICTNLTFIAPVSGTNSRLIVVSAVGANEGKTTTSVNLAAALAENGA
TVLLIDADLRHPSVANKLNIDGSVGLAHVLSGQASVKDVVQRYWKSNLHIMPAGPKPPNASQLINSPIMSELIEHALHQY
DYVIIDTPPLVVANDAVIFAKQGGGLVIVSRRAMTRKKELTDTANELRNLHVDVTGFVFNGAKDEKTSLYGSNYYYYSND
SKGSGEHHHHTRKSSTSRSLKK
>gnl|bykdb|A0A087BKW6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium merycicum] (length=521 residues).
MAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYTLTAQKKYTAT
AQLFASYNNTTADALDSSVSSQSTAGTYIATQLKSYPDLVKTEAVLQPVIDELNDNSITTDDLAAMVTATNPTDTYMLNV
SVEATSPEQSAQLANEVSQSLSRVVSSELYASGKKSMVKLSVVQKAKTPTSQSSPNTKLNIAVAVVAGIVLGIFAALVRD
LLARKLQDLMDLQSIDPNGSIAGIIPKDEVLNVTKPVIVTKPDSPIAEEFRRMRTNLSFVTSKDGDKGRLIVITSSMPSE
GKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMPAGPRIQNASV
LLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMISARGTTYKSALRGAVNELRDLDVPLLGYVFNLA
DEKRNRGYGNYYYYGSYYKGEYGKEDSKKDRKRRRSHRRGK
>gnl|bykdb|A0A087BLR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. suis] (length=478 residues).
MTIADLLQIIRKHLASAIISFVVVFAAVAAVAFIMPPKYTATAEAFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTAANPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPMSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A087BSB6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium minimum] (length=479 residues).
MGRNESIVTLADMWIILKKRRVTALVTAFVVFGLVVIVTFLMPPKYTATAEIFASYASKSESSQTSADMNSGTSYLSTQI
KTYPSLVKTEAILKPVISDLNLDMTVEQLADMVTATNPTNTFMVDISVEGGDPDQSAAIANSVANNLARQISSSLYSGDD
DTSPIKLSVVQPAVVPQSPSTPKIPLYLVAGLVLAVVMAVAVALIKDMVNTKIDSVDDVKEIDNGAASLGSVPKSAFMTE
QAVVVSAHPASAEAEDFRRIRSNISFLTPPQAGKGHLLIFTSAEPGEGKTTVATNVAAAIAEEGKTVLLIDGDLRHPSVA
RALDIEGNVGLSHILSAQATPMDVVQPYWRPNFHILPAGRRVANASILLNSAIMLELVEQAQKQYDYVIVDMTPMSVSND
AAVLGKISDGVVMVVGREVADKRDLRSVLESLTTTKVKILGYIFNLANPKKIHSKNYYYYAEESSTGAHHAGTAKKRNS
>gnl|bykdb|A0A087C7D7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium mongoliense DSM 21395] (length=473 residues).
MTIADLLHVLRKHVVTVVTAFVVVFLAVAAFTFLSPPKYTATAELFATYSGQSDGTQNSNEMNSGASYLSTQIKTYPQLI
KTQAILQPVIDDLSLNMSVKDLADTVTATNPTNTFMVDIAVETGDAQQSAQIANSVSKNLAKQISSSLYSNDAGKSPIQL
SVVQEAQTPTAPSSPKIPLYLAAGFVLALIVAVGAALLRDVLNTRVDSLEDAKTLTDASSLGTVPRSSRMEERKPVVVAE
PSSHEAEQIRRIRTNISFLSPNTNDHGHLVVITSTEPSEGKTTLSVNVASAIAEEGKSVLLIDGDLRHPSVARALGLEGH
VGLSHILSGQASPREIVQQYWKPNFHILPAGKRPGNASILLNSVIMTELIDQALTQYDYVILDTAPLSVANDAAIFGKQA
DGVVLVVGKGVADKKELHATVESLHTSEVPVLGFILNFADPKRINASNYYYYEEDGKSHGKARRSARGRDKRH
>gnl|bykdb|A0A087CJ39 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium psychraerophilum] (length=488 residues).
MSSLGNEADSDNKARKVDTHESPRSGFTVVELVSVIRKHLSIVAAGFASIIFVVAVYSLTATPRYIAASELFVSYDVSST
ASQDIASINTAGAYIATQIQTYPKLASTAAVLEPVISDLNLDTSVVDLGKSITVTNPSNTMLIDISVETDNPAQSQKIAN
AVAESLSNTVKSSLYSSSNSPVKLAVVQKATLPESPSSPNIKLNLIIGALLGLIVGVLAALVRNMMDTRLGSLRDLQSIT
NAPLLGSIPSNDAVKKTSSVIASAPSSLVAEEYRRVRSNLSFIAPVEGLNSRLIVVTSTEPGEGKTTTSVNIAAAFAENG
SRVLLIDADLRHPSVADKVGLEGAVGLSHVLSGQANVADVVQRYWKANLHVMPAGPKPPNASILLNSTTMEAMVAQALKQ
YDYVIIDTTPMTIAADAAMFGRMGNGVVMVVGRGVCDKKDLSSTLSQLKNVEVPVIGTILNYAEQSKKHHGNYYYYDTEG
KRQQRHTS
>gnl|bykdb|A0A087CKX0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pullorum] (length=488 residues).
MDQNQMEQEEGITLGELLQMIRKHIVSAIVVCVVVFAAVAAYTFLAPKKYEATAELLAMSGQGAISDNANASQYSSIGSY
INTQIATYPQLVKTEAVLEPVIDDLGLDTTVAETAELITASNPDGTFMVGITAETEDPALSQQLANAVADSLSEQVSTSM
NTVTKDQAPVSLSVVQQAALPEGQSSPNVPLYLAAGLVVGVILGIGFAIVREMLNTRIDTTSDVRGILGSSAIGSIPDDQ
ILLKQQPVVVAQPGGPIAEEYRRIRTNISFLKTDRVAGEGQLIVISSVSPSEGKTTTAVNVAAALAEDGAKVLLIDADLR
HPSVAKHLGIEGHAGLAHVLSGQMTPKDVVQSYWKPNLHILPAGKRPANASILLNSDTMEALVRQALTQYDYVIIDTAPM
TVSNDGVVFGRLANGIVLVTGKGITEKKDLQETAETLKTASVPVLGFIFTFADPKKSHAGNYYYYYYEDGTKRSNTKRKG
GKNTKRRQ
>gnl|bykdb|A0A087CP34 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium saeculare DSM 6531 = LMG 14934] (length=488 residues).
MDQNQMEQEEGITLGELLQMIRKHIVSAIVVCVVVFAAVAAYTFLAPKKYEATAELLAMSGQGAISDNANASQYSSIGSY
INTQIATYPQLVKTEAVLEPVIDDLGLDTTVAETAELITASNPDGTFMVDITAETEDPALSQQLANAVADSLSEQVSTSM
NTVSEDQAPVSLSVVQQAALPEGQSSPNVPLYLAAGLVVGIILGIGFAIVREMLNTRIDTTSDVRGILGSSAIGSIPDDQ
ILLEQQPVVIAQPGGPLAEEYRRVRTNISFLKTDRVAGEGQLIVISSVSPSEGKTTTSVNVAAALAEDGAKVLLIDADLR
HPSVAHHLGIEGHAGLAHVLSGQMTPKDVVQSYWKPNFHILPAGKRPANASILLNSDTMEALIRQALTQYDYVIVDTAPM
SVSNDGVVFGRLANGIVLVTGKGITEKKDLQETAETLKTASVPVLGFIFTFADPKKSHAGNYYYYYYEDGTKRSNTKRKG
GKNNKRRQ
>gnl|bykdb|A0A087CXM2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium reuteri DSM 23975] (length=512 residues).
MVSANNEQQQNQNAADTAVAQAESGITIMDLMRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTSTAQMFATFNTSTAD
ATQDNNYGSINSAGTYIANQIKSYPTLATTESVLQPVIDQLGLDTSVSSLAGELTVTNPTDTAFVNIQVEDKDPKQAAAI
ANAVAKSMKTVVEDSLYSSDSKSPVTLSVVQQAQVPAGPSSPKIPMNMAIGVLGGLILGIIVALVKDLFSTRIEEAFELQ
EYIDAPIMGRIPEDDLLKGDVPVIISKPSSPIAEEYRRIRTNLSFTAPVEGMNARLIVLSSTSPSEGKTTSSVNLAVALA
ENGAKVLLIDADLRHPSVADRLGLEGNAGLTHVLSGQAAVKDVVQRYWKPNLHIMPAGPKPPNASALLNSAIMKELIKQA
LTQYDYVLVDTSPLVVANDAFVFGAMGNGIVIVSGRDVTDKRDLREIAAQLDNLNLSVSGFIFNYAKDSKKVAYKGNYYY
YDDDASTDGKKGKAGGQRPKQRSTARRAAVKR
>gnl|bykdb|A0A087D5G1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium ruminantium] (length=498 residues).
MEKNSVASVENANAQQAVAPQGVVEETDDGITLMDLLKIIRKHLVATIVAFVVVVAGVSAYTFLAPPKYTATAQTMATYN
ASGDGESISQQSTGGTYISNQITSYPTLATTSKVLKPVIEELGLDKTVADLADQVTVTNPTNTAFVNISVVDGDPQQAAD
IANAVAGSLKDVIEKDLYSGTESPVRVSIVQKAQTPQSKSSPKTALYLAVGVVLGIIIGVFTALIKDLLNTKVEETSEVR
AVVHASTLGSVPTDSSLDEKRPVVVSQPNGAIAEEYRRIHTNIEFLQTDRTEGVGQLIVITSAQPSEGKTTTSINTAAAL
AEDGAKVLLVDADLRHPSVAHHLGIEGNAGLAHVLSGQMRPKDVVQSYWRPNLHILPAGKRPANAGVLLGSETMKLMVEQ
ALTQYDYVIIDTAPLNVANDGAVFGRWAKGIVLVAGRGVCEKKALQEGFDSLVDANVPVLGFIFNYADPKKMHNQSNYYY
YYEDGAPRRKRGGHNKKH
>gnl|bykdb|A0A087D8L2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium scardovii] (length=411 residues).
MSSGASYLSTQIKTYPELVKTESVLDPVIDELGLDMTPEALAEAVTATNPTSTYMIDISAEVGDPQQAADIANSVAKNLS
QQISSDLYTNGQGKSPISLSVVQKAKVPTSKSSPKVPMFLAAGFVLGVIIAIGVALLKDILNTKVDSSDDVRELTRASSL
GSVPLSDTLDDNRPIVVAQPASSEAEEFRRVRTNLSFLATTPGQHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLL
VDADLRHPSVAPKLGIEGHVGLSHVLSGQASPKDVIQKYWKPNLHVLPAGKRPANASILLNSDIMRELIDQALTQYDYVI
IDTTPLSVAGDATLFGRMAGGLVLVTGKGVVEKKELQSTVESLKTAEVPILGFIFNFADPKKIHSGNYYYYYGEENNKKG
GKNRRNRKKRR
>gnl|bykdb|A0A087D923 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium saguini DSM 23967] (length=511 residues).
MVSAENNEQQNQSVADSAAAQAENGITIMDLLRIIRKHVISVIVTFVVVFAAVCAYTLLTPPKYTATSQVFATFSASDST
SSQGNFNDINNAGSYISNQIKSYPTLATTESVLQPVIDQLGLSSTVSQLAGQLTVTNPTDTAFVNISVEDTNPKEAADIA
NAVAKSMKTVVEDSLYSSGNKSPVTLSVVQQAQEPSGPSSPKITLNMAIGIVGGLILGIIVALLKDLFSTRIEEAFELQE
YIDAPIMGRIPEDDLLKGEVPVIIAKPSSPIAEEYRRVRTNLSFTAPVEGMSSRLIVMSSTGPSEGKTTSAVNTAVALAE
NGAKVLLVDADLRHPSVANRLGLEGNAGLTHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSPVMKELLKQAL
AQYDYVLVDTSPLVVANDAYVFGAMGNGIVIVSGRDVTDKRDLRDIAAQLDTLNISVNGFIFNYAKDSKKDYSSKYNNYY
YYDDDSNSGNKNSRNKKRPKRSAPRRAAVKR
>gnl|bykdb|A0A087DKU0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium stellenboschense] (length=494 residues).
MTVADILEALKKHLIVELAVLLVVLAGGYAYVSRQTPQYTATTQMFASVNHSAIYGSSDASAGEPSGDDSTKSSPTADAS
GDTSYISGQVGALPTLVTTPAVLQPVIDDLGLDTTVDALGTKITVSTQTTYFVNVSVVDTNPKRAANIANAVSRSLKKQI
SADSYASEKTYVLSLLNLAVVRQAEVPKTPSSPNVKSFMFKMTLAGIVAAVCVALIIEAADKRLRQIADLQRLADAPTLG
VLLKDDAFQASAPVVVSAPSGSAAESIRRLALNLMFIAPDRTEQSNVIVISSAGQHEGKTTVAVNLAAALAEKGEKVLLI
DTDLRRPSVAKALNINGKVGLSHLLAGQVGSKDAIQQYWKPNFHVLPAGDQTTNPSILINSHAMQELLKQVASTYDHVII
DTTPMRVANDAAVFAKEGARLILVASQGVTVKKQLRDTMQEFEMIGVAPVGTVFNNDHVKRGKNSYYYYGDYAGKGKSSR
ARKGRRSATDGKQA
>gnl|bykdb|A0A087DNN8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium stercoris JCM 15918] (length=501 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RGIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKVNSHSNYY
YYYEDGAPRSSHRANGKKKRI
>gnl|bykdb|A0A087DXR0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium thermacidophilum subsp. porcinum] (length=469 residues).
MTIADLLQAVRKHMVAAIATFVVIVAAVAGYTFLVPPQYTATAELFATYASQGESQNSSDMNSGASYLSTQIKTYPQLVK
TEAVLKPVIKELGLDMTTDELAGKVTATNPSDTFMVDVSVQDGNAEQSARIANSVAKNLSEQISSSLYTDESAKSPIQLN
LVQKARTPQSPSSPKVGLYLAAGVVLGLICGVGMALLLDVINTRVESSSDVRELTKASSLGSIQRSELLDEPRPVVISQP
SSKEAEEFRKIRTNISFLAPNVKEHGHLLVFTSTRPGEGKTTTATNTAAAIAEVGKSVLLIDADLRHPSVAKEMGIEGHV
GLSHILSAQATPRDVVQRYWKQNLHVLPAGKRPANASVLLNSELMTEMVEQALTQYDYVIIDTAPLSVANDATVFGHMAH
GLILVVGRGVAEKKDLVDTTTSLKEADVPVLGFVLNFADEKKHSNKNDNYYYHYYDESTGNHGGSKHSR
>gnl|bykdb|A0A087E3D8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium thermacidophilum subsp. thermacidophilum] (length=469 residues).
MTIADLLQAVRKHMVAAIATFVVIVAAVAGYTFLVPPQYTATAELFATYASQGESQNSSDMNSGASYLSTQIKTYPQLVK
TEAVLKPVIKELGLDMTTEELADKVTATNPSNTFMVDVSVQDGNAEQSARIANSVAKNLSEQISSSLYTDESAKSPIQLN
LVQKARTPQSPSSPKVGLYLAAGVVLGLICGVGMALLLDVINTRVESSSDVRELTKASSLGSIQRSELLDEPRPVVISQP
SSKEAEEFRKIRTNISFLAPNVKEHGHLLVFTSTRPGEGKTTTATNTAAAIAEVGKSVLLIDADLRHPSVAKEMGIEGHV
GLSHILSAQATPRDVVQKYWKQNLHVLPAGKRPANASVLLNSELMTEMVEQALTQYDYVIIDTAPLSVANDATVFGRMAH
GLILVVGRGVAEKKDLADTATLLKEADVPVLGFVLNFADEKKHSNKNGNYYYYYYDESTGNHGGSKHSK
>gnl|bykdb|A0A087E8V5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium subtile] (length=469 residues).
MQIIRKRIVTVIVTFCIVFAAVAAFTFLSPTKYTATAELFATYTGQSDAQQNSSEMSSGASYLSTQIKTYPQLIKTQAVL
QPVISDLNLDMKASDLAGMVTATNPSNTFMVDVSVEASSAKQSADIANSVANNLSEQISSALYTDGTNKSPIQLSVVQKA
VPPEAPSSPKTVLYLAAGVVLGIIAAIGAALLKDMINTKVDDTDEAKELTQTSSLGTVPRSEIFDDTRPAVVGNTGSREA
EEFRRIRTNIAFLNPDARDHGHLLVITSTEPLEGKTTVSVNTAAAIAEDGKTVLLIDADLRHPSVAKSLGIEGHVGLSHI
LSGQASPRDIVQKYWKPNFHVLPAGKRSGNASILLNSQVMHEMVEQALQQYDYVILDTAPMSVSNDAAVFGRLADGVVMV
VGKGVAEKKELESTVQALSTAEVPVLGYVFNFADPKKIHSKNYYYYGESAPKGDKGKNKAKDKDKNKRH
>gnl|bykdb|A0A087EH01 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium thermophilum] (length=470 residues).
MTIADLLQAVRKHLVAAIAAFIVVVGLVAAYTFLTPPKYTATAQLFATYAAQSETQTSSDMNSGASYLSTQIKTYPQLVK
TEAVLRPVIKELGLDMTTSELAAEVTATNPSNTFMVDVSVEDGDAARSASIANSVAGSLSKQVTSSLYTDESTKSPIQLT
LVQKASTPQSPSSPKTTLYMVAGVVLGIICGIGIALLLDMLNTKVEGASDVRELTHASSLGSIQRSNLLGESRPVVISQT
SSKEAEEFRRIRTNIAFLAPNTKEHGHLLVISSTRPSEGKTTVSSNIAAAIAEVGKSVLLIDADLRHPSVAKKLGIEGQV
GLSHILSAQATPRDVVQKYWKQNLHVLPAGKRPANASVLLNSEIMTDMVDQALTQYDYVIIDTAPLSVSDDAVVFGRMAD
GIILVVGRGVADKRELEEETTSLKEAEVPILGFILNYADEKKHSDKNGNYYYYYYEDSHNEHGTGRHGSK
>gnl|bykdb|A0A099JUC4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium roopkundense] (length=474 residues).
MELRDYIRILRKSWVLIVLLTLVAVGAASTFSILQTPQYSATSKVFVSTQSSGTTSELAQGNSFTVQRVKTYSDLVTTPL
VLLPVIGSLDLQVTSDALKGKVTASAPLDTSIIDITVVDTDPVRAAETANAVSESLTSVVAEIEVSSGADAVSPVKLTRV
QQATVPSVPVSPNVPLNIALGALVGLALGVGIAVLRETLETRIRNERDVEQVTDTPILGGIVFDPKAGERPLIVHVDPRS
PRAESFRTLRTNLQFLDVERTDRAFVVTSSIESEGKSTTGANLAIALADSGLRVLLVDADLRRPKISDYMGIEGAVGLTD
VLIGKAELKDVIQPWGRAQLFVLPAGHIPPNPSELLGSARMTHIIAEFNRAFDVVLFDSPPLLPVTDAAVLAKNVGGAII
IVAAGRTHKNQLKGAIAALTTVGASVSGLVLTMLPTKGPDAYGYGNYGYGYGYGSDVEAEAAAPKGSRRTRVKA
>gnl|bykdb|A0A0A0B6L4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas cellasea DSM 20118] (length=473 residues).
MEPSEYLSILRRNWLLLVLAAVLGFVGGYGYAQTVPPSYRAKASVFIAVPPGATVNEDVQGSTYVQNTVPSLARLAVQPV
VLDEVIEDLDLGTTAGPLAKTVTVESPLDTSILEISVVSAEPERAAAIANGIADQLPESVATLMGDRDSDRPAIQITTTG
PATPPAFAFSPNTKLDAATGMALGLALGVAFLLGRRLIDTRVRSLRDLRRVTDAAVLSVVRWERRDTEDRLVVRDRPQSD
RAEAFRRLRTNLRFLNLRGSGRTIVVTSSLPGEGKSVTTINLAMAMAEGSSRILLVDADLRRPSVARMLGLEGAVGLTTV
LIGDASLDEVVQPFGDGTLDVLASGQIPPNPSELLDSDAMAELLREAALRYDIVLLDSAPLLPVTDAAVLARLTDGALLV
VGCRKAHRHQVAEALSSLETVSARLLGIVLNQISSKESGAAYVYGSVPGGDTRPTGRGRRGAQRARGAGETAR
>gnl|bykdb|A0A0A0C0L9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas bogoriensis 69B4 = DSM 16987] (length=497 residues).
MELRDYITVVRKRWIWIALGLVLGAAAALGASVVATPIYTAQSQVFVSVRTGDTGTDLVQGSSFTQRQVTSYADLVTSPR
VLAPVIDQLGLDATPERLARDVTASIPVDTVLITITVSGADAHLAADIANATATSLATQVTELERPQGGTSPVQISTIRE
ATTPVSPSSPDITRNTALGTILGLLLGLGLAVLRHTLDTKIRTVDDVRAVTDRTVLAVVTHDADTPKHPLFVQESPHSPR
SEAFRRLRTNLQFLDVEDGVKTLVVTSCVPEEGKSTVAANLALTLADTGASVVLVDADLRRPSVADYLGLEGEVGLTTAL
IGQAELADVIQPWGDTTLHVLPSGQVPPNPSELAGSAAMRRTLDELASTFDVVVVDAPPLLPVTDAALLARATDGALMVA
GANRIDRAQLDEGLATLEAVDARILGLVLNRVETGSAGGYYGYQAYYGPVEATSAKPARREITRRTATHSRRARRAAQTQ
PAEATAHDDQVGAADEA
>gnl|bykdb|A0A0A0CCR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinotalea fermentans ATCC 43279 = JCM 9966 = DSM 3133] (length=532 residues).
MELRDYLAIVRKRWISIALITVLLTGAAVAVTLATTPVYTARAQVYVSVRTGETTTDLLQGSSFSQRQVKSYTDLASTPL
VLTPVIEHLDLATTPDTLAESVSADSPLDTSLINIRASDPDPQTASDIANAVAESLAEQVTALEEPDEGPSPVEINTVRT
ASAPTEPSSPNLKLNVALGLLLGLAAGFGLAILREVLDTRVRTVDDVRSVTTASILTSMAHDEESVGKSLVVQTDPHSPR
AEAFRRLRTNLQFLDVAERLSAIVVTSSLPTEGKSTVAVNLAITLSDAGSRVVIVDADLRRPSVAEYMGVEGSVGLTTVL
IGKASIEDVVQPWGTGNLHVLPSGQVPPNPSEMVGSAAMAWLINELTKRYDLVIIDTPPLLPVTDAAILARLVDGALVVT
GANRLHRHELADAMGSLEAVGARVLGVVVNHLARKHGEGYSYHYYGSDENAPRQRRGARRPAPKARSSRAAGHANAPVTR
LTPPPSATPPRVTTRHTPEAAPQPQPTGSFDALLQTEPDEVRPGRWPGGPIA
>gnl|bykdb|A0A0A0UDT2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum GT15] (length=486 residues).
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE
EFRRLCTNLSFVENGNKDRPDNDHSNVIIVTSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKSNYYYYEESEVKNRRTKASTGDSSQNSASRNARRGRR
TTADGR
>gnl|bykdb|A0A0A1D2Z9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. PAMC 25486] (length=541 residues).
MVLEDEQLGNAEKSLDVRDYVRVFRQHGLGVIALALIGILCSAGWLFLQKPIYAANSIGYVSIPGGDNMGSALAGDNLAK
SKATSYASFAGSRPVAESVINTLGLNIAPDVLLKQISVTAAKDTAQIKIAASAESALEAQQLANAWVVALAEQVGILESA
PNPLDPAAPPVDSIIKIVPLGDAPLPQSPVSPNKKMTLIVGALAGLIIGVGYALVRNHLDRRIRSVEMVEKAIGTAVVGT
IPVDDRLRNGRHVVESGVIDHGNTEGYAMSEALRELRTNLHYMNVDNPPRVIVITSSIPGEGKSTIAANLAVTIAATGQR
VVLIDGDLRRPVVAEFFGMASGGGLTDILSGQATLDDVLQVYRPVPALAVLGAGRIPPNPSELLGSQAMKRLLERLSESA
VVLIDAPPLLPVTDAAILARSTDGALVVAGAGKTTIDELEKAVATLAKVQAPLLGAVLNRVPTTGGQAAGYGYYGKSYHY
HQSVKGAKARYKRTRNSAPAAPPVAEPAAANEADVQSREAEFEQLLSPSTDNATRRMTRSR
>gnl|bykdb|A0A0A1DU08 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides simplex] (length=458 residues).
MSIVAIILIALGVSAAITFTRTPMYESKTQIFLTVDVRDTTDAYAALLFASNRAASYATVVKSTELAEIVKDQLNLKESA
EVLASRVDAEVVDTTSLIQITVKAKNPRDAETIADRTTKEFIKYVGGLETPGGDLGGQSQILAQITDNASYNPNQVSPDV
ALNLVVAGLIGILLGIGLAIARELLDRTIRTADHVAELTESPVLASIGFDNDIRSAPLLTDLGGFAARTEAFRLLRTNLQ
FIDLDHQPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAVGLTTALVGKTEIHDAIQV
HEASGLHVLASGAKPPNPTEILQSKITHDLILRLRSSYDMVIIDAPPLLPVADASVLAKLADGVIIVVRHARTTKDQVNE
AINRLNHVGARLYGVVVNMVAKRAIGSYYYYYYEETSPSGRGDKSGSSKSNGSGRRRA
>gnl|bykdb|A0A0A1GPZ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=486 residues).
MQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAVELSSGANYINS
QIQTYPQLIKTESVLQPVIDDLGLDTTVKGLAASVTASNPDGTMLVDISVNDPDPKQASSIANSVAENLRKQVTSTIYSD
EGDKIISPVNLTVVQQAYAPTSPSSPNVKLNLAAGLGIGVILGIVVAFIKDLLDTRVRRDSDVTTVIDAPVLGSLSRNEA
YVGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSAGPSEGKTTLSVNLATAFAENGSKVLLIDADVRNPS
VSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDTAPMQVA
NDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGVAMNYGETEKPQKGGYYYYGDESDDNGRKRQIQHKKS
EKTKKD
>gnl|bykdb|A0A0A6VNM8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum] (length=476 residues).
MTIDVLGAIKKHVITAIITLVVVAAAVAVYTFTRTPQYTATSELLATYRSSASTTSSTGNELNSGASYLNSQIQTYPQLV
KTESVLQPVIDDLGLNTTVKTLAASVTASNPTDTMLVDISVVDNDPKVASGIANSVAESLKKQVTSTLYTDEGDKIVSPV
NLSVVQQAYAPSSPSSPKVVMNLAIGLAAGILLGVAAAIVKDLMDTRIRQDSDATAIMDVPVLGTVTRSDSYTERTPVII
AKPASRDAEEIRRLRTNLTFVLPEEDKANVIVVTSAGPSEGKTTISVNLATAFAEAGSKVLLIDADVRSPSVSKKLGIEG
TVGLTHLITNTVSSHDAIQRYWKPNFHVLPAGKQSLNPSILLNSRAMRALVDQVSKAYDYVIIDTDPMQVSNDAAVFAKE
GPQLLVVASLGITEKKTLKQTDQELHTLDIQPIGLAINYAEPEKPQKSGYYYYGEDTDENGKKRQSQHKKSGKAKD
>gnl|bykdb|A0A0A7I7A4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium kashiwanohense PV20-2] (length=466 residues).
MTLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGDDAGISQQYTGGTYIAGQITSYTTLA
TTETVLEPVIKDLGLDTSVKSLAEQLTVTNPTDTAFVNISAEDGDAQQASDIANAVAVSMQNVIQNDLYSAADKSPVKIS
IVQRARVPESPSSPNKPLYLAVGVVAGLVLGVFAALLKDMLNTKVEETSDVRSLVGASSLGSVPQDNSLGEKRPVLVSQP
NGPIAEEFRRIHTNIEFLQTDKVAGKGQLLVITSAQPSEGKTTTSINVAAALAEDGARVLLVDADLRHPSVAHHLGLEGS
AGLAHVLSGQMSPKDVVQNYWKPNLHILPAGKRPANAGVLLGSDTMRIMVEQALTQYDYVIIDTAPLSVSNDGIVFGRWA
KGLVLVTGRGVCEKKELKEISESLHTAKVPVLGFIFNYADPKKTHSNSNYYYYYYEDAPRKKSHKK
>gnl|bykdb|A0A0A7I958 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum PV8-2] (length=494 residues).
MAENMMEQQASGQAGVGAKPESDGMTLSGLFGILRKHVITIIITFFVVLGAVIALTAISPVQYSTTTQLFATYNDSSEGA
ANSSEQNSGSSYIMGQIKSYPALTTTQSVLQPVIDDLGLHTTVGQLKGQISVTNPTNTAFVNISVTDGDPAQAANIANGV
AKSLSSVVENTLYASGSRSSVKLSIVQPATVPSTPSSPKWKLNILVGIVGGLILGVFAALLKDVLSKRIQDGDEVGEFID
APIIGRIAEEEMLNSTKPVVVSEPGSPVAEDFRRIRTNLSFMAPVEDTNCRLIVVTSTGASEGKTTMSVNVAAALAENGA
KVLLIDADLRHPSVSKKLDLDGAAGLTHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASTLLNSPIMVELLNNALERY
DYVLVDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLREISDELTTLDLPVNGVIFNCARESKKSLEHSNYYYYYSN
RTVDHRKKRRFSLK
>gnl|bykdb|A0A0B2AI85 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sinomonas humi] (length=470 residues).
MELRDYIRILRTGWVLVVVMALIGVAAASVFSILSKPQFKASAQVFVSTQSGGTVQDLVQGSTFTQQRVKTYAGLVTTPI
VLLPVISNLHLSMTADDLAKSVTATAPLNTTLIEISATSTDPVQAANVANGISESLTNVVQNIESTGTQSAQVKLTRVQE
AEVPSAPVTPNVPINVALGLFVGLALGIGAAVLRHVLDNRIRSDSDVQAISPAPILGGITYDAKASKRPLIVQDDPRSPR
AEAFRTLRTNLQFVDAGEGARSFVVTSAIESEGKSSTASNLAIALDNLGHKVIVVDADLRRPKIATYMGLEGAVGLTDLL
IGRADMEDAIQQWGRGNLHVLPAGSVPPNPSELLGSAAMHSLVARLENEFDYVLFDAPPLLPVTDAAVLSKTAGGAIVVV
AAGRTHRSQLSAAVTTLENVGVRLFGFVLTMLPAQGPHAYGYQTYGYGPVYAQDDVTVGKDSRRMMHRRG
>gnl|bykdb|A0A0B2BAQ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mumia flava] (length=745 residues).
MTQPSAPPQQAAEDGSETDFVAVLDILMESRWLIAIITCIVLAAGLAYAILGKPVFEANIMVQVEDSPDTSAAKSLLGDV
SALFDVKSSAAAEQQILASRLVVERAVDKLHLFIDASPKRFPVIGDWIARHSDGLSDPGLAGIGGYAWGRERIDVPLFDV
PRKNEGDTFTLTRLDGKRYRLEGGDFDAPVEGTVGTLERFRSPRGPILLRVDAIAAKPGAAFVLVRNSRLKTIEDIRDRL
NVQERVKQSDVVVATLQDTDPEWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLNAQLPQLKQQLTDSEARLTKVRNERG
TVDLTEEAKLALAQTADAKTRLLELQQKRQELMSRFTERHPSVTAIDEQIAALSGYRNAAELQIRRLPDLQQETVRLMLD
VRVNTDLYTALLNNMQQLQLVQAGKVGNVRLVDTAAVPEVAVRPKKVLVALASLLLGLLAGCGTAIVRSMLFHGISDHNE
IERRLGLAVYTTVPISEHQRDLAEEAARKSGHKSILSIDFPNEPAVECLRSLRTALQFAMLEAKNNVVLIAGPAPGVGKT
FISSNLAVVMASAGKRVLLIDGDIRKGRLHDYLGFSRGRGLTELIAGSARVDDVMHREVVTGLDFISTGTMPKNPAELLL
NRNLASLVDDLSARYDIVIVDSAPVLAVPDAGILGAFAGTALLVTMAGKTKLGEIGESSKRFAQNGTRLNGVIFNGVNPR
LGQYGYGSKYGGYRYVAYEYGMHDA
>gnl|bykdb|A0A0B2BP84 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mumia flava] (length=741 residues).
MVNTQAKHSYADLSAKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCYIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGAMINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTLPVIGGVAARIATPGVPAKPWLGLKSYAWGGEVA
DVDSISVVPALEGKKLTLTAGPNGTYSVVDQNGMRLLSGQVGEAAQGGGVTLLVSKLVARPGTQFTVVRYNDLDAISGFQ
TGIQVTEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGLILGTGIVFLRRNMFQGIED
PDRIERAFNLPLYGLVPQSAEQVKLDAQAEKSGSRTRPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGLLDRYFGLTSQPGLSELLSDQSALEDAVRETPVQGLSFISAGTRPPNPS
ELLMSSRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0B2BPU3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mumia flava] (length=761 residues).
MNKVLMNRASCPLPETDLGDEPELVRYADLVLTNRWLVAGVAAAVFAVGAAYALLAKPVYESNLLIQVEDNTGSPDSLLG
SVSSLFDAKIQAAAEIEILKSRMVVGHAVENLRLYVDAQPKRFPLIGNAIAKRAHGLSHPGLFGFGGYGWGNESIDIGTF
DVPKAFEGETFELTALPDGRFRLKSGDLDRPIEGVPGQLVESTQAGGTFRIRVDALQARPGAAFRIERLSELKTLQKLQK
HLNVSEIRKQSNVISVSLKGEDPDTVASILNTIGTAYIAQNVKRKSAEAEKSLAFLETVAPQLKQNLEQAEAKYNAMRRK
RGTFNLGIEAQAYLQDSIATQGTLLALQQKRAEASTRFAADHPDMQALDRQIDGAQQKIDGLSARLHAFPDIEQDELRLR
RDVEVGNEMYVGVLNNIQQLKLVSAGKVGNVREVDHAPVPEEPVEPRKALILALSAILGVMLGVTAAVARESLFGGVTDA
SDIERRTGLTVYGTIPDSAAQRAAAASAARRGYVPSLLADEHPYDPSIESLKSLRTTLSLALLDADNNRVLLTGPSPGVG
KSFVSANLAAVMAAAGQRVLLVDADMRRGHLNEAFDVPRTPGLSDLLTGSVSLHGAVRRVSEGLDFMPTGTPSSRTSELL
QGEPTHRLLDEMSAAYDVVIIDTPPVLAVPDASILAPHCATAFLVTRARQTTIDEIAEASKQLSRVSAGLPGVLFNGVDT
RALGYRSRYGAYRYAPYGSTETNGGAPAAAGRRPRTRKEAS
>gnl|bykdb|A0A0B4D7W4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudarthrobacter phenanthrenivorans] (length=516 residues).
MSTTTTPTEASPGLDLADYLAILRVYWKAIVAFTLLATLAAAGWTVLQPKVYSSDSSGIVVTPGSDNVSLALAGDSLAKA
KVKNYESVAKSRLVADRVIQSLDLKTSADALLGSITIKVPLDTAEIKVTAQSTDPATAQRVADAWVNGLAAQVEAIETAP
AADTAGQAGAGQADAATAVRVLPLGKAVLPTSPTSPNTKLNLALGALVGLALGVAYALIRRHLDRRIRKAADIERLFGVP
VIGTLPVDHRLDGKSTIVDAGTAAQLHDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSMQAEGKSTVTANLAVTMAA
AGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWGALPNLSVLGSGRIPPNPSELLGSRAMKNMLTTL
AKDAVVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLDQSLGNLEKVKGRILGAVLNYVPTKGTDAYSYYGTYT
SAAAHPQAEPEPLGEWPEPDALEVPEAIPGGRRARI
>gnl|bykdb|A0A0B5BIW6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=495 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASDGG
ESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRSIVRA
SSLGSVPMDASLDNKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKVNSHSNYYYYYEDG
APRSSHRANGKKKRI
>gnl|bykdb|A0A0B8ZYB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brevibacterium linens] (length=516 residues).
MIVQHYLTILRERWVYALSTAFIVIAGVAGFTALQTPVYESSANVFVRTDPGNSVTDRSAAADYARQQIDTYADLVTTPI
VLDSAIRSLDLDIDAGQLADSVSADVPEDTLLISITARAGGSEESAKLANAVAESLQEQVADLETTSGKATVQLTVVTPA
TAPRVPASPNLTQNFVLGLIAAILAGMLAAVLRDRLDNKVRKADDIEQLTDAAVIGTVPLISAGENHVFVSEHGSQNVQA
EPYRELRSNLRFLEPRRKSRSLLVTSSVKGEGKSVTSINLASALARGGERVLLVDADLRDPSVHRYLGIEGGAGLSTVLI
GDTELKDVVQPMELANLAILASGPIPPNPAELLDSEQMTVFLEEAAKQYDVVVLDSAPVLAATDAVAMATRVSGTVFVAR
NGVVRRTQITQALRKIQLVQARLLGIVLNGVPRTSGTAYSQTYGSSYDPRSTRKEPDTWAHSAEPETSHSKQLAVRQSAA
PPVSDREIPLSVSDSSLRPDPGRRSVFPGIWAISND
>gnl|bykdb|A0A0C2V870 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=495 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRGIVRA
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKVNSHSNYYYYYEDG
APRSSHRANGKKKRI
>gnl|bykdb|A0A0C5BB48 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter toxicus] (length=492 residues).
MKELDTVELRDVLRLLRDHWLAIVAAILLGTLFAFAWSQLQTPRYEANSQGIVSVATSGTSSDQNQAIYTRQIADSVAKS
SLATYLPIATSRAVAEIAIQKLGLDESPESVISAISVTSDTTAPVLKVTASASRPDAAQTLADAWVSAIATRIQQINKET
GIGNSVSLSVVQAAALPAAPAFPNLRLVLAVGALIGLVIGLVYAFIRNTLDRRIRTAEMVERLFELPVVGTLPVDKRLSE
TNRIVPEADTTDYVKSDGKHALAESLRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGD
LRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIIDAP
PLLPVTDGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQLGRGYGYYYTTYYGSERSGAR
PEPVNDPVPSSV
>gnl|bykdb|A0A0D1C095 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. SPG23] (length=529 residues).
MSVNIAPGAEAPAGLDLADYLRVVRVYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNGLAAQVEAIETA
TPETAAPDAGTSPDAATAPAATASAVRILPLGKAVLPTSPVSPNVNLALSLGALTGLALGAAYALVRRHLDRRIRNAAEV
ERLFEVPVIGTLPVDHRLDEKSTILDAGTAAQLDDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSLQAEGKSTVTAN
LAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRVPPNPSELLGSRAM
KNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLAQSLGNLEKVKGRILGAVLNYVPTKGTDAH
SYYGTYASAPETTDVPDFAQPDASVQAGRRDTEAEEVLEPLSAGRRVRN
>gnl|bykdb|A0A0D1J4Z4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium llatzerense] (length=448 residues).
MTISAVIVLALLASIAITVTTTPLYKSSTRLFVSTYAGSSLMDTYQGNLLSQERVRSYTILLTGEALAQRTIDALHLDMS
ARALRQEVSARSKMGTVLIDVDVLDPSPVRARDIANTLSDQFVKMVRELETPGDGSLPDTRVVVEQPAAIASSPAVPNLM
RNLALGLFAGVLLGVACALGREVIDNTVKKHEDLESITGVAVVGDIPMDKARRGTPAISFGTENSQIAESFRKLRTNLSF
LSVDNPPRVIVVTSSIPNEGKSTTAVNIALALVEVEYNVLLVDGDMRRSIAHKHLNVDGAVGLSTVLSGAVSLSDALQET
QFSGLTVLAAGATPPNPSELLASHAAKNLLEELRGKFDYVIVDSCPLLAVTDAALLAANADGALLLGRYGQTKRDQLKNA
TDALQNVGAPLLGSVFVMTPPRSRSAYGGAYYYYGDKRGSNSRHSQKT
>gnl|bykdb|A0A0D5CGA3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. insidiosus] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFIQQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A0D5CJH1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. insidiosus] (length=465 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDRTPQELARAVSVTTPQNTVIMEISVTEESPADAAEIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPLSQSAPNGRTNTLAGLLLGLLAGLLGIALVRLLDTRVRSAETVAHLTPAPLLGALERERGVTGLAMALRPLSTAA
EGFRQLKANLRFVLLGDRASSIVVTSSIPGEGKSTVAANLALSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEEVVQPWGDGTLDVLTSGEIPPNPSELLASTRMEELVARAREAYDVIVIDTAPLIAVADAAFVACMTDGAIVVAD
QTRVHRGQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRMETEQAGRAGQAARPARRATPAR
>gnl|bykdb|A0A0D8BLB2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frankia torreyi] (length=489 residues).
MALMFYLRAVRAHWLVALGVFAMCSVTTGLYVSVQSPIYTAKIQLFVATSSEGASATQLYEASNFSVERVKSYVRIINSP
DVMQAVVNQLRLDQTAEQLAGSVNASTPVDTVLIDVSVTDRSPRGAQEIANAIGAQFPAVVGRIETPNGGQISPXKVSVT
RSASLPAAPSSPRKKVDLLLGVLVGLALGVGTAVVRYRVDRRVRTEAEVSRIVRAPVIGALANDRRINERAPAVDQLSGS
IAEELRRLRTNIGFLSIDRKLSSFVITSALASEGKSLIAGNLAIMMARAGERVVLVDGDLRRPRLAEAFSLPGSVGLTSV
LVGNVPISRALRQWRDDIPLYLLPSGPIPPNPSELLSSTQFAEIVGELVNSGFVVVFDSPPLLPVTDAALIGRVTGGVLL
VAQMKKVRSEQLASASQTLRAAGVNILGVIANRVTKSERVYGYDSIPDSVSAHQTTRRPAYDVVRHDDGLDLATTIIERK
PSPERFPSS
>gnl|bykdb|A0A0F0EUD4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Terrabacter sp. 28] (length=467 residues).
MTFREFLSVLGTRWRIIALSLLAVVAAAAVQTMLTPAVYSSTAKIFLSATQPPGAGTTNQVTTYAVGTDDLARYLDVLNA
PSVIEPLRQRLGLAPETPLSVTGEVSQTSNIMTITATGGDPVLLARIANEAGPVLAEVATKKFSPLLAANGQSVEATPIA
PATVPGEPLSPNARRNLLLGGLLGLALGVGLALLRHTLDTKVRTEDDIKALSQRPILGDIPMVKSSKGGLLSVDSDPHGR
HAESIRRLRTNILFVDVTTGGHSFVITSSVPGEGKTTTTINLALAMADAGSRVLLIDGDLRNPSVAGTMGLDGSFGLTTL
LLGQADPEDVIQRWRQSTLSVLPAGPVPPNPSELLGSEPMEALFGKLSHDYDFILVDSPPVVPVIDAVLIDKLTHGLIMV
VAADRTKKRDLASAVQSLETVDAPVAGFALNMVAAGSSTTHRYGYYGVNADAEPAKQRKRSRRRHRA
>gnl|bykdb|A0A0F0KEG5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium foliorum] (length=457 residues).
MKADATGWSLASAWGAVRKFWFVILGMALIGGAVGYGVSAATPPQYQSTATLYFAMNQGTTGTDLNQGSTYTQSQMLSFA
QLATSSRVLAPVIEDLDLALTPKELTRNIAITIPQDTTILGVEVTSTSAARATDIANAISEELSSAVEEIVAKGVDQKPT
IIPSVIDEAVVPQFQSLPNKTKDAGLAAVLGLILGVLVAFVATVADNRVRNEAALARVTDLPYLGSITRTKRGVTAGLIV
VREPRSHIAEDFRRVQSALAFANIDGQSRRLLITSASPAEGKSTFSANLAVTLADLGENTLLIDADLRRPRIGEIFGLDA
SVGLTSVVLGSAALTEAVIPWREGGPDLLLSGEVPPNSASVLTSHAFAEVLGAASEGHDVVVIDSPPVLTVADTNLVAPL
VDGVVIVVDASKTSRPQLAATIRTLEGAGAPIIGIVLNKVRLARGRTTYYTQEDSPG
>gnl|bykdb|A0A0F0KLV0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oxydans] (length=450 residues).
MGESRVSLRVIASSLRKFWWMIVLCGVIGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLVGVLDTRMRNEETLAEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDHHRSEYYSD
>gnl|bykdb|A0A0F0KYQ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=497 residues).
MNLEDYGRLVRRHWGAIALSIGLGLAVAFGVSALMPKVYTADASGFVVSQSGGSTGIASLGDAYAKSRAKSYVEIAKNRT
IAQAVIGQLDLKTTPQTLVNQISASVPLDTVTLRITAQAATPQQAQDLANAWIRALAVEVQKLESGEVLTEGGAAAPAEG
DPAGAAVVALVPGDTAVLPSAPSSPNLRLNLLLGALIGLALGIAWALVRSTVDKRIRSAAAVESTYDVSVVGTLPVDDVL
AGAGRRLISTSSARADNEHLRLAEALRELRTNIQFLHVDDPPRVIVLTSPVPGDGKSTVVANLALAIAESGRRVVLVDGD
LRRPTVAESFGVSGAAGLTDVLVGSAQIGQVLQRTAWHRNLYLLTSGTVPPNPSELVGTQVMRDLLRELSEHAIVLVDAP
PLLPVTDGAILANQADGAIVVVRAGRTHIDELGKALSNLAKAGAVALGIVINRIPVKGMDRAGYGYYGGGYVGKNAGYVS
ANPDAAPLHEVLAEAER
>gnl|bykdb|A0A0F0L1W1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=577 residues).
MDIRDYLRALRRNWIAIILMTAVGLGAAYGWAKIQTPVYEASVSGLVKSRVTPTDPQQQLAQSTDTYARAKVPTYLVMAG
WRSVAVNAGSTLGLSDSPESLVKRITVTNPEATNIINIAATASSPKAAQQLADAWMKGLVSVIDDTDGIDRQPGTSPVMI
YVAQTAALPEAPIFPSVPTALLIGGLLGLGGGIAFAMIRAISDRRVRGTDDVEQRLGVPVVGIIPKVDSVAAERRIVAED
DAHADSRTDFAVRESLRALRTNLQFMDVDHPPRTIVVTSALPGEGKSTVAANLAMTLAAAGANVVLVDGDLRRPTVASTL
GLVAGAGLTDVLAGRAKLTEVAQTAPDIPNLAVLTAGTIPPNPSEVLGSARMHQLVKDLTKHATVIIDAPPVLAVTDGAV
LANQADGALLVVAVGKTTYDVVDKALNTLEKARGRVLGVVLNRVPVTGRQAGYAYDYREKSSPKETAGKGGKSTDAASGP
KRTGAQPVPVVPADQGPLLPDEEASAQPVEETVAAPASKPRRATARAVRAARTAAPAERGKDPALAADPEAGDLDSLLGD
FIADDAATGPRRQRGRT
>gnl|bykdb|A0A0F0L851 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oxydans] (length=486 residues).
MELSDYFRILRAHWIVILVATVLGAGAAFGWSALQPRVYAADTTGIVTAVGGDGSSGAALVGNQLAQSRVKSYLNLGSWR
AVAEHAIDDLGLEATPESLVSRVSVTNPTDTTALKVTATGATPETAQELAEAWMRGMAVEIEKLEGGTESSPAAVSLIVG
DSARLPTAPSSPNTRLNLIIGALAGLAIGLVYAFVRHTVDRRIRHPRDIERETGVSVIGTLPLEKTMDGERQVIDFSLDT
QHGVSHHTIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVAVNLASSLAAAGQWAILIDCDLRRPVIADIFGISR
DVGLTDILAGRAELQDVAHRPNRDVPLAVLGAGRIPPNPSELLGSHRMQDFLAEISKTAIVILDSPPVLPVTDAAVLAAN
ADGVIVVVSSGKTTFDMLQRAIASIQRTTGRVLGVVLNKVPRKGAESAYYGREYYGAYERYGRETEADDAAKADAEPGVR
RRGRQA
>gnl|bykdb|A0A0F0LA25 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oxydans] (length=476 residues).
MSLQDYLDALRRQWIVIIALTIIGAGAAFGYSRTLPPEYSSTAAVMVIPQRGDSTNELVQGSSYVQSLVQTYAVLASSPL
VLTPVIDDLGLDETATQLAKRVSVVNTLNTVVIEISVTDSDKDRAQEITAAITDSLVSAVADVSPSDANGQPAVRLETIA
PARMPQAPIGPNTRLITLIGAALGLALSVAYALIRRALGTRIAERGDIASVTDAPVIGEIVAWRRNYTVLSTMLRSRDSR
AAESFRALAANLKYVAVDRELQVVMMTSSAPHEGKSSVSIGLAAALAESNHDVLVIDADLRRSSVATQLQLEGSVGVTSI
LVGDATFDEAVQHAQSMNIDIIAGGSPAPNPGQLITSHRLRELVAVARERYEYVIIDSAPALVVSDALWLADLSDGVLVV
TRSGKTRRKQVSAVLSALKSTHKDVVGIVLNAVKRNERGPYYVPEAPPRRWSREAKRANANVSAERNPGDGAAHGA
>gnl|bykdb|A0A0F0LD75 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium azadirachtae] (length=492 residues).
MDLREYLRVFRAHWLGMVLITLLGVAVAFGWTLLQPKVYTADASAIVQANTAGDAGDSNLSSAMLGNSLTSGRVKTYVAL
GQSRAVADGVIKDLGLDVSADQLVKQVTVTNTVDTTTLKVTADAATPEKARDVAEAWVRSMGAEVNRLETSDPGKKGAVF
LSPIDSARLPDSPSSPNTRLALALGGLVGLAIAVGYGLLRYTLDRRIRSVEQVERETGKPVVGTIPEEKTFTADNRLLPF
DGGTSSSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMI
DTVFGLPRGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMRELLKSIAREAIVIIDAPPLIPVTD
AAVLAHSADGAVIVGTIGKTTFEVLGKAIGNLERAGARALGLVLNRVPKRGSGAAYYGYQYHGEYYRGDDQELPTGAVRG
DKPRRRGDAEAA
>gnl|bykdb|A0A0F2C8N7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. SA39] (length=485 residues).
MELRDYARILRAHWIVIIVATIVGAAAAFGWSALQPRVYSADTTGIVTSVGGDGSSGSALVGNQLAQSRVKSYLNLGSWR
AVAEHAIDELDLDTSPDVLVDRVSVTNPVDTTALKVTATGSTPEEAQALAQAWLDGMAIEIENLEGGTSTSPAAISLMVG
DSARLPSSPSSPNTRLNVIIGALAGLALGLVYAFVRHTFDRRVRHPRDIERETGVSVIGTLPLEKSMAGERQVIDFSLDS
QHGVSHHTIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVSVNLASSLAAAGQWAILIDCDLRRPVIADIFGMSR
DVGLTDVLAGRADLQDVAHRPSRDVPLAVVGAGRIPPNPSELLGSHRMRDFLAEISKSAIVILDSPPVLPVTDAAVLAAG
ADGVLIVVSSGKTTFDMLQRAIDNITRTTGRVLGVVLNRVPRKGAESAYYGREYYGTYEKYAQSEDEPDAEEKSPGVRRR
GTAQV
>gnl|bykdb|A0A0G9MCI5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=494 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRGIVRA
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIEFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYYYYEDG
APRSSHRAKGKKRH
>gnl|bykdb|A0A0J6DDB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas sp. A375-1] (length=471 residues).
MTLHDAVLAVRKHWLWVLAPILVLTLGIGYLSERAEPVYRARTALFVALTVGDSASDLNQGSNYTQAQMLSFAELASLPI
VLDPVVEELGLTTSARALAGSISATTLNGTSILNIAVTNPSPQVAADIANAVAGELTTVIAQVAPTTTEGTASIRATIVD
QAVAPKRPASPNVERNVIAAALAGLILGLAAAYVRQAFDTRVRRPEELEAAIDVPLLGVVRGVRRSELEVRVGDAVLNGP
QAEEFRRLRTNLQMVGERGAPRMFAVSSAVEGEGKTHTNLRLAFSLAAAGDRVLVIDADLRRPAVADRLGLEGAAGLTEC
LVGRAEFDEVVQHLGDGPSILASGATPPNPGELLASKEFAALLEQVADEYDAVFIDTPPLLPVADAVVVSRQVAGLILVV
DAHKARRPQLTRAVDAVHRGGGRVVGAVLNRSRTAQEESYVYGSPSRRTRRWPRSERVDGAHTRAKAGQTG
>gnl|bykdb|A0A0J6WEP7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium obuense] (length=493 residues).
MSIQDFFKLLRARWMIVCAATVVAVLGAVVLSLMTTPLYQASTRLFVSTTSGSSLSDIYQGNRLSQERVVSYAQLLTGVT
LAQRTIDKLGLDMDASELQENISASAKPETVLIDVSVLDKSPVRARDIANTLSDEFVAMVRELETPESGAAPDARVVVEQ
RASLPDKPVVPRIKRNLAVGLALGIVAGVGLAVLRDLLDNTVKSRETLEDITGVGLVGSIPMDKDRRKQPAIAFEGDNSA
IAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPHEGKSTTAINIALALAESERSVLLIDGDMRRPTLAKYMDLVGTVGFSTV
LSGAASVEDSLQKTRFPGLTVLTSGAIPPNPSELLGSQSARKLLTELRSKFDYVVIDSTPLLAVTDAAILAAAADGVLIM
ARFGQAKRDQLAHAVGNLESVGAPLLGAVFTMMPVRGRSSYSYSYTYYGTDAAQASGRHGGAQSSELSRTSEKADAEAGA
DGAMDATPPKRRQ
>gnl|bykdb|A0A0J6WM28 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium chubuense] (length=474 residues).
MTLVTTPMYQATTRLFVSTTAGNSVTDIYQGNRFSQERVISYTELLMGQTLAQRTVDKLGLPMTGDQLKSRVKASAKPDT
VLIDLAVQDESPVRARDIANTISDEFVVMVRELETPENGSTPDARVVVEQRASIPADPVVPRTGMNLMAGLAFGLVLGVG
LAVLRDLLDNTVKEAKNLEDITGAGVVGTIPLDKERRKTPAIAFESDNSAIAEAFRKLRTNLQFLAVDNPPRVIVITSSV
PSEGKSTTAINLALVLAEAEHNVVLVDGDMRRPSLDKYLDLVGTVGFSSVLSGAVSLDEALQKTRFPGLTVLTSGAIPPN
PSELLGSQSARMLLNELRSKFDYVIVDSTPLLAVTDAAILAAAADGVLIIARHGHTKRDQLAHAVESLQNVGAQPLAAVF
SMMPARGSSSYTYQYTYYGEAPNALRAPKKVAAAPPTSKPVPTDGALDTSDAASQSASETETSRSGGRRRRQDD
>gnl|bykdb|A0A0L0BIN0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. RIT-PI-e] (length=487 residues).
MELSDYLRILRRNWLLITVCTVVGLLIGALASFMVRPTYTAETKLFMALQSSGSVQELQQGNTFTQARVQSYVDTVNESL
VLQPVIDALGLDLTTGQLSQKITATADLNTVIITIAVDDTSPVQAAAIAQATADSLMIAVDELERPSEGGSSPVTSTVIA
PAIAPSEPSAPNTPLNLALGLLVGLALGAGAAVLRTTLDTRVRGESDLRRASEAPLLGGIAFDNDAVKKPLLTQVPGQSP
RAESFRQIRTNLQFAHVSHKSKAVLVTSSLPGEGKSTTATNLAIAIAQSGQSVVLVDADLRRPRVDEYLGLERNAGLTTA
LIGRAEVEDLLQPWGTDELYILTAGQIPPNPSELLGSDAMKRLITRLEEKFDAVIIDAPPLLPVTDAAVLAQQVGGVVLV
IGSSKVRLPDLQKSLGNLEMVEADLLGVVINLLPSKGPDAYAYSYYSYEAKEAPALKSPGRVGRGSSSKASPDANEKALN
ASPSRDH
>gnl|bykdb|A0A0L0LU29 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0L6I3R0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. GCS4] (length=474 residues).
MTLQDYIDALRRQWIVIVALTVIGAGAAFGYSRTLPPEYSSTAAVMVIPQRGDSTNELVQGSSYVQSLVQTYAVLASSPL
VLTPVIDDLELDETATQLAKRVSVVNTLNTVVIEISVTDTDKERAQETAAAITDSLIGAVAEVSPSDAEGAPAVRLETIA
PAREPQAPIGPNTRLFAVIGAAIGFGLSVAYALFRRVLGTRISERSDIAAVTDAPVIGEIVAWRRTYTILSTMLRSRDSR
SAESFRALAANLKYVAVDRDLQVVMMTSSAPHEGKSSVSIGLAAALAESNHDVLLIDADLRRSSVATALQLEGAVGVTSI
LVGDVTFDEAVQHSEAMNIDIIAGGATAPNPGQLITSHRLRELVAEARERYEYVIVDSAPALVVSDALWLADLSDGVLVV
ARSGRTRRKQISAVLSTLKSTKKDVVGIVLNAVKRNESSPYYVPEAPSRTWSRSPKRKKAALTAGETDRDAADA
>gnl|bykdb|A0A0L7AYJ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve MCC 1128] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0L7BSV7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium animalis subsp. animalis MCC 0483] (length=515 residues).
MRLKRKPRDSSDLSGASMLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYT
AMSPVAYTTTTQLFATYNSSNDSANSSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTN
TAFVNIAVTDADPSTAARIANGVAASLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKPSSPKWSLNLLAGILGGLIIGIL
AALLKDVLSKKIQDESDVTDIVDAPIIGRVVKDDILTGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLIVVTS
AGASEGKTTTSVNIAAALAEDGSRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKP
PNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGV
IINCAKENKKALENSNYYYYSNSSPAEKNRKNRKS
>gnl|bykdb|A0A0L7BTF3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve MCC 1340] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0L7C1M1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve MCC 1454] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0L7D1M8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve MCC 1114] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQSAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNPKVDSTDDVRELTHASSLGTVPQASILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0M0VLI6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILNDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0M2RDC0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. HK10] (length=484 residues).
MDVLGYLRLVRRHWWIVLVTLMAALGTAAVITVRTAPRYEASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAENPLGLTADQVQRRISTTTEAGTVLLRATFTDTDQTRALKTTETLSAKFVELVQKVETPPDGKAPPIKLELVSG
PRVSSSPVSPQPVRNLIIGALLGLLLGAGLAVLRGLADVRMRDAAGLQRVTGSPLLGEIPFEAGAKSAPLIVGEAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAARALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPPAPAVPTDRAGVRRGGHAADGVGDRTQELT
RLSR
>gnl|bykdb|A0A0M3DDN8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Ag1] (length=445 residues).
MSLRVIASSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQLATSSR
VLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTITAQVID
DAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLIGVLDTRMRNEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQEPLGH
TSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSIGLTSV
LLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVADANLFATQTDGVILV
VDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A0M3T8W0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQSAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNPKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0M4HAE8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. capsici] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMFVAPSSSGNVQELQQGNNFTQQAVKSYADVVTTRA
VLQPVIDQFGLDITSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A0M4LFJ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. infantis] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTSNDMSYGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQAAILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELRSTATALQTAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0M4N206 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIIRKHLASAIISFVVVFAAVAAVAFIMPPKYTATAEAFATYAGQSGETQTINDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTAANPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVHELTHASSLGTVPQASILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A0M5JNB0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. capsici] (length=462 residues).
MTLHESTALLRRLWYVVVAATLVGGGVAYGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDVTPQELARAVTVTTPQNTVIMEISVTEPSPAEAADIANAVAASLRDTAESYAPKGAEGSPTVSVRVIQ
EAPEPQSQSAPNARTNTLAGLLLGFLAGLLGLALVRLLDTRVRSAEAVAHLTPAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVATNLALSLSEGGRRVLLVDADLRRPVVAQYLGLVGDAGLTTVLV
GQALLEEVVQPWGDGTLEVLTSGEIPPNPSELLASARMEELLVRARATYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETERAGRAARKARREPAAR
>gnl|bykdb|A0A0M8KP53 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. SW0106-09] (length=586 residues).
MELQQYLTILKERWSTVAIAAVIVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQIITYADLAKTPI
VLDPVIEELGLDLTAEQLADRISTRIPEDTLIIDITASSVDPQVASAIANATSESLRTQVSTLEAPTQEAAATGTTEDGL
EAVPSTVELTVISSAATPSSPASPNIPRDLALGVLLALLAGLAAAVVRDFLDNRVRRPADIEALYDLPVIGSIPSVHSSQ
NVALIAAQKPSSVQAEAYRELRTNLHFMLIADRMKTLLVTSSLSGEGKSSTAINLAQVLAQAGDRVLLVDADLRRPSLAT
ELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVVVDTAPLLAVTDA
VALSRFVDGSLVVAQCDRVKKQQFGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPDEESSEPAVSVVPAEDRPAEAW
PEDARPSGSASSEHRHEEALEAEEATGDRPEALPAARAARPTAMHGGRPAAPRRRAVRRPEATRPDDSRQSGSDRSSGGT
HEADVPAGGPALTVSGGAGRQGARSA
>gnl|bykdb|A0A0M8XEP1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. NRRL B-16802] (length=486 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVSEAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQRRVSTSTEAGTVLLRASVTDTDQARALRITETLAARFVDLVQKVETPPDGKTPIKIEVVSGP
RVSASPVSPQPVRNLVLGGLLGLLLGVGLAILRGVADIRLRDSAGLQRATGSPLLGEIPFEATARTAPLIVGEAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVSQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVPKAEAYQYEAYRVVASTATPSVPTDRATSARHSEDAGVNGVSDRTQE
LTRLPR
>gnl|bykdb|A0A0N0KVZ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. RIT-PI-h] (length=479 residues).
MELRDYITVLRKGWAFIVVMVLVGVGAAAAYSLVKTPDYSASAQVFVSTQTSGSVADLAQGNTFTQQRVKTYASLVTTPI
VLLPVISSLGLNITAEQLAESITASAPLDTTLIQIDAVSDDPVRAADIANATSQSLTNAVEQIESTGDSGGSQVKLTRVQ
EAQVPVSPVSPNVPLNIALGFLVGLAIGIGIAVLRHVLDNRVRNESDVERISPAPVVGGIAFDPKAQSRPLIVQADPRSP
RAESFRTLRTNLQFLDLGGRARTFVMTSSVQSEGKSTTVANLAIALDSAGAKVIVIDADLRRPKLGQYMGLDDAAGLTDL
LIGRAELADVAQPWGRGQLHVLPAGQIPPNPSELLGSRAMSDLIRELETRFDYVLFDAPPLLPVTDAAILSKSASGAIVV
VSAGKTHKNQLAGAVSALESVGAPIAGFVMTMMPTKGPDAYGYGRYGGAYGYGIDDDGDTKAEKKERIRVGSAARKAAK
>gnl|bykdb|A0A0N0RHI0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. SW0106-09] (length=575 residues).
MTIEDFLRLLLRNLLLLVAGLVLGAAAGYGLSFTQSTTYSASALGYVSASAQSDENGDPIQQASGNMQFQYSKAQSYLPL
FNTRAVGQRIVDELGLEASPDEVAGSLQTTLDPNAPIITVEAVAPTAEEASAIANAAVEATAAEARELETGGNENAAVGV
QLTNYQNAVVPGAPVSPDREKFLIAGAAFGLLVALGLAWLRDRNDSRLRTADDVTDVVGLPTLGALPDAKELARGKDGVL
PEPASFPSREALRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSTVAANLARVMARAGQPTLLVDADLRRPMIAQQFSVDG
EVGLSQLLAASVSLEDVAEPTTVPLLTLLPAGQIPPNPSELLGSRRMQELIEELSRQYFVIIDAPPVLAVTDAQLLTRHS
DGAILVAVPGQTRTAAMQKAVEAIRAVNGTVYGAVLNRASTGRLNRLAYGDAVYGYSAYGKYGYGALGGYDESAVVPDSE
EADVELAGGPAEPGPASAPAAAVAAPDAPRPADTEAPRRAAQASPRPEAQPVAHPARAADESAPVEHDENEPEGDSAPAA
RTSPRGRRAASTWGR
>gnl|bykdb|A0A0N6ZW80 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MR_MD2014] (length=482 residues).
MELRDYITVLRKSWALILVLALVGVAAAAGFSLLKKPVYSAEAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLGLDMNADELSKMVSATAPTSTTLISITVNGTDPVQATNIANATSQSLTNVVEDIEATDENGSSSVKLTRVK
QAQVPSSPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRVETDVEKISDKPVVGGIAYDNKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFKVILIDADLRRPRVGEYMEVDGSAGLTDV
LIGRASLEDVAQPWGRGNMVVLPAGQIPPNPSELLGSKAMQDLIETLEQQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGLDEEEPPQKSTKSPGKTRGKLGVVRRA
DR
>gnl|bykdb|A0A0P0DHN7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. No. 7] (length=502 residues).
MDVNQYLRIFRAHWLGIILLTLAGVVLAYGWTMFQPRVYTADSTAIIQARTAASGDNSLGEQSLANIVAQGKVKTYVDVG
TSRRVAERTISDLGLDTTPEALVGSVIVTNPLETVSLRVSATANTPEGARDLAESWVRSMAAEVNVLETKDPEVQGATFL
TAMDSARLPTAPSSPNVRLALAIGGLLGLVAGIAYGILRYTLDRRIRSVDGVEKATGVAVVGTIPEEKSFTTDDRLIPFD
GGNSVKSRNAHLFGIAEAMRELRTNIQFMDVDNPPKVMVVTSPLPGDGKSTTASNLAITLAANGQRTILIDGDLRRPMIS
TVFGLVEGAGLTDVLAGRAELADVAQTIGRNRNLVVVGAGKIPPNPSEVLGSERMRELLAALSEQATVIVDAPPLIPVTD
AAVVANRADGAIVVTTVGKTTFEVLGKALSNLERASARPLGIVLNRVPRKGSGAAYYGYQYHGEYYRSNDETQPADDAAP
LRRTPFESAPAPRAESRRAARR
>gnl|bykdb|A0A0P7FX18 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Edens01] (length=490 residues).
MDMREQILILRRNWMLIVSFALSGLIAAAVVSVAMPKAYTASSSLFVSTQNVDTSAELQQGSAFALARVQSYVNLASKPQ
VLDPVIEELELNTSSAELAKNVKASTSRNTVIIEIKAVDSDPQRAADIANGVVSSLILAVADVERPTNGTPSPVRLTSVD
TAQAPSAPSSPKTSLNLALGLLYGMAAGLAVAVLRNVLDRHVRTEADLRRSTSLPLLGGITESEAPKGSSAPFVLGGSGT
DAFRQLRTNLEFAAVGHAMKSLLVTSAQAGEGKSTVSLNLALSMAQSGRRVLLVDADLRLPSVADATGLEPSVGLTTVLV
GRTNLSDATQHWGNAGLSILTSGPLPPNPTELLASSTMQKLIGEMEAAYDVVIFDAPPVLPVADAAILTRHTDSLLLVVG
ARKVSQHNLSKAVEQLNLVKANVIGVVLNGIPRSGPDANSAYLTDYGAVPASPLDGEQHSGRPSSPIAEAAEVVNGDRGR
NSRRKQAVKN
>gnl|bykdb|A0A0Q3BEY5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia kristinae] (length=486 residues).
MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILSGDSAAQAKASAYLPLVTSGP
VAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATASSPQDAATLANNALQATADYVSDLEGRESAVKVTPLDDAQA
PDGPVSPSYRNYLLIGAAVGLVLAYLIAFLRKFADVRVRTTDDLENATEAGTLGILPKSSALDENTFLSDRADHQSEEAL
RQLRTNLRFVSVDAPPRSIIVSSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFGLDDAVGLSQVLSGQI
GPEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDGSLLSANVDGAILVNVCGRT
RKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGYGGYRSGYQAYYGQDGEGSGSGSSPAAGGKHGAKGRGRRA
RTSHSS
>gnl|bykdb|A0A0Q4FGF8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia sp. Leaf210] (length=466 residues).
MELRDYVRVLQKSWILIAVLLFVGIGAAAGFSILQTPKYSSSAKVFVSTSGGSTASDLQQGNTFTQQRVKTYADLTTTPI
VLLPVIAELGLDISSGELASQVTASAPLNTTLIEIAVTNVDPALASQIATAVSESLSQVVEKIETPANSGSETSPVKLTL
VQHAEVPQVPVSPNIPLNIGLGGLVGLALGIAIAVLREASDNRIRNERDVEAITDVPILGGIVFDPKAAERPLIVHDDPR
SPRAESFRTLRTNLQYLDVGRENRSFVITSSIQSEGKSTSAVNLAIALADAGSRVLLVDADLRRPKIHEYLGLEGAVGLT
DLLIGRAEPEDVIQPWGQRDLFVLPAGTIPPNPSELLGSDALLKLISEFNRAFDVVLFDSAPLLPVTDAAILARTVGGTI
VVCAAGRTHKNQLKGAFTALANVDAPVSGVVLTMLPTKGPDAYGQGRYGYGYTYGDASLPGEMASK
>gnl|bykdb|A0A0Q4HBI5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces sp. Leaf222] (length=481 residues).
MELRDYIRILRQSWVLIVLLTLFGVAAGAVFSILQTPMYSSSAKVFVSTSNGGTIGEMAQGNTYTQQRVKTYADLTTTPI
VLLPVIADLQLDMTSDELAREVTAVTLPDTTLIEITVTDENAALTAEVATAVSESLTNVVSAIETTGANAEDTGEDGAPA
EASPVRLTLVQHASVPQKPVSPNVMLNIVLGGLIGLALGVGAAVLRETLDTRIRNERDIEQVTDAPVIGGIVFDPKAKDR
PLIVHADPHSPRAESFRALRTNLQFLDAGRPDRSFVVTSSIESEGKSTTAANLAIALADAGARVLLVDADLRRPKVASYL
GIEGAVGLTDLLIGRAELQDVIQPWGRSQMYVLPAGRVPPNPSELLGSQVMAETVKELNRAFDVVLFDAPPLLPVTDAAV
LSRAAGGAILVVAVGRAHKGQVKGAFSVLENVDANVSGIVLTMLPMKGPDAYGYGRYGYGYGYGYGYAPKEEPKQETAAG
A
>gnl|bykdb|A0A0Q4LKJ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf44] (length=467 residues).
MELRAFVAVVRSSWQLIVVLAIGAVLVGAVASLLTTKTYSSRTQLFVSVSSLGASDAGDLVQGSSAAQAKVRSYVDVVTS
GRVLQPVIDEWQLDTTPAQLAARVEASSPVNTSLITIRVTDTDPARSARLAGAVAASFETVVEDELERPEGGGSSLVTVE
TLDEPVVPTTPTNPRPVLWIGLAAAVGLLGGVVLALLRSTLDTRIRGKGDVEALGDTPVIGAVGFHADASTTPLIVHDEP
RSPLAESFRALRTNLQFLAFEGSRRSFVVTSAMPSEGKSTTAANLAVCLSETGASVLLVDADLRRPRVAEVMGLEGAAGL
TDLLVGRAELDDVVQPWGFLGLRVLPSGSVPPNPSELLGSMAMVSLLTEIEAAYDFVVIDSPPLLPVTDAAVLSRCVSGV
VVVAAARRSTRHQLRQALTSISEIGSRTLGVVLTMVPARGAGAYGYGSYTGYFTTQSATPGPEERRR
>gnl|bykdb|A0A0Q4M3J4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf44] (length=464 residues).
MDLRDYARLARRSWWIVLIASAVGAGIALAISSVVTPRYVSTAQLYVVVRASGDATTGDVVQGSTAAQQKVLSYVDIASS
SRVLGPVIDELGLDVSSRELAESVTATSPEDTALVVIEAADPSAEQSARIADAIATTLSRVVDSIENVETAGVVRLELVQ
GADTPDSPESPRPVVNTALGALLGSVAGLGLAVLRSTLDTRIRTAAAAEAASGAPAMAAITYDPDIQRRPLIVHSDPHDH
RAEAFRTLRTNLRFASVGGHLTTLVITSPSQGEGKTTVACNLAIALADSGARVVLVDADVRRPQVADRMGLEGAAGLTDV
LIGRAEVDDVLQPWGRDRLMVLPAGAIPPNPSELLGSQGMSTLLTDLAHEFDHVVIDAAPILPVTDAAVVSTVADGALMV
IAASRTQISDATAARAALDRVGGRVVGVVLSMVPTKGADAYAANNSYYRAESRHETGASSPSGR
>gnl|bykdb|A0A0Q4MAN1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf44] (length=479 residues).
MELRDYITVLRKGWAFIVVMVLVGVGLGAAYALIKAPDYQASAQVFVSTQTSGSVADLNQGNTFTQQRVKTYASLVTTPI
VLLPVISSLGLNITAEELAEDISASAPLDTTLIEINARSRDAVMAANIANATSQSLTNAVEQIESTGDGSGSQVKLTRVQ
EAQVPVQPVSPNVPLNLALGLLVGLTIGIGIAVLRHVLDNRVRNEADVERISSAPVVGGIAFDPKAQSRPLIVQADPRSP
RAESFRTLRTNLQFLDLGGRARTFVMTSSVQSEGKSTTVANLAIALDSAGARVIVIDADLRRPKLGQYMGLDDAAGLTDL
LIGRAELADVAQPWGRGQLHVLPAGQIPPNPSELLGSRAMADLIRELETRFDYVLFDAPPLLPVTDAAILSKSASGAIVV
VSAGKTHKNQLAGAVSALESVGAPIAGFVMTMMPTKGPDAYGYGRYGGAYGYGIDDDGDTKAEKKERIRVGSAARKAAK
>gnl|bykdb|A0A0Q4TNQ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf254] (length=469 residues).
MELKTFITVVRTRWVLIVVVTLSAVLLGATASLATAKSYSSSTQLFVSVSSIGSSDAGDLVQGSSAAQAKVRSYVSVVTS
GRVLEPVIADLGLDTTPAGLASKISAFSPVNTSLIDISVTDGDPAQAARLADAVATSFEKVVEEQLEQPVGGGSGLVTVE
SIDAPVVPTSPANPKPVLWISLALGLGILSGTALALLRNTLDTRIRSKADVEGVTNAPLLGGIGFHTEASSAPLVVNNDP
RSPLAESYRALRTNLQFVSFEGRSRTFIVTSAMPGEGKSTTAANLAVCLAETGASVLLVDADLRRPRVAEVMGLEGAVGL
TDLLVGRAELVDVVQPWGRLGLHVLPSGTVPPNPSELLGSLAMASLVSTVEVDYDFVIIDTPPLLPVTDAAVLSRCVSGV
IVATAAQRSSRHQLKQALAAVSEIGSRTLGVVLTMAPTKGLGAYGYGAYGGYYGSVTENSVPASTAAAR
>gnl|bykdb|A0A0Q4UN39 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. Leaf261] (length=473 residues).
MDLIDYAHVLRKNLLLLIATTLVGMGAAGGIAAAQTPTFTATTELYVSVRFGSEVASVELADGSAFARQAVLSFIDVVDS
EVVLGRAEKNLDFPASTADLAKVVRASSPANTVVVEIAADDADPAHAAAIANAVGKALAETIQEDLEAPAGGGPSRINVK
TIQPAPVPSIPSAPEVELMIAIGAALGLALGVTAAMLRTVLDTRIRRASDLEEATRLPILGTIGFDPDAAVRPLVVHEEP
RSPKAEAFRRLRTSLQFLNVGDSPNTFLVTSSTPSEGKTYMSANIALALAETGASVVLVDADLRRPRVAQRFGVEGGAGL
TDLLIGRAEFEDVIQPWGTGGLSLLASGRVPPNPSELLGSVAMEETVRALEAAFDYVVIDAPPVLVVTDATVLSRLAGVL
LVAAANKVRKPELVAALRVLEGVSATVHGAVATMLPSRGPDADAYAEHLYYGEDAEIAAAPVTRGRARRGVRA
>gnl|bykdb|A0A0Q4UQV7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. Leaf261] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGYSIVKQPEYAASAQVFVSTETSGSAADLAQGNTFTQQRVLTYSNLVTTPI
VLLPVISSLKLDMTAGELATLVSADAPLNTTLITINVTDTDPVQAADIANATSQSLTNVVQNIESTSENGGSTVKLTRVQ
EAQVPSAPVSPNVPVNVILGLLVGLALGVGIAVLRETLDNRVRTEQDVERISDAPIVGGIAFDSKASVRPLIVQADPRSP
RAESFRTLRTNLQFLDLEASSARTFVMTSSVESEGKSTTVANLAIALDSAGYKVILIDADLRRPKIATYMNIEGAVGLTD
VLIGRAVIEDAAQPWGRGTMRVLPAGKIPPNPSELLGSRTMQLLIEQLETEYDFVLFDAPPLLPVTDGAILAKKASGALV
VVAAGKTHRNQLAGAVSALENIGAPVAGFVLTMMPTKGPGAYGYGRYGYAYGYGLDENNDENEVETPKKPSGFGPMRRAT
R
>gnl|bykdb|A0A0Q5ASZ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. Leaf294] (length=484 residues).
MELRDVLRLLRDHWLAIVAAILLGTLLAFGWSLTQKPRYVADSQGIVSVDVGSGDPSQAVYLRQISATVANSSLKTYLPL
ATSRDTAEIAIENLGLDVSPSALISAITVESETDAPVMNITASASTAEGAQKLADAWVAAVATRIQQINAETGAGDTVSL
AVVQAAALPSSPAYPNLRLVLAIGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVPEA
DTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAK
SFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDG
AILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSERSGARAETVPEPA
PSAV
>gnl|bykdb|A0A0Q5BQW6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. Leaf299] (length=471 residues).
MPIVAAILLGTLVAFGWSLTQKPRYEADSKGLVTVAVPDSGDGSQDLYGEQIAEALAKSRLTTYVPIASSRDVAEIAIEN
LGLDISPSALISAITVTPEAAAPVLNVTAEASTADGAQKLADAWVSAVATRIQQINAETGTGDSVSLKVIQDAALPGSPA
FPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIIPEADTTDYVKADGKHA
LAESLRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDL
LIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDGAILTARTDGALVV
ISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSEKTGARPESASEPTPSAV
>gnl|bykdb|A0A0Q5CBC0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frondihabitans sp. Leaf304] (length=472 residues).
MQLNDYIRIVRRRWATIVVVTLVAVSCAAAYTITATKTYVASTQLFVSVQAADASSAVEAVQGTSAAQEKVRTYVGVIKS
STVLAPVIKKLHLTTTPAALADRVTATANSNTTLMDVAVTDTDPQRAAEIANAVGASFTTEVLDLESPLAGGSSLVKVRT
IEPAVVPGYPSSPRVLFTLALGGLIGLAAGFSVAVLRSALDTRIHGSSDVEGITTVPILGGISFDPSIKNRPLIVRADPR
SPRAEAFRALRTNLQFVDIGATKRCFVTTSSVPSEGKTTTTANLAIAIAESGATVVLVDGDLRRPRIAEIMGLEGAVGLT
DILIGRVELEDALQPWGRGSLTVLPAGSIPPNPSELLGSAGMHALIRELTAAYDYVLVDAPPTLPVTDAALLSTVTSGAL
VVAAAGRTTKNQLRSALDNLERTGSHPAGVILTMLPAKGPNAYGYGSYDAYYGIDGKDPSLETDALISGRHR
>gnl|bykdb|A0A0Q5CM05 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frondihabitans sp. Leaf304] (length=478 residues).
MELREYITVLRKGWILILVLALVGVALAATYSLVKKPVFSATAQVFVSTQSSGSVSDLVQGSTFTQQRVTTYANLVTTPI
VLQPVVASLKLDMTAEELAQIVSADAPLNTTLIQITATSTSGVQAAEIVNATSQSLTNVVQNIEATGKDDASTVKLTRVQ
EAQVPTSPISPKVPLNVILGLLIGLAVGVGLSVLRETLDNRIRNEGDVEKIHSGPIIGGIAYDAKTSSRPLIVHADPRSP
RAESFRTLRTNLQFLELEGKARTFVMTSSVQSEGKSTTVANLAIALETAGYRVVLIDADLRRPKIADYMGLEGAVGLTDV
LIGRFDLSDAVQPWGSGNLHVLPAGQIPPNPSELLGSRRMQDLLSTLEASYDYILFDAPPLLPVTDAAILAKRASGAIVA
VAAGQTHKNQLSGAVATLENVGAPIAGFVLTMMPLKGPNAYGYGRYGYGNYGYGTSDEAVAPARGGLFRRGPSRQATR
>gnl|bykdb|A0A0Q5E3I1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. Leaf314] (length=463 residues).
MTLHEYVQTLRKYWVLIAVLVVVGCATGYVVAKTQVPMFRSTSSVLLSAERGESTSELAQGSNYVQSLVQTYALLAESNL
VLQPVVDELDLDTTVARLSKSVSADSPLNTAIIEISVVDSDPSRAKQINDSVVASLSSAVADVSPQDDQDQPTVRLTSIN
SATLPNAQFSPSSTLYAAVGGAIALLLGIVFAFVRRALSTRITDGADVAHDTAAPILGEISEARRGAPVLVSLRTNPQGL
VAESFRTLSANLRFASIDRPIRSVVVTSAQPDEGKSSVAIGLAQQHAESGQRVLLIDADLRHPTVATYTQLDGTVGLTSV
LLGQHDLQDAVQSWGSDTLDVLTAGTTPPNPSQLLSSSSMRLLLEQASSDYDLVVIDSAPIITVTDSLWLGNMADGMLIV
VRERFTRHRHLAKAVSAVEGARAELVGIVLNRVKRGDRNSKYYTSEVESVSNIRHAVAERLGR
>gnl|bykdb|A0A0Q5E5W5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. Leaf314] (length=523 residues).
MDLKDYLRIFRHRWLLIVAITAGIAALAHGYTLVTKPVYQSTAQLFVAVKSGDSVGELNQGNTFAQSRVSSYVILATGST
VRTMVAERLDLDPATLVGAISAANPAQSVLINISALDSDPVAAARIANTASEVLVDLVDDVESTDAASSTDAAGGPTPVG
LTIVEQASPPWSPVAPNPLQNLAVGVFIGLALGVGTALLIEVLDTRLRGRAAIEKLTDTSILGTFTAEPADTPQLILGST
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSIPGEGKTTTAANLALVLAEAGNSVLLVDADLRRPRQHELFGLEGSV
GLTTVLTGRISLDEAAQSVNGAGRLAVLTSGELPPNPSELLGSAAMERALAEMERTFDVVVVDTPPLVNVSDPTALSTLA
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEASRGGQSYSYSYYDRIPEPGTTAPKRRTRRKTAPTDAPD
TRRPAAAPALRRTPEQQQAQRELPGVTPPVDSSSSRRSRRERV
>gnl|bykdb|A0A0Q5EDZ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. Leaf314] (length=460 residues).
MELSDYLRILRKYWVLILALALTGLAASALYSLSRTPEYSSSAKVFVSTQATDSLSELSQGNTYSQQRVKTYVNLVSTPI
VLQPVIAALELNMTAGQLAGQVSATSTADTTIIEITASNADPVLAAELANTTAESLTGVVAKIESSEDGASSPVKLTRVQ
EANVPTQPGSPNVPLNLIMGTLLGVALGVAFAVLRTTLDTRIRNERDVESVTDIPLMGGIAFDPKAKQRPLIVQADPKSP
RAESFRSLRTNLQFLDVSDQPRSYVITSSIQSEGKSTTAANLAIALADAGHRVIIIDADMRRPKLASYFDLEGAVGLSDV
LIRRATLEDTMQPWGRGALTVLPAGTVPPNPSELLGSSVMQKLITGLEKQFDYVLIDAPPLLPVTDGALLARHTGGALVV
VAAGRTHKNQLKGALESLVHVNASVAGLVMTMVPTKGPDAYGYARYGYGAGYGYTEDVKA
>gnl|bykdb|A0A0Q5HN28 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Leaf137] (length=521 residues).
MSSTAAPAEAPAGLDLRDYLLVVRTYWKGIVSLTLLATMAAMGWTVLQPKVYASDSSGIVVTPGSDNVSLSLAGDSLAKA
KVKNYESVAKSRLVADRVISALQLNTSADALLGSISVKVPLDTAEIRVTAESTDPATAQRVADAWVNGLAAQVEAIETAP
AAEAGSEAASDAGTAAGATATAVRVLPLGKAVLPASPTSPNTKLNLALGALVGLAFGMAYAVIRRYLDRRIRDAAEIEQL
FGVPAIGTLPVDHRLDARSTVLDAGMSANAHNGGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQSEGKSTVTANLAV
TMAAAGEKVVVVDGDLRRPTLVDVFNLVPGAGVTDVLAGTAELEDVLQPWSALPNLSVLGSGRIPPNPSELLGSRAMKNM
LTALAQNATVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGKTTQDQLAQSLGNLDKVKGRVLGAVLNYVPTRGAGSYSYY
GTYTAAPENAAGTAIPPLAAAQDEAMDGTLEAALTGRRARV
>gnl|bykdb|A0A0Q5I075 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. Leaf325] (length=538 residues).
MDPRMYLSALRRRWPLIIVLGLLGAAIAFFYDSTLPTLYKSTASVFVSTQRGDTTSELVQGSNFAQANVQSYAQLATSPV
VLNPVIDELDLDTTANGLASVISADTPLNTVIIQITVQNSDPARAAMIADAVTDSLSTVVEEISPTSADKTPAIKMTQIS
PAQVPAAPFAPNTRFIVATGLAIGLALGLVLALIWELLDTRIRSEKELTAITGLPVLGAVAKGPSKKPGWIAMRSDSHSM
QAESYRRIRANLEFADIERAVRSVIVTSATAGEGKSTTSLNLALAMAERVGRVLLIDGDLRRPTIAERCGLEGSVGLTTV
LLGKVSVADAVQRYARTVDVLASGVIPHNPGQLLGSSAMAALLAEVSSTYDFVVIDTPPLLAATDTLGLAHATDGAIIVV
KYKSTRRQQLAEAVGSMRAVNARLLGVVFDRIDTPKAIEYYSYHAKGSTGGPDRSESAPDDVDESTTPVTTPASRDDAST
APPAPVDEIEDATSRPGPAPAGESRDTPPATSRTKKPRRATSDVIHTSDAGATVVVES
>gnl|bykdb|A0A0Q5KMI7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. Leaf154] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVEGTDPVQAANIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSTPVSPNVPVNVALGLLVGLALGIGISVLRETLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIIA
VASGQTLKGQLAAAVASLANVGAPISGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRASKKLGVLRR
AGR
>gnl|bykdb|A0A0Q5KQN1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. Leaf154] (length=469 residues).
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGASVTDLSQGNTFSAARVKSYEELAVTPQ
VLGQAAKQLGLPGGGGLGRVVTAESKRDTVLIAISATDESPTQAAAIANAVTAQLVKVVEQVENEAAATDGLVHLSVFQP
ATAPSTPFSPRLAVNTAIGVLAGLALGIAQAVLREVLDTRLRSFEALRRLTHASVLGEFPLDETIANEPLVSFGNRYSTR
AEAFRQLRTHLTYTNLDGDAQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
TRQVALDDAVQEVGADTPLHVLAAGRVPPNPSELLSSSRMVELVRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRRSSRARRTAEDH
>gnl|bykdb|A0A0Q5L7K3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf164] (length=483 residues).
MELRDYITVLRKGWVFIVAMMLVGVGLASAYSVVKTPDYSASAQVFVSTQTSGSVSDLAQGNTFTQQRVKTYASLVTTPI
VLLPVISSLGLNTTAEQLAQSITASAPLDTTLIQVDVVSEDPVMAADIANATSQSLTNVVEQIEATSEDADSEAGSQVKL
TRVQEAQVPSAPTSPNVPLNLALGLLLGLAVGVGVAVLRHTLDNRVRNEADVEKISDAPIVGGIAFDPKADERPLIVQAD
PRSPRAESFRTLRTNLQFLDLGTKSRTFVMTSSVQSEGKSTTVANLAIALDSAGARVILIDADLRRPRVGQYMGLEDAAG
LTDLLIGRADLADVVQPWGRGQLHVLPAGQIPPNPSELLGSRAMQELIGQLEQQFDYVLFDAPPLLPVTDAAILSKSASG
AIVVVAAGKTHKGQLSGAVAALESVGAPIAGFVMTMMPTKGPDAYGYGRYGGAYGYGIEDDKETKAAKKERTRIGAEARK
AAR
>gnl|bykdb|A0A0Q5MS06 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Leaf337] (length=542 residues).
MSVNTVPAGETPAGLDLADYLRVVRTYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNGLAAQVEAIETA
TPETATTETTTPDAGTSPDAATAPAATASAVRILPLGKAVLPTSPVSPNVKLTLALGALIGLALGVAYALVRRHLDRRIR
NAAEIERLFEVPVIGTLPIDHRLDEKSTILDAGAAAQLHDAGGAMAEALRELRTNISFLDVDQPPRIIVVTSSMQAEGKS
TVTANLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRIPPNPSELL
GSKAMKNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLGQSLGNLEKVKGRILGAVLNYVPTK
GTDAYSYYGTYTSATGSAPDYHSAPESLAPEAFVDDTFQSQIQRKNDDDVLEPVPAGRRARG
>gnl|bykdb|A0A0Q5N0H1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf172] (length=464 residues).
MTPLDLLGALRRSALLVVAITLVGIALGAAAVAMTAPLYTSSTLLFVSVRSAATTTAGELVQGNAAAQQKVQSYVGVATS
PRVLQPVVDDLDDETTLSSLAPQVSAETPVGTVNIRITVVDADPSRAARLAGAIAESFRTVVVDELETPAPGGTSLVGVE
TLAPPVVATTPSSPDLVVDLLLGGLVGLCAGVAAAALRARLDTRIRNRADIEAVTGGPVLGALAFDRDAGQRPLVVAVDP
RSPFAESFRALRTSVQFIGLDRTARCLVVTSALPAEGKTTTVANLAVALSETGSRVIVVDTDLRLPRLAELLGLEGAVGV
SDVLLGRADLADAVQPWGRGGLAVLPAGTLPPNPSELLGSNRMADLLGELARHYDHVLLDAPPLLPVTDAAVLSRLADGA
IVVAAAGRATRGQLATALETLSSLGATSFGVVATMLRPTGPQSYGYGYGYTAPRTAPEADPATA
>gnl|bykdb|A0A0Q5PNV8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf179] (length=474 residues).
MELRDYLRILHRNWILILALTILGGAGAFGYSLLQTPSYEANTQLYVSVRSDSSGVSELAQGTNFARQAVVSFVDVVDSA
VVLDRVVDDLNLDTTPQQLARSVEASSPLNSVIISVKVTNTDAELAAAIANSVGTNFANVVVNQLEKPEGEATSLVRVET
IEPALVPTSPAAPHTALNIAVGVVLGLALGLGVALLRSVLDTRIHSLHDIEAATEAPVLGGIALDPDAKKRPLIVHADPR
NPRAESFRSLRTNLQFIDVDGTSRSFVVSSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGIEGGVGLT
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLETLADAFDYVLVDAPPLLLVTDAAVISRFTSGVL
MVAASGTTKKPQLTAAVDKLQAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPDETAASVKGERRSRRNQADEK
>gnl|bykdb|A0A0Q5RU45 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. Leaf183] (length=482 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLVKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVTATAPTSTTLISISVNDTDPVQAANIANATSQSLTNVVQDIEATDANGASTVKLTRVK
QADVPSKPISPNVPVNVALGLLVGLALGIGIAVLRETLDNRVRTELDVEKISEKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMEVEGSAGLTDV
LIGRAELEDVAHPWGRGNLVVLPAGPIPPNPSELLGSLAMQDLIARLEGQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGTGQDDDKAPAAVKPPKRPGKLSALRRA
ER
>gnl|bykdb|A0A0Q5SIU7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf186] (length=466 residues).
MTDIFRALLAGWYLLLIGLVVGGGAGVAISASATPTYVSSTKLFVAVRGQADTTAMEIASGSNAAQQKIKTYTSLVTTPR
VLDPVVRDVGSPLTLESLAAEVSASSPTASTIMSVTVSDVDPRRAAELADAVTESLRSVVTTELEPEFAPGVPSVTMEVV
EPAAVSSSPATPHTTANVALGLALGLAVGALGALLRTVLDTKVRGQDDLADEHDLAVVGDIPFDPEVRRRPVVVGDGGGS
INAEAFRMLRTNIRFLASGASARTFAVTSAGPGEGKTTTTANLAVALAETGLRVVIVDADMRRPNLAKVLGIEGAVGLSD
LLIGRVELDDVLQPWGSDALGVLPAGDVPPNPSELLGSVAMKALLDDLGSRYAVVLIDTPPLLSVTDAVLLSEMVTSMLL
VVASGRTQRTHVKKALERLDAVGETPRAAVLSMSPRRRSDTRYQYYGEASGAPRGLRRLIRSKGRS
>gnl|bykdb|A0A0Q6B7E9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. Leaf415] (length=469 residues).
MELKTFITVVRTRWVLIVVVTLSAVLLGATASLATAKSYSSSTQLFVSVSSIGSSDAGDLVQGSSAAQAKVRSYVSVVTS
GRVLEPVIADLGLDTTPAGLASKISAFSPVNTSLIDISVTDGDPAQAARLADAVATSFEKVVEEQLEQPVGGGSGLVTVE
SIDAPVVPTSPANPKPVLWISLALGLGILSGTALALLRNTLDTRIRSKADVEGVTNAPLLGGIGFHTEASSAPLVVNNDP
RSPLAESYRALRTNLQFVSFEGRSRTFIVTSAMPGEGKSTTAANLAVCLAETGASVLLVDADLRRPRVAEVMGLEGAVGL
TDLLVGRAELVDVVQPWGRLGLHVLPSGTVPPNPSELLGSLAMASLVSTVEVDYDFVIIDTPPLLPVTDAAVLSRCVSGV
IVATAAQRSSRHQLKQALAAVSEIGSRTLGVVLTMAPTKGLGAYGYGAYGGYYGSVTENSVPASTAAAR
>gnl|bykdb|A0A0Q6E734 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf436] (length=475 residues).
MELRDYLRILHRNWILILAMTILGGAGAFGYSLLQTPTYEASSQLYVSVRSDSSGISELAQGTTFARQAVVSFVDVVDSA
VVLDRVIDDLNLDTTAQKLAGSISASSPQNSVIITIRATAADADTAAAITNSVGTNFADVVVNRLEKPEGEAASLVRVET
IAPALVPTSPSSPHTPLNVALGLIVGLAAGLGIAVLRSVLDTRIHSLHDIEAATEAPVLGGIALDPDAKKRPLIVHADPR
NPRAESFRSLRTNLQFVDVDGSSRSFVVSSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGVEGGVGLT
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSEMLGSQAMQRTLAALSDAFDYVLVDAPPLLLVTDAAVISRFTSGVL
MVAASGTTKKPQLTAAVEKLQAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPEETSSPRGGGDRRSRRDRADEK
>gnl|bykdb|A0A0Q6PIE9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Root322] (length=450 residues).
MGESRVSLRVIASSLRKFWWMVVLFGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDAKAAAELADAVAEQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGAVLGLAIAALIGVLDTRMRTEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPSEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTVPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A0Q6VGV2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root344] (length=477 residues).
MDLRQFLGILRGRWKFIISTLVIGTIASVGLVLNLSPVYSSSARVFVSTPTNGQADPYAATVFAAQRIASYADLATDPTV
LQKVIDRLGLKVTREELAGDISATVVPQTLILQITAKAASPQLAQDIAGAESEEIVDLVKEIEKPADTNLSAAIVARVTG
KASFNPNPIAPTVVLDIIVGIMLSLFIGVAGAVLRDLLDTTVKTRQDVELATGNAVMATLPFDPTVKKDPLTRDDTGSLS
EAFKVLRTNLQFANLDASRQMIVVSSALPDEGKTLVATNLAVSMAKSGRSVLLIDADMRNPNVADLLGLENSVGVITVLI
GRSTLEHAIQEHSTGVHFLGTGPRPPNPAEVLDTQAMRDLLAHARSQYDVVIIDAPPLLPVADTAILMTEVDGALLLARY
GSTGREQLRLAVSRIEAVGGRLFGTVLNRTPRRASTDGYGYYGYGYGVPYEIDKGKVKVKVKESETALTRTGRRAKR
>gnl|bykdb|A0A0Q7GBJ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. Root1293] (length=527 residues).
MYLSALRRRWPLIIILGILGAAVAFFYDSTLPTLYKSTASVFVSTQRGDTTSELVQGSNFAQANVQSYARLATTPLVLQP
VIDELDLDTSVNGLASVISADTPLNTVIIQITVQNSDPARAAMIADAVTSSLSTVVEKISPTSADKTPAVKMTQIASAQV
PAAPFAPNTRLIVATGLAVGLALGLVLALIWELLDTRVRSEKELTAITGLPVLGAVAKGPSKKPGWIAMRSDSHSMQAES
YRRIRANLEFADIERAVRSVIVTSATAGEGKSTTSLNLALAMAERVGRVLLIDGDLRRPTIADRCGLEGSVGLTTVLLGK
ISVADAVQRYARTVDVLASGVIPHNPGQLLGSSAMAALLAEVSKTYDFVVIDTPPLLAATDTLGLAHATDGAIVVVKYKS
TRRQQLAEAVGSMRTVNARLLGVVFDRIPTPKAIEYYSYHAKHSNGSADLTASGLDEVDETAPSTIAPAAQPESPVPAED
VEPAREPAPSAEPQAVAPTVTRTKKTRRARSDVIHTSDAGATVVVES
>gnl|bykdb|A0A0Q7MSV5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas sp. Root485] (length=699 residues).
MEPSEYLALLRKHWLMIAALGVLGFVGGYGYSQTIAPSYRATASLFVSEQAGSTVGESLQGSTYAQNRIESYAQLATKAY
VLDPVIDELGLDTSARSLAHSVEATSPINSLILDISAVSGNPEKSADIANTVSTELARAVERIEGAGSDDTTPHVGMTVI
SPATPPSFAFTPNTKLNAVTGLVVGLAIGVVLALARTILDTRVRTQKDIRRVSDVAVLSTVRYDRKSAHEAAVMRSQPFG
DQAEAYRRLRTNLRYLNLRGPNRSIVVTSSLPTEGKTTTSINLAWAMAEGGARVLLVDADLRRPSIARHLGIEGTVGLTT
VLIGEATVADVVQRWGDMLDVLPSGQVPPNPSELLDSTTMVDLLAELASSYDVVILDSAPLLPVTDAAVLSRLTDGALVV
VGSKRVHRHQLADGLATLSTAGGRVLGLVFNRVSGKDVGATYVYGSTPQATARWHGTGERPQRASRRSRARRGEATPVGT
TAVFPREVPVAPVVTTPVPAPVERAEPGPDLDEIDELDTARASSKFAAHVAARVSPPTVPAAAQVTDGQVAGGTGTDQPR
TASAQPAGEPAGTQASTPAGGRATNGQAGHPTAKETEGPLVATGQPTAQTAADQPASHHVRSATQDEPRPSPVAVLDDPL
DAPLTTAPSDDEATYSASVAEPSLDHDDEASRAAEPDELDAPDDLEHRIQVVPAAPWRP
>gnl|bykdb|A0A0Q7PFQ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root140] (length=461 residues).
MDFKDLMRTARRRWKTIVALFLVALVAAGAYSFLVTPQYQSTARVFISTDVEDSSEAIAASLVSSGRVASYADLATSREI
MLKVIKELGLKQSPEELASQIKAEVEPLTVIIDVTVTDPDPKAAQLIAEAHSEQLTKFITRVDAPDRAATPIRATVADPA
SYSSDPVSPRTLLNLVVAGLIGLVIGFGVAVLREITDNTVKTAEDVRKISGVGVVASIGYDADVPKHPLLTDLNGFAPRA
EAFRVLRTNLDYLDLDAQPKSFVITSALPGEGKTTTSTNLAVALAQAGRRVLLVDGDLRRPRIAGLLGLEGRVGLTTVLV
GKTSLVDSIQQHTETGVDFLSGGPIPPNPTEVLQSNATRDLIGKLRDMYDVVIIDAPPLLPVADAAILARAADGALLVTR
HGKTTKEQLHDACQRIEQVDAKLYGVIVNMAPRRSNQDYYYYYADEDDAANKTGRWVSLKP
>gnl|bykdb|A0A0Q7QIS8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root495] (length=478 residues).
MGKYVELRQFFGTLQARWKFALVAFLLGTIATVALVFTMAPQYGSTVKIFMSTPGGGTTEYVAAYTLQQRVASYADLAVD
PAVLDTVVTRLDLDETPQELAGQISATVVTGTNNIQIDVTADTAEQAQLIAGAEADAIVALVKRLERPSASGQTAAVTAR
IAADPSFRSSPVAPNVPLNLAAGLLVSLFVAIAGALVRDLLDRTVKSRRDVETITSSAVLATLPFYPQVKKEPLSAETGG
NLAEAFRVLRTNLQFVKLDADRQAILVSSALPNEGKTLTATNLAISMAQSGRSVLLIDADMRNPNVAELLGLENSVGLLS
VLVGRTTIEQAIQPHVSGISFMGTGPAAPNPAEVLESRAMRDLLSRVRKEFDTVIIDAPPMLPVADASILLTEVDGALLL
VRHGSTTREQLRLAVERVETVGGRLFGCVLNRTPRRASDDAYGYGYGHGYGYGSALPTAVKPEQVQKSGDEASTLSRS
>gnl|bykdb|A0A0Q7RV30 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Root1433D1] (length=450 residues).
MGESRVSLRVIASSLRKFWWMVVLFGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDAKAAAELADAVAEQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGAVLGLAIAALIGVLDTRMRTEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPSEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTVPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A0Q8A3C4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root151] (length=461 residues).
MDFKDLMRTARRRWKTIVALFLVALVAAGAYSFLVTPQYQSTARVFISTDVEDSSEAIAASLVSSGRVASYADLATSREI
MLKVIKELGLKQSPEELASQIKAEVEPLTVIIDVTVTDPDPKAAQLIAEAHSEQLTKFITRVDAPDRAATPIRATVADPA
SYSSDPVSPRTLLNLVVAGLIGLVIGFGVAVLREITDNTVKTAEDVRKISGVGVVASIGYDADVPKHPLLTDLNGFAPRA
EAFRVLRTNLDYLDLDAQPKSFVITSALPGEGKTTTSTNLAVALAQAGRRVLLVDGDLRRPRIAGLLGLEGRVGLTTVLV
GKTSLVDSIQQHTETGVDFLSGGPIPPNPTEVLQSNATRDLIGKLRDMYDVVIIDAPPLLPVADAAILARAADGALLVTR
HGKTTKEQLHDACQRIEQVDAKLYGVIVNMAPRRSNQDYYYYYADEDDAANKTGRWVSLKP
>gnl|bykdb|A0A0Q8CQ58 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. Root60] (length=527 residues).
MYLSALRRRWPLIIILGILGAAVAFFYDSTLPTLYKSTASVFVSTQRGDTTSELVQGSNFAQANVQSYARLATTPLVLQP
VIDELDLDTSVNGLASVISADTPLNTVIIQITVQNSDPARAAMIADAVTSSLSTVVEKISPTSADKTPAVKMTQIASAQV
PAAPFAPNTRLIVATGLAVGLALGLVLALIWELLDTRVRSEKELTAITGLPVLGAVAKGPSKKPGWIAMRSDSHSMQAES
YRRIRANLEFADIERAVRSVIVTSATAGEGKSTTSLNLALAMAERVGRVLLIDGDLRRPTIADRCGLEGSVGLTTVLLGK
ISVADAVQRYARTVDVLASGVIPHNPGQLLGSSAMAALLAEVSKTYDFVVIDTPPLLAATDTLGLAHATDGAIVVVKYKS
TRRQQLAEAVGSMRTVNARLLGVVFDRIPTPKAIEYYSYHAKHSNGSADLTASGLDEVDETAPSTIAPAAQPESPVPAED
VEPAREPAPSAEPQAVAPTVTRTKKTRRARSDVIHTSDAGATVVVES
>gnl|bykdb|A0A0Q8E213 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root614] (length=462 residues).
MVLRRRWMSVVALVLVAVAASAAITFTRTPVYESKSQVFLTVDVRDTTDAYAALLFASNRAASYADLASSTQLSERVIRQ
LDLPVTATGLASRISAEVVESTSLIQIRVVDEDPQEAQKIADVTTTEFTKYVAELETPGGGSDSQILAQITDEATLNTSQ
VSPNVALNLGVAFLIGLLVGVALALAREILDRTIRTADHVAELTESPVLASIGFDGDIKSAPLLTDLGGFAARTEAFRLL
RTNLQFIDLDHQPRCIVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTEIH
DAIQVHEASGLHVLASGAKPPNPTEILQSKITQDLIKRLRSSYDMVIIDAPPLLPVADASVLAKLADGVIIVVRHGRTTK
DQVNEAINRLGQVGGRLYGVVVNMVAKRAVGSYYYYYYEESSPSGRQATGKASSSLSGRRKA
>gnl|bykdb|A0A0Q8HXQ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root682] (length=462 residues).
MVLRRRWMSVVALVLVAVAASAAITFTRTPVYESKSQVFLTVDVRDTTDAYAALLFASNRAASYADLASSTQLSERVIRQ
LDLPVTATGLASRISAEVVESTSLIQIRVVDEDPQEAQKIADVTTTEFTKYVAELETPGGGSDSQILAQITDEATLNTSQ
VSPNVALNLGVAFLIGLLVGVALALAREILDRTIRTADHVAELTESPVLASIGFDGDIKSAPLLTDLGGFAARTEAFRLL
RTNLQFIDLDHQPRCIVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTEIH
DAIQVHEASGLHVLASGAKPPNPTEILQSKITQDLIKRLRSSYDMVIIDAPPLLPVADASVLAKLADGVIIVVRHGRTTK
DQVNEAINRLGQVGGRLYGVVVNMVAKRAVGSYYYYYYEESSPSGRQATGKASSSLSGRRKA
>gnl|bykdb|A0A0Q8LJ68 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Root180] (length=562 residues).
MADIRSQVTPGRILGVLLRAWWVILLAGLLGGLLAFGYSSTLSPIYQSTASTYFSMRSASSGSDINQGSAYTQSQMLSFA
QLAMSSVVLDAVRDDLDTDLTNSQIRNMTTVTIPQNTVILDVTAASTQPEFAAELANSIADNLAEVVDEISPKDDAGNAT
VVARVIEPATPAAFQSSPNKQRDAVLGAFAGVLLAVLAIVVWTLLDTRVRSEDALRRITDLPVLGGIPRRKDAQRRALVV
SEPNSTSAEAYRRVRSSLRFAAVEHDIRAIAVTSSIPGEGKTSTAVNLALTYAEAGLRVLLVDADLRRPMVAETLGLENS
VGLTTMLVGAVDFEEASLPWGDTSLWVLPAGEVPPNPAELLASARMTELLRELRGKFDVMVVDTAPLLSVSDATIIAQSV
DTTIVVADVSKVHLAQLSRSLEALDRARAEVAGVLFSRVKRQRGDDYNYYYGPSGGKRQRTGVPLTRRERRGEATPTSVP
LDIAPAGSLPAPAPSPSPPDDAPEIEVEDNARHEDAPSAEGADAVQSPDVSSDLGEAEDDANALDLSRVEGDVRLTADRS
DS
>gnl|bykdb|A0A0Q8Q033 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root190] (length=479 residues).
MAHGTDSKGWVLDFKQFLVVLRRRWVSVLLLIALALGVAAGITFTRTPMYESKSQVFLSIDVRNTTDAYAASLFASNRAA
SYAKLAKSTALSERVIEQLNLDMTPEKLADRIDAEVVELTSLIEIKVKDENARDAQKIGDVVTEEFTKFVPGLETAGGQS
ESQINAQITDEASYEPDQVSPTVLLNMIVAALIGLVLGIGLAVARELLDRTIRTADHVAELTDSPVLASIGFDNDIRSAP
LLTDLGGFAARTEAFRLLRTNLQFIDLDHQPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVATTLG
LDPAIGLTTALVGKTEIHDAIQVHEASGLHVLASGAKPPNPTEILQSKITQDLIRRLRSSYDMVIIDAPPLLPVADASVL
AKLADGVIIVARHGKTTKDQVNEAINRLNQVGARLYGVVVNMVAKRAIGSYYYYYYEESGPSGRGSGKSSSGKSGRRRA
>gnl|bykdb|A0A0Q8V9V9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root79] (length=458 residues).
MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYESDSTVFLSVDVRDTTDAYATLLFASNRAESYAKVIKSTELAAEVIDE
LNLKITPEDLSSRTNAEVVESTSLIKISVKDENARDAQQIADVMTDRFTKYIGKIEAPGGEGSSPIVARVTDKASYNPSQ
VSPNILLNMIVAFLLGILLGVALALAREILDRTIRTADHVADITPAPVLASIGFDGDIKSAPLLTDLGGFAARTEAFRLL
RTNLQFIDLDHRPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTEIH
DAIQVHEPSGLHVLASGAKPPNPTEILQSRITQDLVERLRASYDIVIIDAPPLLPVADASVLAKLADGVIIVVRHAKTTR
DQVTEAVNRLNQVGARLYGVVVNMVARRAVGSYYYYYYEETAPSGRGSNSSSGGRRRA
>gnl|bykdb|A0A0Q8W6H9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Root236] (length=477 residues).
MDLRQFLGILRGRWKFIISTLVIGTIATVGLVLNLSPVYSSSARVFVSTPTNGQADPYAATVFAAQRIASYADLATDPTV
LQKVIDRLGLKVTREELAGDISATVVPQTLILQITAKASSPQLAQDIAGAESDEIVDLVKEIEKPADSNLSAAIVARVTG
KASFNASPVAPSVLLDIIVGVLLSTFIGVAGAVLRDLLDTTVKTRQDVEFATGNAVMATLPFDPTVKKDPLSRDDTGSLS
EAFKVLRTNLQFANLDASRQMIVVSSALPDEGKTLVATNLAVSMAKSGRSVLLIDADMRNPNVADLLGLENSVGVITVLI
GRSTLEHAIQEHSTGVHFLGTGPRPPNPAEVLDTQAMRDLLAHARSQYDVVIIDAPPLLPVADTAILMTEVDGALLLARY
GSTGREQLRLAVSRIEAVGGRLFGTVLNRTPRRASTDGYGYYGYGYGVPYEIDKGKVKVKFKDSETALSGTGRRAKR
>gnl|bykdb|A0A0Q8X1G0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Root240] (length=458 residues).
MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYESDSTVFLSVDVRDTTDAYATLLFASNRAESYAKVIKSTELAAEVIDE
LNLKITPEDLSSRTNAEVVESTSLIKISVKDENARDAQQIADVMTDRFTKYIGKIEAPGGEGSSPIVARVTDKASYNPSQ
VSPNILLNMIVAFLLGILLGVALALAREILDRTIRTADHVADITPAPVLASIGFDGDIKSAPLLTDLGGFAARTEAFRLL
RTNLQFIDLDHRPRCLVITSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVASTLGLDPAIGLTTALVGKTEIH
DAIQVHEPSGLHVLASGAKPPNPTEILQSRITQDLVERLRASYDIVIIDAPPLLPVADASVLAKLADGVIIVVRHAKTTR
DQVTEAVNRLNQVGARLYGVVVNMVARRAVGSYYYYYYEETAPSGRGSNSSSGGRRRA
>gnl|bykdb|A0A0Q8Y2V9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Terrabacter sp. Root85] (length=468 residues).
MTFREFLGVLGARWRIIAVSLLAVVAATAVQTMLTPAVYTSSSKIYLRATTPASATNNNQVATYAVSAGDLGTYLEVLTS
PSVMDPLRTRLGLPAGFPLSVSGDVSQTSNMMTITATGGDPQLVARVATEAGPVLADVAKKFSPLLASNGQAVEADTIVP
ASVPADPTSPNAKRNLMLGALLGLALGVGLALLRHTLDTKVRTEEDIKALSKRPILGDIPMVKSVKNGLLSLESDPHGRH
AESIRRLRTNILFVDVTTGGHSFVVTSSVPGEGKTTTTINLALAMADAGSKVLLIDGDLRNPSVASTMGLDGSFGLTTLL
LGQADTDDVIQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMVV
GAERTKKRDLASAVQSLETVDAPVAGFALNMVSAGSSTAHRYGYYGYNRDADVKPSRRAKRSQAKHHS
>gnl|bykdb|A0A0Q9AGY3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. Root265] (length=497 residues).
MTLASSLKLLRKQWIIVCGVIVLAVAVAAVITALTPSKYQAATRLFVSTSSGSTLSDAYQGSRFSQERVVSYTDLLMGET
LAQRTIDKLGLDTTAKDLQANVTAKAKAGTVLITVEVLDESPVRARDVANALSDEFVVMIHQLEAPEDGSRPDSRVVVEQ
RASIPQEPVIPNTLRNLGLGLLLGIGLGIGTAVLHDILDNSVKDREEVDRITGKGIVGTIPLSKELREQPTISFEGDMSH
VAESFRKLRTNLQFLSVDNPPRVITVTSSLPGEGKSTTSLNIALALAEADHSVVLVDGDLRRPTVHTKLDLVGQVGFSTV
LSSRSSLSESLQNTRFPNLTVLTAGAIPPNPSELLGSQAAKKLLEELRTKFDYVIIDSTPLLAVTDAAILGAAADGVLIV
VRYGRTSFEQLQQAVDALNDVEAPLLGTVITQRPTTRNSSGYYGYSGYYGSDQPNQIEANNTPEQSALPSLPPVKADPAA
TTTRSKAPDLAREKPAE
>gnl|bykdb|A0A0Q9J8J7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces sp. Soil535] (length=508 residues).
MELRDYLRGLRRHWIAILLMTLLGIGAGYGWTLLQTPVYTAGASGYVVSKQTADVGTSSLGDSLARSRVQSYLDIAGWRS
VAENAIEDLELDTTPEALVQRVTVTNTPDTVIMKISAEADKPESARDLASAWIRAMKVEIDKIEGDGTLGSAPVTVIPGD
SASLPTTPSFPDVQTAVIVGGILGLGFGIAFAMIRTVSDRRIRTAEDVEQKTGVAVVGTIPIVPGLNADNRLVDLSDNGG
GKTSKFAVAEALRALRTNLQFMDVDHPPRTIVVTSPLPGDGKSTVACNLALTLAAAGTTVVLVDGDLRRSMVAKTMGLPG
GAGLSDVLAGRAALAEVLQRTPKSNNLLVLAAGSPPPNPSEVLGSERMHVLLGDLTKHATVIIDAPPLLPVTDGAVLTHQ
ADGALVVVTLGKTTDDLLDKALATLRKARGRALGIVLNKAPLRGVDASPYSYDYRREYTAKEPVAEAPAPVVPAGLDNAS
AGGLDELAGEEDAAATPVGVQRRQGRRG
>gnl|bykdb|A0A0Q9K1Q8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter sp. Soil728] (length=496 residues).
MTLQDLWKITRRQFVAIATCALLGVLLAFGWMLMQPKVYTASAGGYVTAGGGTSIGESFSSQTLAQQKAQAYVTLFTNRR
VAEAVIEDLGLDSTPQDLVSRISAAVPDQGVTITVTATGPTPEEARDVADAVVTAAAKEAKRIEESGPTRQVVGADGKTR
KVKSTAQVLIEPNESAVLPKSPTSPNPTRILPLGLLLGLLAGYGVAALRHHNDTKLRHVDEVEATAGAGVLGVLPQSAAL
SSERGQAYHPKAFHEGEALRKLRTNLRFVDVDNQPRSIVVTSANQGEGKSTVAANLATVLAESGEQVVLVDADLRRSAVA
RAFDMDGDVGLSEVLAGAIPLSDALQETRTPGLQILAAGATPPNPSELLGSHRMEALIEQLSREHFVVLDAPPILPVTDA
VLLTRSADGAVLVAAAGRTHKEALERAAGSLRAVDAKVLGAVLNGASTSRVDRVRYGDVEYGYVKSYSDDYVYESEDAAA
TSRQDVKAKRRRRVRG
>gnl|bykdb|A0A0Q9K847 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter sp. Soil728] (length=467 residues).
MQFSEFLNVLRARWKLIAACVVLAVLAATALTLLTTPVYEARARIYLSAEGRGGDAARTTGNVFVLTSDDLDTYVSILNT
PAVLEPLRKELGLEPGHPIDVRADVTGSTSILNVTARSSDPKEAAEVANEVGPQLGAVAGEFSTLLKSSGQKVVSTPIQP
ASAPSRPVSPDPVRNIGLGLLAGLVLGIGIAFIRHSLDTKVRGEDDIRAHSDAPMLAALPLDRSSSKGLVSVEDDPHGRH
AEAIRRLRTNLMFVDVTTGRHSFVVTSAMPGEGKTTTAANLALAMADSGRRTLLVDADLRNPSVARTLGMEGSVGLTSVL
LGESEVHDVIQPWGSHGMDVLPAGPVPPNPSELLGSAPMEALLRSLVGEYDFVLVDSPPVVPVIDAVVIERLTGGLLMVV
GVDRTRKKDLAAALRQLDTVGAKVSGFARNFVSGKAEGAYRYGYHAYEQEVERETRRARRTKTRSRA
>gnl|bykdb|A0A0Q9MJT3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Soil761] (length=495 residues).
MSTTAVPAETSPGLDLADYLNVLRVYWKAIVAFTLLTTLGAAGWTALQPKIYSSDSSGIVVTPGSNNVSLALAGDSLAKA
KVKNYESVAKSRLVADRVIQALDLKTTADALLGSISVKVPLDTAEIRVTAQSKDPATAQRVADAWVNGLAAQVEAIETAP
SADAAGSSPSAETAVRVLPLGKAVLPTSPTSPNTKLNLALGALVGLALGVAYSLVRRHLDRRIRKAADIERMFGVPVIGT
LPVDHRLDGKSTIVDAGTAAQLHDAGGAMAEALRELRTNLSFLDVDRPPRIMVVTSSVQAEGKSTVTANLAVAMAAAGEN
VVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWAALPNLSVLGSGRIPPNPSELLGSNAMKNMLELLAEEA
IVLIDAPPLLPVTDAAVLTRAADGAIVVVGAGRTTEDQLSQSLGNLEKVKGRILGAVLNYVPTRGADAYSYYGTYTTSSG
RAITADLGANYVDHL
>gnl|bykdb|A0A0Q9QYG9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Soil782] (length=487 residues).
MELKDYLRVLRRNWILITACTVFGVLTAGVLSLSVAPTYTAQTRLFAALQTSGSVAELQQGNSFTQARIESYAETAETPL
VLQPVIDSLGLEVTPAELAENIEASSDVNTVLLTIAASHPSPVQAAAIAQAVADSLVERIEDLETTAEDGASPVKLSVVT
PAIAPTAPSAPNTRLNLALGLVVGLIIGLTAALLRTTLDTRLRGEADLRRITDSPVLGGIAFDSDATKKPLLTQAPAQSP
RTEAFRQIRTNLQFSHVSHASKTVLVTSSLPGEGKSTTAINLAIAMAQSGQSVVLIDADLRRPRVDEYLGLERNAGLTTA
LVGRADVRDLLQPWGEHELYVLTSGQIPPNPSELLGSKTMKKLIAGLEDTFDAVIIDAPPLLPVTDAAVLAQQVGGVVMV
IGSSKVKLPDVQKSLASLEMVDADVLGVVLNLLPTKGPDAYAYSYYSYESSPAKNVKVPADGSKARGRSRIDSDFDEKVL
RARPNQS
>gnl|bykdb|A0A0Q9RI09 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Soil796] (length=461 residues).
MDFKDLMRTARRRWKTIVALFLVALVAAGAYSFLVTPQYQSTARVFISTDVEDSSEAIAASLVSSGRVASYADLATSREI
MLKVIKELGLKQSPEELASQIKAEVEPLTVIIDVTVTDPDPKAAQLIAEAHSEQLTKFITRVDAPDRAATPIRATVADPA
SYSSDPVSPRTLLNLVVAGLIGLVIGFGVAVLREITDNTVKTAEDVRKISGVGVVASIGYDADVPKHPLLTDLNGFAPRA
EAFRVLRTNLDYLDLDAQPKSFVITSALPGEGKTTTSTNLAVALAQAGRRVLLVDGDLRRPRIAGLLGLEGRVGLTTVLV
GKTSLVDSIQQHTETGVDFLSGGPIPPNPTEVLQSNATRDLIGKLRDMYDVVIIDAPPLLPVADAAILARAADGALLVTR
HGKTTKEQLHDACQRIEQVDAKLYGVIVNMAPRRSNQDYYYYYADEDDAANKTGRWVSLKP
>gnl|bykdb|A0A0Q9SBW5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. Soil797] (length=455 residues).
MRTARRRWKTIVALLLIALVAAGAYSFLVTPKYESHARVFISTDVEDSSEAIAASLVSSGRVSSYADLATSREIMEKVIA
ELNLEESPSELADMIKAEVEPLTVIIDINVTHPDPKIAQAIAQTEAEQLTKYITRIDAPNRAATPIRATVADPASYSSDP
VSPRTLLNLVVAGLIGLVIGCGVAVLREITDNTVKTADDIRKITHTGVVANIGYDSDVPSHPLLTDLNGFAPRAEAFRVL
RTNLDYLDLDAQPKSFVITSALPGEGKTTTSTNLAIALAQAGRRVLLVDGDLRRPRVAGLLGLESKVGLTTVLVGKSSLV
DSIQQHGDTGVDFLGGGPIPPNPTEVLQSNATRDLIHKMRDMYDVVIIDAPPLLPVADAAILARAADGALMVTRHGKTTK
EQLHDACQRIDQVDARLYGVVVNMAPRRGQQDYYYYYADESDPAIKSGRWVSLKP
>gnl|bykdb|A0A0Q9U1Y8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Terrabacter sp. Soil810] (length=469 residues).
MTFREFLGVLGARWRIIAVSLLAVIAAAAVQTMVTPAVYTASAKIFLSATQPPGAGTNNQVVTYALSADDLARYIDVLNA
PSVIEPLRDRLGLEPGTPIAVSAEVGQTSNVMTITATGGSPELIARIANTAGPVLAEVATKKFSPLLAANGQSVEATPIA
PATVPTEPVSPNAKRNLMLGALLGLALGIGLALLRHTFDTKVRTEDDVKALSNRPILGDIPMVKSVKSGLLSLESDPHGR
HAESIRRLRTNILFVDVTTAGHSFVVTSSVPGEGKTTTTINLALAMSDAGSKVLLIDGDLRNPSVASTMGLDGSFGLTTL
LLGQADPEDVVQRWRETTLHVLPAGPVPPNPSELLGSEPMEILFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMV
VGAERTKKRDLASAVQSLETVDAPVAGFALNMVSAGSSTAHRYGYYGYNRGADAKPSRRERRAQAKRHA
>gnl|bykdb|A0A0Q9U9A8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Terrabacter sp. Soil811] (length=469 residues).
MTFREFLGVLGARWRIIAVSLLAVVAAAAVQTMLTPAVYTSTAKIFLSATQPAAASTNNQVTTYAVSADDLARYLDVLNA
PSVIEPLRERLGLAPDAPLSVSGEVAQTSNIMTITATGGDPVLLARIANEAGPVLADVATKKFSPLLAANGQSVEATPIA
PATVPTEPVSPNAKRNLLLSGLLGLALGIGLALLRHTLDTKVRTEDDIKALSDRPILGDIPMVKSVKNGLLSLESDPHGR
HAESIRRLRTNILFVDVTTAGHSFVITSSVPGEGKTTTTVNLAIAMADAGSRVLLIDGDLRNPSVASTMGLDGSFGLTTL
LLGQADTDDVVQRWRETTLHVLPAGPVPPNPSELLGSEPMEVLFGKLSHDYDFILVDSPPVVPVIDAVLINKLTHGLIMV
VGAERTKKRDLASAVQSLETVDAPVAGFALNMVSSGSSTTHRYGYYGYNRDADAKPSRREKRSRSKHHA
>gnl|bykdb|A0A0S2M268 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter alpinus] (length=541 residues).
MEDEQLVTVEKSLDVRDYVRVFRQHWLGVVALTLIGILCSAGWIFLQKPVYAANSIGYVSIPGGDNMGSALAGDNLAKSK
ATSYASFGSSRPVAESVIKTLNLDVKPDVLLQQITVTSAKDTPEVKIVATAQTPQEAQALANAWVVALAEQVKVLESTTD
AGPEAGAESIIKVVPLGDAPLPLAPTSPNKKMALVIGALAGLIIGIAYALIRNHLDRRIRSVEMVEKAIGTAVVGTIPVD
ERMRDGRRVVANAVIDHSSTEGYAISEALRELRTNLHYMNVDNPPRVIVITSSIPSEGKSTIAANLAVTIAATGQKVVLI
DGDLRRPVVADFFGLAGGGGLTDILSGQAELDDVLQVYGPVPSLAVLGAGRIPPNPSELLGSLAMKRLLERLSKEAVVLI
DAPPLLPVTDAAILARSTDGALIVAGAGKTTIDELEKAVATLAKVKAPLLGAVLNRVPTTGGQAAGYGYYGKGYYYGQND
AAKAGKRNRKTQASTPAPEGIQQGVNNGGPGAGKEMSAEQEFDLLLHPADGPPTRRMTRQR
>gnl|bykdb|A0A0S2MGZ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum] (length=486 residues).
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE
EFRRLCTNLSFVENGNKDRPDNDHSNVIIVTSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKSNYYYYEESEVKNRRTKASTGDSSQNSASRNARRGRR
TTADGR
>gnl|bykdb|A0A0S9D7J0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Leaf234] (length=436 residues).
MTIVALCLLGALAAFAYASLSAPQYRAVSSVFVSSNRGETTGELVQGSTYTQNLVASFTELATKPVVLDPVIEDLDLDSS
AAQLEDAVSAETPLNTVLINITAVSESPAGAANIANGVADSLARVVTDMSPKTESGSPTISISTVATAQAPTFAFAPNTR
LLIAAGALVGLVAGIVVALARQLLDTRIHDAGDVARLTDLPILGTIPRTRGADSGSIVLTSDPNGNVAEAYRLLATNLEF
LNPDKSLRSIVVSSPLPGEGKSTTAINLALAAAERNHKVLLIDADLRRPSVAEFCSIEGGVGLTTVLSSRASLSSVIEPW
ESIDVLPCGVVPPNPNQLLSSDSMAHLVKELSDVYDFIVIDSPPILLVADALPLARLTDGAVIVTRQHRTRRGQLAKTLQ
SLEGVGSDALGVILTGGKAASRTAYYGSKEQPGPTR
>gnl|bykdb|A0A0S9DZU4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia sp. Leaf244] (length=459 residues).
MEFRDYVHILRRSWILIAVLLLAGIGAAAGYTFLQDPTYSSSAKVFVSTSSGSTASDLQQGNNFTQQRVKTYADLATTPI
VLLPVISELGLGMSSSELAAAVTASAPLDTTLIEIVVTNGDPVLAADIATSISKSLTRAVENLETPTDSDKVVSPIKMSL
VQEAEVPTKPISPVVPINIAVGALLGLALGVGLAVLREILDNRIRDERDVAVITTAPILGGIPFDANARERPLIVHDELH
SPRAESFRMLRTNLRFLDVGRENRSFVITSSVQGEGKSTIAVNLAIALADAGSRVLLVDADLRRPRVHEYLGLEGAVGLT
DLLIGTAVPDDVIQPWGKRDLFVLPAGKIPPNPSELLGSDALVSLIAEFNDAYDVVLFDSAPLLPVTDGAILARTVGGTI
MVSAVGRTHKNQLKGAFSVLSNVGAPVSAVVLTMLPAKAPDAYSYGYEDVTVPEPVKAV
>gnl|bykdb|A0A0S9E1G2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia sp. Leaf244] (length=465 residues).
MELRDYIRILQKSWILIAIVLLLGVGAAAAYSILQTPKYSSSAKVFVSTSAGSTVSELQQGNTFTQQRVKTYADLVTTPI
VLLPVISELGLDLSSDQLARMVTASAPLDTTLIEITVVSADNAESARIATSISESLTRVVEEVEAPADQTASSPVKLTLV
QHASVSQSPVSPNVPINLALGALGGLALGIGLAVLRETLDNRIRNERDVALITEVPILGGIVFDPKARERPLIVHADPRS
PRSESFRTLRTNLQFLDIGREDRSFVITSSIESEGKSTSAANLAIALADSGLRVLLIDADLRRPKLHEYMGLEGAVGLTD
LLIGTAEPQDVIQPWGKQDLFILPAGKIPPNPSELLGSEALNKLVVEFNGAFDVVLFDAPPLLPVTDAAILARVVGGTIV
VCAAGKTHKNQLKGAFTALQNVDAPVSGVVLTMLPTKGPDAYGYGRYGYGYGYGDIDSKAVPAGG
>gnl|bykdb|A0A0S9PK66 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia sp. Leaf283] (length=466 residues).
MELRDYLRILQKSWILIAILLLLGIAAAAAFSILQTPKYSSSAKVFVSTSGGSTVADLQQGNTFTQQRVKTYADLTTTPI
VLLPVIADLQLDLSSGELASMISASAPLDTTLIEITVTSEDPALAAEIATAVSASLTQVVENIETSGDDVQAISPVKLTL
VQHAESAQAPVSPNVPLYIALGGVIGLALGVGVAALREALDNRVRNERDVEVITDAPILGGIVFDPKANERPLIVHDDPR
SPRAESFRTLRTNLQFLDVGRTNRAFVVTSSIQSEGKSTSTANLAIALADTGARVLLVDADLRRPKLHEYLGLEGAVGLT
DLLIGTAEPEDVIQPWGKNDLFVLPAGKIPPNPSELLGSEALTRLLNEFNRAFDVVLFDSAPLLPVTDAAILARTVGGTI
VICAAGKTHKNQLKGALAALNNVDAPVSGIVLTMLPTKGPDAYGYGRYGYGYGYGDVSTPLASTAT
>gnl|bykdb|A0A0S9QI77 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. Leaf288] (length=460 residues).
MELRDYLRILRAHWLAIVILTLLGVAVAWGWTALQPKVYTANASGIVTATNAGSDTGSSLVGDQLARSKVTSYVELGSWR
AVAECAIDELGLNTTPESLVTRVDVSNPLDTVIVRVTASASSPEEARDLAESWLGCMVEQINNVEGTDETGTAAVTLVTG
DSARLPTAPSSPNVRLALALGALVGLALGIGYAVVRHVLDRRLRDPRDIERETGVPVVGTLPVDKGLSVERGLADFESQH
SSSAPLAEAMRELRTNLQFMDVDNPPRAIVVTSPLPGDGKSTMAANLAVSLAAAGRHVVLLDADLRRPMVSTVFGLPDGA
GLTDVLAGRAELNDVVHNVGASRNLAVITAGRVPPNPSEVLGSNRMQALVHSLTEHALVIIDSPPLLPVTDAAVLTTAAD
GALIVVSAGKTTYDMLHKALANLGKANARVLGVVLNRVPRKNGGYYGYQYQGDYAGADTR
>gnl|bykdb|A0A0S9R0B0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. Leaf289] (length=474 residues).
MELRQFLGALRARWVFSTVTFLAGAVLTVAAVFLMTPQYGSSVKLFVSTPSGGSAEYAASFIVTQRVASYAELATDPSVL
QRVVDSLDLDMTREDLEGRVSASVITGTQTIELDVTAETPELAQQIAKAEAEEVVALVEQLERPAVEDEEPAIAARIAAE
PSISDTPVSPNIPLNLGIGLLVSLFVAIVGALLRDLLDRTVKSRQDVEKISGHSVLVTLPYDPQVKKTPLATEVGGSLAE
AFRVLRTNLQFADLDAERQAILVSSALPDEGKTLVATNLALTMAQSGRSVLLIDADMRNPNVAELLGLENSVGIVTVLVG
RTSIEDATQPHVSGISFMGTGPAPPNPAEVLDTQAMRDLISRVRKEYDAVIIDAPPMLPVADASILMTEVDGALLLVRHG
STTREQLRLAVARIHAVGGRLFGTILNRTPRRSGDADGYGYGYGHGYGYGYAPTPAAEPASSTRGRRIGRRVKR
>gnl|bykdb|A0A0U3XWM6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. XT11] (length=458 residues).
MKADATGWSLGSAWAAIRKFWYVIIGMAVIGGAVAYGISSTTTPQFQSTATLYFAMNQGTTGTDLNQGSTYTQSQMLSFA
QLATSSRVLAPVIDDLGLDSTPKELTRNIAITIPQDTTILSVEVTSTSAKRAAEIANAISEELSGAVEEIVAKSVDQKPT
IVPSVIDEAVVPQFQSLPNKSRDGALGGVLGLVLGILVAFIATIADTKVRNEAALARVTDLPYLGSITRTKRGTDAGLIT
VREPRSHIAEDFRRVQSALAFANVDGESRRLLITSASPAEGKSTFSANLAVTLADLGERTLLIDADLRRPRAGEIFGLDS
SVGLTSVVLGSVDLSEAVVPWRASGPNLLLSGEVPPNSASVLTSHAFADVLDEAGEGNDVVVIDSPPVLTVADTNLLAPL
ADGVVIVVDASKTSRPQLAATIRTLEGAGASIIGIVLNKVRLARGRTTYYTEEKSGSA
>gnl|bykdb|A0A0V8IVB9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter enclensis] (length=512 residues).
MSTAAAPEQAPTGLDLADYLGIFRTYWKAIVSLTLLATLAAMGWTVLQPKIYSSDSSGIVTTPGSDNVSLSLAGDSLAKA
KVKNYESVAKSRLVADRVIAALGLDTSVDALLGSISVKVPLDTAEIRVTAESSDPATAQRVADAWVNGLAAQVEAIETAA
PADAAAGTAGTPTAVRVLPLGKAVLPTNPTSPNTKLNLALGALVGLALGVAYAVVRRHLDRRIRRASDVERLFGVPVIGT
LPVDHRLDGKSTVLDSGISSQVHDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQSEGKSTVTANLAVTMAAAGEN
VVVVDGDLRRPTLVDVFNLVPGAGVTDVLTGSVQLADVLQPWGALPNLAVLGSGRIPPNPSELLGSNAMKNMLEALAEDA
IVLIDAPPLLPVTDAAVLSRVADGAVVVIRAGRTTQDQVGQSLGNLDKVRGRVLGSVLNYVPTRGADAYTYYGTYRSSVG
TADAPEVQPSVPAGPAFDGTVEAVLSGRRARV
>gnl|bykdb|A0A0V8STB2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas sp. B6] (length=585 residues).
MTLRDVLRSARKHWWWVVLPVVALTLGMGVVSVRSTPVYRSTATLYVALAAGGSAGDLNQGSSYTQNQMTSFARLAVLPV
TLEPVVRDLGLDTSARQLAKTVAATSPKDSSLLDIAVTGTSPEQTALVANAVAAQLGQVVETLAPKGEAGSTITATVVSE
AVAPAFPIAPNTRRNVLAAFLAGLLIGLAAAWARDALDTRVRHQQDLRRTVDVPVLGSIRQRRRPVKGEAPPSALVGASG
EDFRRVRANLEMIGRPGAPKLLVFTSALQSEGKSFVATRVAASFAAAGVRTLLVDADLRRPTVAGHVGVDGGAGLTDVLV
GRAALGDVVQHVGRHLVVLAAGPVPPNPAELLAYPEFGALLDQAAAEFEVVVIDAPPLVPVADAAVIARRATGVVVVADA
RQVRRPQLRQVAEAVRLGGGRVVGTVLNREKGLADESYGYVADGERRRPRRRRGAPAPSEHAPAPPLDGAAGGADPATAA
PRDGRRRAPDGHRAAADAPVRPAVVEDVADDEAASTDVVAAPPAAVAEGVGPRDVASPEDVPRARRADEGRGAATAHPEA
DDLDVEHEHEHDEDDAALPSVALRS
>gnl|bykdb|A0A0W8IE50 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nesterenkonia jeotgali] (length=458 residues).
MELREYLRILHRGWLIIVLATLAGIGAAATYSLLQSPQYEAGTRVYVSTDSASSVAELGQGTTYTQQIVSSFVEVTTTPR
VLQPVIEDLGLQQTPSELADAVSVSTQADTVLMQITASDEDPALAAAIANSVTENLIGVVGEITPGASDEASPVSVEILQ
EAVAPESPVAPRVPMNLALGFLVGLAVGLGVAVLREVLDTRIRGEHDISAVTEAPVLGGIVYDAEAQKRPLVVQVDPKSP
RAESFRTLRTNLQFVEVGESKRSFVFTSSIQGEGKSTTVANTAITMQEAGQRVLVIDADLRRPRVADYFGLEGAVGLTNV
LIGKVDLADVVQYWGPHDLAVLPAGDIPPNPSELLGSPSMDALLRFVEDQFDVVLIDAPPLLPVTDAAVLATRATGAIVV
VAAGKTDRNQLKGAITSLENVGAKLFGVIPTMLPTKGPDAYGYGRYGHAYTYEEDRKA
>gnl|bykdb|A0A101AMP3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. IS-1742] (length=499 residues).
MTLQDFVKTMRARWMTICVTVIAAGLCAVAFSLATTPLYQATTRLFVSTNGGSTLTETYQGNRFSQERVISYAQLLMGET
LAQRTIDKLGLAMSAEQLRENVTASSKLDTVLINVAVLDESAVRARDVANALSDEFVVLVRELETPESGATPEARVVVEQ
RASVPSQPVVPKTGRNIGIGLAVGIFLGICLAVMRELLDNTVKDRQVLEEITGAGLVGTIPLDKERRKEAAISFEADNSP
TAEAFRKIRTNLQFLSVDNPPRTIVVTSSTPSEGKSITAINIALALAEAEHNVVLVDGDMRRPTVHKNLKLVGPVGFSTV
LSGQASLDEALQKTGFPGLTVLTSGAIPPNPSELLGSQTAKKLLGELAAQFDYVIVDSTPLLAVTDAAILAAEADGVLVM
TKFGQTKRDQLTHAVGNLRDVGASVLGAVFTMTPSRGGSSYSYSYSYYGDEGSRRSPRHGGSPDTPKTPERFSGAASSRS
SARDTAAQSVGNRASENPD
>gnl|bykdb|A0A101LA70 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. EpRS71] (length=510 residues).
MELTDYWKVLRAHWVSVIAITLVGGIAAFGWTLTQTKVYSADASGIISVGVNKDLGTAMAGESYSKSRAKSYLDVAKSRS
VAETVIDDLKLQGTTPEQLISRISAQNPQDTATLKFTAQASTPESARDLAEAWVRAVGQQVDQLERGGAKAGETSIVSFV
SLDAAQLPTSPTSPNTRLALMIGVVAGLLVAIGYALLRNIFDRRVRSAAQLESETGVAVIGTVPFHTNFDGVNRLVLSRG
GNDLENKNHQDYAVAEAIRELRTNLQFMDVDAPPRIIVVTSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAK
TFGLLTNVGLTDVLIGRATLNDVLQPWGESGDLFVLGAGSVPPNPSELLGSNAMHSMLEDIAKHAIVLVDAPPLLPVTDA
AILTARTDGALVVSRAGKTTYDQLKRALQNLERVRGRPLGLIINGVSRKSTKGEDYGYQYYTYYNRKDSGEESARATHVP
VDESRPVEATALEPLGEQRRGRRRERTHAL
>gnl|bykdb|A0A101LAM5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. EpRS71] (length=524 residues).
MSGNDLLSVVRSHWLGILFITVLMVGGSLGWYALQPKVYSAESSGIVVAAGAENLGMSLAGDSLAKSKAKGYQSVGESIL
VAESVIKSLGLKESAPDVTRSISVSVPLDSVEIRVSARSSDPQTAQNVADAWVTALAAQVYELDKGNASPGTEPVTKIVP
LAKASLPSAPVSPLLTATLGIGLAAGLLIGLGYALARNHLDRRIRGASEIERLFGLAVVGTLPLDKRLSEKSSVLESTTG
MHRVPGGHAMAEALRELRTNLDFIDVDNPPRILLITSSLPSEGKSTVTSNLAATIAAAGRDVIVVDADLRRPTVHQVFGV
LPDVGVTDVLSGRASIDDVLQEWGPNPHLRILTAGRIPPNPSELLGSRAMEHLLRDLSQRAMVLIDAPPLLPVTDAAVLS
RVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVATKGPGDLNYGYYGAYGSAEDLKDHQPPAPSTTTTSAS
RRSPDADAVNPVPDIREASPFLGSVSTWRAPQDGSRGRRSAPPS
>gnl|bykdb|A0A101Y8M3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria rhizophila] (length=492 residues).
MTVIDFLRLTRANLVLLLAATLAGLLLAFGVALAQPKIYTSSSTGFVTTTGSSSLGDVLNGDVAAQNKANAYIPVISSRS
VAEKIAQDPALGLTADEVAGHLTASVVPNSALIKVDATADDPEKSAALANSALQATAEVVQDLEGNSSPVRVVPLEDAQV
PGGPSSPNTKRYLLAGAAAGLLAGYAVALLRKVSDVRIRTSHEVEELTDAGVLGILPKTPSLKGNNRGEVEDDAAHEAVR
QLRTNLRFVSVDNPPRCVVVTSPNPGEGKSTVTTAIANSFAHAGEAAVIVDADLRRPTVAGVFGVDGSVGLTQVLSGQVA
LQDALQQVPGSSLMVLPAGRIPPNPSELVGSQRMKHVLTELRESYMVFVDAPPVLPVTDASLLAAAADGAILVIEVGGTR
KEQVELAASMLRRVSVTLLGAVLNLAPARGVGSSHYGFGYGGYRRGYSSYYGETKKSSRGFRAKRRATPDRARSRRSSSA
GSSASSHSARDV
>gnl|bykdb|A0A109IIZ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora rifamycinica] (length=483 residues).
MDVRTCLRLVRRHWWIVLVTLMLTVGAAALVTVRTPPRYMASVTFFVTAPSQGVTNAYQGELFLQQRVKSYADLLRSDRL
AQAMVADNSLGLTADDIQHRVATSTETGTVLLRANVTDTDQARALKTTEVLSAKFVELVQKIETTSDGKAGPTRLEVVGG
PRVSASPVAPQPNRNIALGVLVGLLLGAALAVLRGMVDVRLRDAAGLQRATGSPLLGDIPFDVAAKAKPLIVGEAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGIDGGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGAKAMADLLLALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQVAAAARSLHSVSVRLLGCVLNMAKVARVDAYQYEAYRVATTTPSVPADRAAAHRGDQDLHPVEDRTQELTR
LSQ
>gnl|bykdb|A0A126SX27 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium angulatum] (length=479 residues).
MSDGSRPSGITFADIVVIIRKHIATAAICFAVIVGVAGAYAFLAAPQYSATAQVIATYNAAQDGGNSDDITQQNTGGTYV
SNQIKSYPTLATTETVLKPVISQLGLDVSVKDLSNQLTVSNPSNTAFVNITATAGDAKQSATIANAVADSLRTIVEHDLY
AKGAAAPIKLTVVQRAATPQEPSAPNKKLCIAAGVVLGLIVGIIAALLKDLLRTKVEEASDVRGIVHASALGSIPKNEAL
EGTRPVIITEPNGSVTEEYRRIRTNIKFLEVNKTPGQGQLLVISSTSPSEGKTTTAVNAAAVLAENGAKVLLIDADLRHP
SVAHHLGIEGNVGLAHVLSGQMAPVDVVQNYWKPNLHILPAGKRPANASLLLNSDMMKMLVDQALLQYDYVIIDTAPLTV
SNDAIVFGSWTSGIVLVTARGLCRKKNLEEVADSLRTAKVPVLGFVFNFANPKKSHNEAYYYYYEDGAKRSAARRGRKH
>gnl|bykdb|A0A126SYB4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium angulatum] (length=531 residues).
MIETVRQERSVAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYT
LTAQKKYMATAQLFASYNNTTADALDSSVSSQSAAGTYIATQLKSYPGLVKTEAVLQPVIDELNDNSITTDDLATMVTAT
NPTDTYMLNVSVEATNPEQSAQLANEVSQSLSRVVSSELYASGKKSMVKLSVVQKAKTPTSQSSPNTKLNIAVAVVAGIV
LGIFAALVRDLLARKLQDLMDLQSIDPNGSIAGIIPKDEVLNVTKPVIVTKPDSPIAEEFRRMRTNLSFVTSKDGDKGRL
IVITSSMPSEGKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMP
AGPRIQNASVLLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMVSARGVTYKSALRGVVNELRDLDV
PLLGYVFNLADEKRNRGYGNYYYYGAYYKGEYGKEDSKKGRKRRRSHRRGK
>gnl|bykdb|A0A127A501 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sinomonas atrocyanea] (length=598 residues).
MEQGTGLSAEQGMSLTDYLRIARRFWKGIVALVLVSTVAAFGWYLIQPRIYSAEASGMVISSGADNLSWSLAGDSLAKSK
AKSYKAVAESASVADRVISDLSLPTTAQDLLGNVAVTVPTDGTEIRIDARDKDPVQSQKVANDWVKALASQVSDLEKDAN
SNAKGNPAVKVVPLVTAMVPTEPVSPKLTLALGVGVVGGLLLGLAYAFIRDRVDRRIRTSEEAERFGYPVIGTLPLDDVL
VKGSSVLEGTGGHQFMSEALRELRTNLRFIDVDHQPRIVLVTSSLPSEGKSTVIANLASTLAADAEPVIVVDADLRRPNV
HNVFDIVGDVGVTDILSGRARIDDVMQTWHRNDLVRVLAAGHIPPNPSELLGSQAMRNLLATLSQDALVLVDAPPLLPFT
DAAVLSRAADGTLVLVRANRTKVDELSHALGNLQRVKGRVLGLILNGIPAKGADARARGYYGRYGYGEPPAEDRTLEPAA
QPREARSRRGSAGSAEDWSGSGQSMTDDAAGSRWDRPFDEDSQGAHGFGAPSPGQDRLGLAAEHDQPDGPRGHSGWAQPG
YGEDPGAHSTDADESAADDGVWLPARVRESYGSRRRGL
>gnl|bykdb|A0A132I1I7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPQIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENESLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEKYLSSVGSSARKERRSRHKARTRS
>gnl|bykdb|A0A133L2Q6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A133LT97 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=476 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILNDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKKNYYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A147DUP0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium oceanosedimentum] (length=469 residues).
MTPLFRALLSRWYIVVAGILLGCVAAMALSATVTPQYRATTKLWVSVGGDAETSALELAQGSNAAQQRIRSYLDLVSQPI
VLDPVIEELGLSTSAGALAGAVSATSPTGSVVMEISVTSPDPRRAAALAEAVARSFTQVVEQRLDANADAAGTGVGVTET
SPPTVPTTPVEPRTTANVTLGALIGGAVGALAAFLWWSLDTKVRGREEVQSLWDLAVLGEIGFDQEATKRPLILRDERAS
VRAEAFRSLRTNVQFLSSRPQGARTVAITSSRPAEGKTTTIANLAVALAEGGQRTVVIDSDLRRPNLANVMGVEGSVGLS
DLLIGRAELEDVLQPWGTSGLQLLPAGTIPPNPSELLGSPAFAALIESVSEEFDYVLVDTPPLGSVSDAALVSASVQNML
LVVASGRVRRADVSASIESLRTVGAAVQGAVVTMTRSRAGKDRYAEYAYSAQPVARSVGARMPKRRRAA
>gnl|bykdb|A0A147E2K4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oxydans] (length=445 residues).
MSLRVIAGSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQLATSSR
VLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTITAQVID
DAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLIGVLDTRMRNEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQEPLGH
TSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSIGLTSV
LLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVADANLFATQTDGVILV
VDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A147F0T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium testaceum] (length=475 residues).
MELRDYLRILHRNWILILAMTILGGAGAFGYSLLQTPTYEASSQLYVSVRSDSSGISELAQGTTFARQAVVSFVDVVDSA
VVLDRVIDDLNLDTTAQKLAGSISASSPQNSVIITIRATAADADMAAAIANSVGTNFADVVVNRLEKPEGEAASLVRVET
IAPALVPTSPSSPHTPLNVALGLIVGLAAGLGIAVLRSVLDTRIHSLHDIEAATEAPVLGGIALDPDAKKRPLIVHADPR
NPRAESFRSLRTNLQFVDVDGSSRSFVVSSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGVEGGVGLT
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLAALSDAFDYVLVDAPPLLLVTDAAVISRFTSGVL
MVAASGTTKKPQLTAAVEKLQAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPEEATSPREGGERRSRRDRADEK
>gnl|bykdb|A0A147F4Z2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium testaceum] (length=474 residues).
MELRDYLRILHRNWILILALTVLGGAGAFGYSLLQTPTYEANTQLYVSVRSDSSGVSELAQGTNFARQAVVSFVDVVDSA
VVLDRVIDDLNLNRTAQQLASSIEASSPTNSVIISIRVSDTDAETAAAIANSVGSNFADVVVNRLEKPEGEAASLVRVET
IAPALVPTSPSSPHVALNVALGVLLGLALGLGIAILRSVLDTRIHSLHDIEAATESPVLGGIALDPDAKKRPLIVHADPR
NPRAESFRSLRTNLQFIDVDGTSRSFVVSSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGIEGGVGLT
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLAALADAFDYVLVDAPPLLLVTDAAVISRFTSGVL
MVAASGTTKKPQLTAAVEKLQAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPEEPATGGKGERRSRRDRSSEK
>gnl|bykdb|A0A151BXD8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius sp. NY16-3462-2] (length=481 residues).
MRIDEYYRILRRHWKVIIAATLAAIAVMFVWDLFQPRVYQASSSGYVTAGPSQNLSEASFGDQLAKSRATSYVDVAQSRA
VAERVIDDLNLQTTPAALINQISVEQPTDTVLLRISANASSPEQAQAIANAWVKALAAQVKQIEGSSANSLRVDVVDPAQ
LPSSPVSPNTKLDLIIAGIVGLLAGIGLAMVRSQMDGRLRDPNKVREQFGVPVLGSVPQNSQLSKSEQRIPIVVGEGVRT
DTEGLITAEAFLKMRTSLQYMNVDRTLRVIVVSSPNPDDGKSTVAANIAASVALSGERTLLVDADLRRPSVATGFGLLDG
AGLAEVLAHRVDLADVLQEAPETPNLSVLAAGLTPPNPSEMVGSKAMKALLDDLSQEYFVVIDAPPLLPVTDAAILGTQV
DGVVVVITAGKTLDHQLETSLRSLREVHADILGVVMNKLTQRDMQSYYGSGYGTYYGREVAAPSTQRGSRERALRRQRSK
K
>gnl|bykdb|A0A151C1L8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius sp. NY16-3462-2] (length=486 residues).
MDLSAAVRTLRKRWQLLSLLALLGVALAAAITTQIPAVYASKVTFYVATPPSTTSSLFDASQFGTQRVNSYVKLLSSDEL
AARIVADQHLTDDPHQLATRISGTADLNTVLMTAQATGDSPAHAQQLAAGIKVAMPPLVQDLDVTPASKTPSVDLTVVTG
PTPAIQIAPNKKVNYGLGLLLGLGVGIAWALLRELTDTSVKSTAQLSEVSGQAVLGTASLAAKGASPLMPDNDGYNPLTE
EIRQIRTNLQFVNVDRPPRVIAVSSAVSGDGKTTMSVDLAAAFGETGQRTLLVDADLRRGRVAEYLKIDGSIGLSDVLAN
RIGLDDVLTETPAHLWVLPSGTVPPNPVELLDSRHMTSVIQDLADRFDVVIIDTPPVIPVTDGVVVASKCDGVILVARHG
VTKRAQIAQATSAINAVRAQCIGWILNQVPRTRKDRSYYSYASTNPTRHADHLTDKTEHASKGVTAAPDRPTQDAGPVGK
GSKGSS
>gnl|bykdb|A0A151C7E4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=486 residues).
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE
EFRRLCTNLSFVENGNKDRPDNDHSNVIIVTSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKSNYYYYEESEVKNRRTKASTGDSSQNSASRNARRGRR
TTADGR
>gnl|bykdb|A0A151D6I5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. CH7] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGLLAARNADQSLIAGNGPAESRAQAYVALINSQAVR
ERVAQDTGQDGDGSLSAALVPGSSMIKVTATSTDPETAAQLANSALQATADVAAEVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEVTGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTIASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEKYLSSVGSSARKGRRSRRKARTRS
>gnl|bykdb|A0A154V2D9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. tessellarius] (length=503 residues).
MDPHDYWTALRRRWISILALTLVGGGAGYGYATTLAPSYRSTSSVFVSSTQGATTTELVQGSTFSQNLVQSYAQLATTPA
VLAPVIARLGLDTTPNALARAVTVDTPLNTVIIDVSVTDGSPEEAARLADAVSDSLADVAGGLAPATGSGDPSISLTTVA
EAQVPRAPVSPNTRLIVLTGLLAGLAAGVLHALGRQLLDTRIRTERDVERVTDAPVIGSVQRRERGAGITLLAAPRSSAA
EGYRRIRANLEFADVDTPIRSLAITSALPGEGKTTTAVNLALALAEHSTRVLLVDADLRRPTVAQTTGLEGAVGLTTVLV
GGASLDDAVQGWAGGVDVLAAGAVPPNPNQLLGSAAMAALMAELRGRYEYVVLDTPPILPAADALTLAHLTDGALLVTRV
RATRRGQLAEAADALDGVHARTLGVVLTRVAPARHSSYYGPDAETGAEDLVPVAPAAVATDASRGVPLAPVVSAHSVTAR
TAGTDATEGAPGTRAGGSRTHAR
>gnl|bykdb|A0A160KVA5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter tritici] (length=488 residues).
MELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQAIYTQQIAQTVAKSNLATYI
PIATSRDVAQIAIDSLGLDVSPATLISAITVQPDTVAPVMKVSATASTPEGAQKLADAWVSAIATKVQQVNQETGVGDTV
TLTVLQTAALPSAPAFPNLRLVLAVGALVGLVLGLIYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVP
EADTTDYVKADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVT
DGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERSGARPDTAVE
AEPAPTSA
>gnl|bykdb|A0A161GBQ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus fascians D188] (length=468 residues).
MRMTVRRYAAALRARWLVIVATTIVGTLIAVVFSLVSTPMYQSTTQFFVTTTAVSSSDVYQNNLASQQRVVSYTELLTGR
ELARRVVDQLGLPMSPDELTDRITATAKPNSVLLDASVVDSSPAQARDIANAIGELFPTLVGELEKPVDGGTASAAVTVA
ETAEASTTPVSPKKVRNVALGFVLGLLVGIAGALVRDRMDNTVKEPDELQALTDSVLIGSIPLDKKIRDTPPINFGSSTA
PIAEAFRQLRMNLKFLSVDNPPRILLVTSCIAGEGKSTTAVNLALSLAESGNRVVLVDADLRRPHIADYLGIVGSVGVSS
VLAHDAGLDEVVQTTGHTDLWALGSGPAPPNPSELLGSSTAQSLLRDLGRAFDYVVVDSPPLLPVTDAATLATQCDGTIL
VTRYGYTRREELTRAAANLENVGASLLGVVMSMVPATGRGRDQYGYDFEPGRVPTPPTQSAPVRTNRH
>gnl|bykdb|A0A164BG91 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. TNHR37B] (length=453 residues).
MSTTQSAATRLPSVFLQLWWVIVVAGVVGGLAAFGYSSTLTPVFHSTASIYFSMRTASSGSDINQGSAYTQNQMLSFAQL
ATSAAVLDEVRDDLAGTRPDLTLTDLRRMTKVEIPQNTVVLEITAASANPEFAAEVGNSIADNLTQAVYTIAPKDDKGES
TVVARVIDPAVPATVQSSPNKSQNAVIGVLIGALLAALALSAWALLDTRVRSRNALAEVTDLPVLGAVPRQKGKPSGPVV
LTKPNGHGAEAYRQVRSALKFSAVEHRIGAIAVTSSVAGEGKTTTAVNLALAYVESGQRVLLIDADLRRPTVATTLGLEN
AVGLTSVLVEAVEAEDAIIESAGGLAVLTAGEPAPNPAELLASNRMRLLVEALRPSYDLVVIDTAPVLSVSDATVISQYV
DATIAIINTRKTAKTQVERCIAALTGVRANLAGFVLNNVAEARRDRYYYLSEN
>gnl|bykdb|A0A165I7L3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. T32] (length=551 residues).
MDMQRVARILRAYWKTIVALTIIGGLAGLAWSALQPRVYTADASGYVASVSSDGSTGAALAGDTLALSKVKSFIDMGYWR
AVAETARDELGIADSPESLVERVHVSNPVDTVNVRVEATGPTPESARDLAQAWLHGMTVQVDQLESTGGGRGAVRLVAGD
SARLPSAPSSPNVKLDVAVGAIVGAVAGVVFALVRRAFDRRVRSARDISDAVDASVVGILPVDKELAAGRAVFSFDDIRD
GRGSFAHKEAVRELRTNLQYVDVDHPARVMVVTSPLPGDGKSTTASNLAVSIAATGQSVILIDADLRRPVLGATFGFSDD
VGLSDVLAGRARIDQVAHQVDEHGRLFIVAAGRTPPNPSEMVGSQRMQQLARGLADDMVVIIDSPPTLAVADAAVIASWA
DGAVLVVTAGRTTDDMLVRAVGNIAKTRGRLLGVVLNRVPLRGVDSSYYGTQYGGYYGYGVPTSGAARTVWWRRLLRRGE
SATPGADEAAPGPRRRSTDLPPDNVSGLRTLSPRRNVPALPGDPGREGREAAGTAPQSARDDLPSRRRQRG
>gnl|bykdb|A0A165S8K4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces sp. NDB4Y10] (length=467 residues).
MELRDYLRILRGSWVLISVLALLGIGAGAAYSIVTTPKFSSSAKVFVSTSNGTTVTELQQGNTFTQQRVKTYADLVTTPI
VLLPVIDQLSLDLTGEQLAEQVTATAPLDTTLIEITVTDVDPALAAEIATAVSESLTEVVESIEASQTPEGEPTSPVRLT
LVQHAAVPQTPVSPNVPLNVALGGLVGLALGIGLAVLRETLDTRIRNERDVELVTETPIIGGIVFDPKANERPLIVHADP
QSPRAESFRTLRTNLYFLDADRTNRAFVVTSSVESEGKSTTTANLAIALADAGARVLLVDADLRRPKQADYLGLEGAVGL
SDVLIGRADLQDVVQRWGRNSMFVLPAGAIPPNPSELLGSTAMVELIAEANRSFDVVLFDCPPLLPVTDAAILARNVGGT
IVVVAAGRTHRGQLKGAMAALANVDAPVSGVVITMLPTKGPDAYGYGRYGYGYGYGYASEAPAVTAP
>gnl|bykdb|A0A171DSR6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. HM58-2] (length=486 residues).
MDLRHYLRVFRAHWLGMLLLVVAAVAIAFGWTLLQPRVYTADATAIVQATASGDDVGSKMLGNQLASSSVKTYVDLGTSR
SVAERVIEELELDTTPDRLVSQVTVTNPLDTFSLKVTATASSPEGARDIAEAWVRGMAAEVNLLETADEEEAGLVHLAAI
DSARLPESPSSPNTRLALAVGALIGMAVAFGYAMLRYTLDRRIRSVDAVEKELGIAVVGTLPEEKSFTPENRLIPQDGGN
SANSAHAHLFAIAEAMRELRTNIQFMDVDNPPRVIVVTSPLPGDGKSTTASNLAITLASSGERVLLIDGDLRRPMIGKIF
GLVEAVGLSEVLSGRADITQVAQRIPGRDNLIVVAAGKLPPNPSEVLGSVKMRDMLQAVSREAIVIIDAPPLIPVTDAAV
LAQHADGAIIVATVGKTTFEVLGKALGNLARANARALGVVLNRVPRRGSGAAYYGYQYHGDYYRADSEESEEDLAPGPRR
RRAAVE
>gnl|bykdb|A0A172X5A6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia xyli] (length=518 residues).
MTRNPYLALFRHFWYVVVAGALIGALAGWGVSQLATRMYTSTTSMYFSLSAGVSGNDINQGSTYTQNQMLSFAQLATSPV
VLQPVIDSLDLSVEPGTLAKQISVTTPQNTVVLQLDVTDTSPKQATDIANAVAASLRTEVEDIAPKNAQGNGTVTTRVIE
PAVEPAGPSAPNERLNILLGLIVGILAAAGALLLWEALSTRVDSEEKALAVTGAPSLGTVRRRRGAAQGLAMVGDTRSPS
AEDFRQLRANLEFVAVDVEAPVFVITSSVQGEGKSTVATNLAIALSEGDKRVLLIDADLRRPAVAHYTGMVPDTGLSTIL
AGRISLEDAVQPWGDGALTVLTAGRIPPNPSELLSSRAMAALIAEARKRYDVIVIDTPPLGAVADAASLVSVADGTVVVV
DRTTVRRSQLTHTVDAIRRAGGSVAGVVLNKARGKRSGTAYYYYKEDEVRGASGAPTSHHATEGRAPKNRLLIPRRSEPT
AKPAEPEVKPDAQTDANPTEAETETEDSPSETAPLSRK
>gnl|bykdb|A0A174A3G1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RSIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A174B9F5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudocatenulatum] (length=501 residues).
MAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVNITAETGDAKQASDIANS
VAESLSNVVEKSLYASGKESPVKLSVVQRAAEPISPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASDLQDII
NAPIMGRIPTDESLQSNKPIIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLDAALQT
YDYVIIDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYYYYYYY
DEDGKKSKHAHKNSRKKSKHN
>gnl|bykdb|A0A174BGC0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASQNGVDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RGIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIEFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLFIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVGRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A175S221 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium luteum] (length=475 residues).
MTFPDFVRVIRRSWLLVVALSTLGLAGGAALTLSATPLYSSTTKVFVAVQSTGTTTSELVQGNSAAQQKVSSYIDVVTTA
SVLQPVIDELDLDESVAALAGRVTAASKVNTVVIDITVQHPDAATAAKVAGAVGSSFAKVVTEDLETPTSGGPSLVRIGT
IEPPVVPTTPTSPKLTTNLVLGLTVGLVLGIAAALIRSTLDTKVRTQEDVRAVTELPVLGGIGFDPAATKQPLIVHVDPR
NPRAESFRTLRTNVQFVDLDDTVRSFTITSSLPSEGKSTTAANLAIAMAESGVRVIIVDADLRRPRLDDVLGVEGAAGLT
DVLIGRAELDDVIHPWGSGGLHVLPAGRIPPNPSELLGSARMRALVDHLSTAFDYVIIDAPPLLPVTDAALLARLTDGAL
VIAAAGRASRNQLRVALDALASVGGRTLGLVMTMLPTKGAGSYGYGTYYAYYGRGGSAVDFSAVPRTGGRRAARS
>gnl|bykdb|A0A176UCN8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. OY3WO11] (length=507 residues).
MGLRDYARVARTYWKHIAVVTLIVTLLATAWSTFRPRIYAAEASAVVLAVGTDNVSSLLAGDTLAKARAKNYKSLAESRL
VADNVRLSTGLNMSSDALLGAISVTVPRDTAEIRITAESPDPTIAQRVADAWIVELSKQVQDRERAATATSGQPLEAVTP
PLSLVPLDPAALPTTPVSPGVALTAVYGAALGLLLAYASALLRDRLDRRLHTAAEVEHLFSVPVIGALPVDLRLTGENKV
LGGVPAAPTPGSRAQSPAFAEALRELRTNLTFLDVDNPPRIIVVTSSVSGEGKSTIAANLASAMSAGGEQVIVVDGDLRH
PSMAKIFDVIPGIGITDVLTGKAEVDDVLQQRSDLPNLSILGSGRIPPNPTELLGSHAMKQLIESLSEKGIVIIDAPPLL
PVTDAVLLARIADGAIVVVRAGRTTKDQLTKSLGNIRKVHGAVLGTLLNCVPAKEFDGYSYYSSDPDSADNDPSEDADDS
PVVIEPESPPAFRGSSREQTSRSVTSF
>gnl|bykdb|A0A181Z7W1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. 9128] (length=510 residues).
MWQYFPADCWENPGSLARGTARPASHGEGRRVELRDYITVLRKGWVLILVLALVGVAAAAGFSVLKQPVYSASAQVFVST
QTSGSASDLAQGNTFTQQRVLTYSNLVTTPIVLLPVISSLKLDMSADDLAKLVTADAPTNTTLIAITVNETDPVQAADIA
NATSQSLTNVVQNIEATDANGASTVKLTRVKEAQVPSTPISPNVPVNVVLGLLVGLALGVGLAVLRETLDNRVRTEADIE
KISDKPIVGGIAFDNKASERPLIVQVDPRSPRAESFRTLRTNLQFVDIGSDARTFVMTSSVQSEGKSTTVANLAIALDSA
GYKVILIDADLRRPRVAQYMDLEGGAGLTDVLIGRAELEDVAVPWGRGNMVVLPAGEIPPNPSELLGSQAMSMLIERLEA
QFDYVLFDAPPLLPVTDAAILSKKASGAIVVVASGRTMKGQLAGAVQSLENVGAPIAGFVMTMMPTKGPGAYGYGRYGYA
YGYGTDEDEAPKPPKQARRGRVGALRKAER
>gnl|bykdb|A0A181Z8L4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. 9128] (length=458 residues).
MNHFVVARALLSGWWIVLAVSIAGGGVALVVTSTTPPTFRASTSYYVSVAGQESASAGEIAQGSTAAQQKIKSYTVLASS
PRVLEQVIAALRLDTTPAALGRRVTSVVSTGTVIIEISVTDGDARAAARIAAATGRVLAEVVSEIEPRTTSGEPSVRLER
VSEASVPTAPIAPRTSVDLALGFAAGLAFGTGLALLRAAADTRVRSAEDIDADVPLIGEIGMDPEASRQPLIARDEGTTT
RAEAFRSLRTNLQFLRTGGVSTIAVTSPRPAEGKTTTTLNLAIALAQSDVRTVVVDADLRRPNVASTLDLEGAVGLTDLL
VGRAELDDVLQEWGFDAFSVLPAGTIPPNPSELIGSAAMEQVIADLTERFDVVLVDTPPVLAVTDAALVSTLVSTTLLVA
AAGQTKRSDVRLAVTALTRVGERVDGVVLTKSRRPVADGYYARPGTTTSAPIALRSTS
>gnl|bykdb|A0A196LJH7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. H83] (length=482 residues).
MTLQDYIDALRRQWIVIVALTVLGVGAAFGYARTLPPEYSSTAAVMVIAQRGDSTNELVQGSSYVQSLVQTYAVLASSPL
VLSPVIEELDLDETATQLAKRVSVVNTLNTVVIEISVTDTDKERAQETAAAITDSLISAVSDVSPSDAEGQPAVRLETIA
PARMPQAPIGPNTRLLTIIGAAIGFGLSVAYALFRRVLGTRMTERSDIAAVTDAPVLGEIVAWRRNYTILSTMLRSRDSR
SAESFRALAANLKYVAVDRDLRVVMVTSSAPHEGKSSVSIGLAAALAESGHSVVIIDADLRRSSVANALQLEGAVGVTSI
LVGDVTLEETVQHSESMNIDVVAGGATAPNPGQLITSHRLRDLVAEARDRYEYVIIDSAPALVVSDALWLADLADGVLVV
ARSGKTRRKQISAVLSTLKSTHKDVFGIVLNAVKRNESSPYYQPDVPTRRWPRSSARKSVTATSGAAKSGATESRVEDAP
DA
>gnl|bykdb|A0A1A0TFG1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. 852013-51886_SCH5428379] (length=489 residues).
MTLQDFISVLRARWITVCVTIVVAVLGGVALTLLTTPLYQASTRLFVSTGSGSSLSDVYQGNRFSQERVISYAELLMGET
LAQRTIDKLDLDEDSTTLRENVKATVKPDTVLINVEVLDESPIRARDIANALSDEFVTMVRELETPEDGTPPESRVVVEQ
RASIPDTPVVPKTARNIAVALGLGVILGMGLAILRDRLDNTVKDRKTLESITGAGVIGNIPLDKERRKHAAISFEVDNSP
IAEAFRKVRTNLQFVAVDNPPRVIVVTSSVPSEGKSTTAINIALALAESDNKVVIVDGDMRRPTLHKHLGAVGPVGFSTV
LSGGATLSEALQQTRFPGLKVLTSGAIPPNPSELLGSQSARKLLNELRGEFDYVVVDSTPLLAVTDAAILAAGADGVLVM
ACYGRTKRDQISHAVQSLESVAAPILGAVLTMTPARSNAAYGYGYGYYGDRSEQGQDAPATPTTPAPDASANGSGHSPSS
AATHRRPVE
>gnl|bykdb|A0A1A0XID5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia sp. 852002-50816_SCH5313054-a] (length=457 residues).
MTSRNLALRRVSNSLSLVVRAWWIVAMCALVAGTSAFLYSLNETPVYRSTATLYVTAGTDANTAAAYQGSLASQQRIGSY
AQLVLSDSVLSAAIRDSGSSKSVSELRAMAEVKTTPETVLLKVSVYDPDSAEAAMLANSISAALLSSIDSLERPPGASEA
LAKATVVSPAVATSVPVSPNRKRYVVFGIIIGALVGILIVVIRSRFDNKVRTPDDVKDMELSVLSVIPADEALASRRFGP
DYSFGATAAAEAYRKLRTNLSFVVVDTPSHCLVVTSPRPGDGKTTTAISMAIASAEDGKKTLLVDADLRRPTIDERFGLA
GSVGLSTVLSANLDWRDAIQDTEWQSLSVLCSGEVPPNPAELLGSARAVSLFEALKEEYERIIIDSPPVLPVTDSAVLAA
LADGVVLVVRSGTTKTTDTVSAVEQLERADAGVFGVVLNYAEASNGVYSYLYEYSRP
>gnl|bykdb|A0A1A1YNQ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. ACS1612] (length=475 residues).
MTIQELLRAMRARWLIIVATAAVAVAATVFYNILTTPLYESSTRLFVSTSAAPGDASQIYSGTLSSQQRVVSYTKLLTGE
TLAQRVVDKLHLDMTAEALRKEVKATAPPDTVLIDVSVLDASPVRARDIADALSDEFVVMVRELETPPDGEAPVARVVVE
QHASVAAKPVIPETTRNIAIGLALGVLLGIALAILRDRLDNTVKSRQVFEEIAGAGLIANIPFDKDRRKDPGISFANDVS
PIAEAFRELRTNLQFLEVDDPPRVLVVTSSLPDEGKSTIAINIALALAEADYNVVVIDGDMRRPKLAEYLDVIGSVGLST
VLAGRASLPEVLQKTRFPGLTALTSGAVPPNPSELLGSEAAKKVLRELRGGFDYVIVDSSPLLAVTDSAILAAESDGVLV
IAKFATTKREQLAQAIENLTKVGARILGGIFAMSPTGKTGNYHYPYYGKEQKPAAGAHPAFRHGADDRLRHRRKQ
>gnl|bykdb|A0A1A3GKG5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium mucogenicum] (length=452 residues).
MKLQDFLKLMRARWITVCAAIVVAIVGAIAVTWTTTPLYRASTQLFVAASASGTPTDINQGNLFSQQRVISYAQLLMGKT
LAQRTVDKLKLGIPAAELQEKVKATVKQNTVLINVDVLDASPVQAADIANALSDEFVTMVRELETPVRGVQPDARVVVEQ
RATVPEHPVVPDVARNILVGLGVGVLLGVVLAVLRHVLDNSIKSRESLEEVAGAGMVGGIPLDKQCVKQPAIAFGNANSA
IAEAFRKLRTNLSFLAVDNPPRVIVVTSSVTGEGKSTTAINIALALAEGENNVVLVDGDMRRPSVDKLLGVDGPVGLSTV
LSGAVPLDDALQKTRFDRLTVLSAGTIPPNPSELLGSQVAMKVLAELRAQFDYVIIDSSPLLAVTDGAILAAHSDGAIML
ARYGHTRREQLAHAVSNLQAVGAVLLGVVLTMVPTRGDSSYAYSYYGDGNAE
>gnl|bykdb|A0A1A8Z813 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora auratinigra] (length=484 residues).
MDVLGYLQLVRRHWWIVLVTLMAALGVAAAVTVRTAPQYRASVTFFVTTPSQGVSDAYQGGLFLQQRVKSYADLLASDRL
AQSVVAEAPLGLTADQVQRQLTTNTEAGTVLLRATFTDTDQARALKTTEALAAKFVELVQKVETPPDGKAPPIKLEVVSG
PRVTSAPVSPQPARNLTIGALLGLLLGSALAVLRGMADVRLRDAAGLQRVTGSPLLGEIPFDANAKSAPLIVGDAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVAEYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAARALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVLPPAAPSVPTDRAGVARRGGHAAGRDRTQELT
RLSR
>gnl|bykdb|A0A1A8ZEN5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora narathiwatensis] (length=485 residues).
MDVLSYLRLIRRHWWIVLITVMLALATAALITVRTPPRYQASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQGVVSESPLGLTADQVQSRISTSTEAGTVLLKATFTDTDQTRALKTTEALSAKFVELVQKVETPPDGKSPPIKLEVVSG
PRVTSSPVSPQPVKNLVIGGLLGLLLGAGLAVLRGMADVRMRDAAALQRVTGSPLLGEIPFEAGAKSAPLIVGEAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAARALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPPAASVPADRARSARHGGSAASGVGDRTQEL
TRLSR
>gnl|bykdb|A0A1A9BBH4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sediminicola] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLALGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYGDLLTSDRL
AQSVVAEAPLGLTADQVRNRITTVATTGTVLLKATITDTDQTRALKTTETLAAKFTELVRKVETPPDGKSPPIKIEVVSG
PRVTSSPVSPQPVRNLVLGGLLGLLAGAALAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGDAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGAAPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPAAPSVPTDRAGTRRGGQPAVGDRTQELTRL
SR
>gnl|bykdb|A0A1B3PZG7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium avidum] (length=523 residues).
MTIVDVVRILRRNLALLIVCTLAGGLLGAVYQLTRPETFTAKATGMVVAGDSTSVGETMSGNTIAQQRAATYTKLVETRT
MAQKTSEILKKQGMPEAANGQLSASVPGDTAFIDIKATGDTAKNAQALANAGLEALISEALRMETYGQIAASDHKSDAQL
AKMTSVHVLGYESAGLPSGDRGKSVALYVVAGLVAGFLIGAVVAVVRKQFDVKVRDQATIEELTGSGILSVIPDDKKLAE
QREKSIVHISGVTGEAFRHLRTNLRFANVDNPPRAVVVTSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
FGAEAGVGLSQVLAGDVTLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLTELRKRGYFVVIDAPPLLAVTDAG
LLGAIADGTIYVAVVGKTHRDQVSLVAKRLQQVGAPLLGSVLTRVPRKKMGDVLYGYGAANYGYGSYYGDYGKRGYSSYS
SEEQDSRESIAVVQEAQSTEGLVRVPKKDRADTDTEITPRRAK
>gnl|bykdb|A0A1C0AIE6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus lapidicaptus] (length=449 residues).
MQIVRRYWRSTLATVFLCIALAAGFTVLQSPTYTATSSVFISVESGGTAGELSQGATYAERQVGSFISVATSAMVLQPVI
DELVLDLSVKELAEKLSVSSPSATSIIKVSADDESAQRSADLANAVAASLQRSTEELAPPGPDGNRLVSATIIDQAVVPE
SPSAPLPGMNLALGGLLGLLLGFGQAVLRTVLDTRVRTTEDVADLTDAPVLAAIEHHEPSHVANRAATAGGGVQWASAEA
YRKLRTSIGFVGLGGERRSSMVITSSVDSEGKTETATNLARVLALAGERVLLIDADLRRPAVGERLRIDSELGLSDVLTG
RGSLHDLIIAMPPGHLSVLPAGTVPPNPSELLGSEAMQHLLATVERQYDYVLLDAPPLLPVTDAVILAAQTGGAVVVSRS
GSVRRQQLATALSALESADATLLGVVLNDVPSLRADSYGYYTPTKVQPV
>gnl|bykdb|A0A1C3N102 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora krabiensis] (length=486 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQTVVAENNVGLTADEVQRRVSTSTEAGTVLLEASVTDTDQARALKVTETLAAKFVELVQKIETPPDGKAPLKIEVVSGP
RVSSEPVSPQPVRNLVLGGLLGLVLGIGLAILRGVADIRLRDAAGLQRATGSPLLGEIPYESGARSAPLIVGDAATSSRA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGIDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVSQ
QGRTSRAQVAAAARALHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVAAAESSVAASDGAATPRHAEGGRLNGVSDRTQE
LTRLPR
>gnl|bykdb|A0A1C4FI90 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia sp. v-85] (length=500 residues).
MTSSNIAPDGAPTARSFSMDHLRFLVRRNWWIVALSGAVIGCLGLGYCLLQTPLYVSSAKLYVTSGTEADAQSAYQGSLA
SQQRVASYAELVDSDVIIREALDDSGLQMSIDDARESLSATSNPDTVLLRISAENSDPALATQLANGVAEAMTSYVTTLE
QPNEASQPLAKLTVVSPAVQPDEPFSPRTARNTVLAVLVGLVLGLLIAVLRERFDTRLRNGDEVQRSVSSAVLAEVPSEN
NLDGNPVIDFSVGSSRAAEGYRRLRTNLAFVRVDEPPRCILVTSPGPGEGKTTTSMNLAAALAEDGNRVVLVDADLRRPS
IARRLGLTGAVGLTSFLRGDGVISDFVQAGPVHGLDVLVAGALPPNPAELLGSHRAKDGIEALQSSYDFVIVDTPPVLPV
ADAAILSQFTDGALVVVRAGRTRSQDLTTAFSSLRTAQASILGIVLNDVSAHDSRYVYYSYEQQMAGRERATGKHVAPAR
DQASVEGDVPRVGTATGSTT
>gnl|bykdb|A0A1C4UD01 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora chaiyaphumensis] (length=484 residues).
MDVLGYLRLVRRHWWIVLVTVMIAVGAAALVTIRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVAEAPLGLTADQVQHRITTSTEAGTVLLKATVTDTDQTRALKTTETLSAKFIELVQKVETPPDGKAPPIKLEVVSG
PRVTSSPVSPQPVRNLVIGGLLGLLLGAGLAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGEAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPAAGPSVPTDRAGVARRGEKAPVGDHTQELT
RLSR
>gnl|bykdb|A0A1C4V106 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora tulbaghiae] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLGLGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIHTTATAGTVLLKATITDTDQTRALKTTETLATKFTELVRKVETPPDGKSPPIKIEVVSG
PRVTSNPVSPQPTRNLVLGGLLGLLLGVGLAVLRGVADVRMRDGAGLQRVTGSPLLGEIPYETGARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPPAAPSVPADRAGARRGAKAVGDRTQELTRL
SR
>gnl|bykdb|A0A1C4VS21 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora saelicesensis] (length=487 residues).
MDLLRQLRHVRRHWWVALVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPSTGVTDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQRRVSTSTETGTVLLRASVTDTDQTRALRVTESLANKFVELVQKVETTPEGKTPIKIEMVSGP
RVSANPVSPQPVRNLTLGGLVGLILGIGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFEANARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVKVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTAEASVPADRAASGRHSATADGVNGIPDHTQ
ELTRLPR
>gnl|bykdb|A0A1C4WAW4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora marina] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLGLGAAALMTVRTTPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIQTTATTGTVLLRATITDTDQTRALKTTETLATKFTELVRKVETPPDGNAPPIKIEVVSG
PRVTSAPVSPQPTRNLVLGGLLGLLLGVGLAVLRGVADVRMRDGAGLQRVTGSPLLGEIPYETGARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRTLLIDADLRRPKVADYLGIDGGIGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAANALSSVSVRLLGCVLNMAKVTKSDAYQYEAYKVGVPPAVPSVPADRAGTRRGAKAVGDRTQELTRL
SR
>gnl|bykdb|A0A1C4XRD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora coriariae] (length=486 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAENPVGLTADEVQRRVSTSTEAGTVLLRASITDTDQSRALRVTETLAAKFVELVQKVETPPEGKAPIKIEVVSGP
RVSASPVSPQPVRNMTLGGLAGLLLGVGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFESGARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTATPSVPTDRATSARHSESTGVNGVSDRTQE
LTRLPR
>gnl|bykdb|A0A1C4Y4C1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora chokoriensis] (length=487 residues).
MDLLRQLRHVRRHWWVALVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNTGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAETPVGLTADEVQRRVTTSTETGTVMLQASVTDTDQTRALRVTESLSAKFVELVQKVETTPEGKAPIKIEVVSGP
RVSANPVSPQPVRNLTLGGLIGLLLGIGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFEGNARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTPTQSVPAERTASGRHVATTDGVNGVTDHTQ
ELTRLPR
>gnl|bykdb|A0A1C4Y9N1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora purpureochromogenes] (length=486 residues).
MDVRTCLRLIRRHWWIVLVTLMVAVGSAALITVRTPPRYVASVTFFVTMPSQGVTDAYQGGLFLQQRVKSYADLLRSDRL
AQSVVAETQVGLTADDVQRRLSTSTETGTVLLRATVTDTDQTRAMKVTETLAAKFVELVQKVETPAEGRAAPIKIEVVSG
PRVSSSPVTPQPTRNLIVGGLVGLLLGAALAVLRGLLDVRMRDAAGLQRVTGSPLLGEIPFEAGAKAAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRTQVAAAARSLHSVSVRLLGCVLNMTKVAKADAYQYEAYRIATTGKTKVPADRAPAARHGESNGFDGVTDRTQE
LTRLRR
>gnl|bykdb|A0A1C4YLW4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora viridifaciens] (length=482 residues).
MDVLSYLGLIRRHWWIVLVTLMLALGTAALVTVRAPARYQASVTFFVTTPTQGVSDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAESPLGLTADQVQGRISTATEAGTVLLKVTFTDTDQTRALRTTETLAAKFVELVQKVETPPDGRSAPIKIEVVGG
PRVTSSPVSPQPVKNLGLGGLLGLLLGAGLAVLRGLADVRMRDATALQRATGSPLLGEIPFEAGAKSAPLIVGEAASSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRGQVVAAANALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPPAPSVPTDRARAARRGSTGVGDRTQELTRL
SR
>gnl|bykdb|A0A1C4ZLL7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora echinospora] (length=482 residues).
MDLRTYLQFVRRQWWIVLVTVLLALGAAGWLTVRAEPRYVASVTFFVTTPSQGVTDAYQGNLWLQQRVKSYADLLRSDRL
ARTVAADPVLRLTPQQVQDRLDANLQNGTVLIEATITDTDRNRALRVAEAVSVKFADLVKTVETPPEGRSSVKMEVVSGP
GVGANPVSPRMDRNLLLGGLLGLLAGIGLAVLRGLVDTRLRDGDTLQRATGSPLLGEIPFDPVARTAPLVVGDAATSARA
EAVRKLRTNLRFVDVHEPARIIAVTSALQGEGKTTLSCNLAITLAEAGWRVLLVDADLRRPRVAEYLGLERGVGLTDVLL
GDVEVGDVVQRWGDRSMLVLPSGSNPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALMVSQ
QGRTSRNQVARAAKALHAVSVRTLGCVLNMARVAKADAYQYEAYRVAADRRNVPADRATARHGAGHRSGAGQAAQDLTRL
PR
>gnl|bykdb|A0A1C5AG23 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora matsumotoense] (length=485 residues).
MDVRTCLRLVRRHWWIVLVTLMLTVGSAALVTVRTAPRYVASVTFFVTAPNQGVSNAYQGELFLQQRVKSYADLLRSDRL
AQAMVAETSLGLTADDVQRQVATSTEPGTVLLRATVTDTDQARAMKVTEALSAKFVELVKKIETTSDGKAGPTRIEVVGG
PRVSSSPVSPQPNRNLALGVLVGLLLGVALAVLRGMVDVRLRDAAGLQRATGSPLLGDIPFDPGAKAAPLIVGEAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGVDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLSLRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQAAAAARSLHSVSVRLLGCVLNMAKVARADAYQYEAYRIATTAGPSVPADRATAAQRGDQGLPPVGDRTQEL
TRLPR
>gnl|bykdb|A0A1C5G976 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora echinofusca] (length=485 residues).
MDVYRQLRLVRRHWWIVLLTVMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSVVAENSVGLTAEEIQRRVGTSTETGTVLLRASVTDTDQNRALKVTELLSAKFVELVQKVETTQDGKAGPIRIEVVSG
PRVTPTPVSPQPVRNFAVGTLIGLLAGVGLAILRGVADIRLRDAAGLQRTTGSPLLGEIPFESTARSQPLIVGEAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDAGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRSQVAQAARALNSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVAGAATPDLPADPAPVARHAERVDVVSDRTQEL
TRLSR
>gnl|bykdb|A0A1C5GRE8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora humi] (length=484 residues).
MDVLGYLRLVRRHWWIVLITVMLAVGTAALVTVRTPPRYQATVTFFVTTPSQGVTDAYQGGLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRGRITTSATTGTVLLKATLTDTDQTRALKTTEALATKFTELVRKVETPGDGKAPPIKIEVVSG
PRVTSSPVSPQPFRNLVVGGLLGLLAGVGLAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGVDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGAAPPNPSELLGSKAMSDLLVALRESADIVIIDTAPLLAVTDGVVVAVQADGALLIT
QQGRTSRGQVAAAARSLSSVSVRLLGCVLNMAKVGKADAYQYETYKVVVPPAPTAVPADRAEAARRGAPPAEENRTQELT
RLSR
>gnl|bykdb|A0A1C5H5Y4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora coxensis] (length=484 residues).
MEVRTYLRLIRRHWWIVLVTLMVAIGSAALITVRTPPRYVASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYADLLRSDRL
AQSVVAETPLGLTADDLQRRVATSTESGTVLLRATVTDTDQARAMKLTETLASKFVELVQKVETPPEGRSAPIKIEVVSG
PRVSSSPVSPQPTRNLLLGALIGLLLGAGLAVLRGLVDVRLRDAAGLQRVTGSPLLGEIPFEPGAKAAPLIVGEAATSAR
AEAVRKLRTNLRFVDVNEPARVIAVTSALQGEGKTTLSCNMAIALAEAGWRVLLVDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRTQVAAAARSLHSVSVRLLGCVLNMTKVAKADAYQYEAYRIATKPSVPADRASAAHRAGPAGAARVTDRTQELT
RLSR
>gnl|bykdb|A0A1C5HF13 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora halophytica] (length=484 residues).
MEVRTYLRLIRRHWWIVLVTLMVAIGSAALITVRTPPRYVASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYADLLRSDRL
AQSVVAETPLGLTADDLQRRVATSTESGTVLLRATVTDTDQTRAMKLTETLSAKFVELVQKVETPPEGRSAPVKIEVVSG
PRVSSGPVSPQPTRNLLMGALIGLLLGAGLAILRGLVDVRLRDAAGLQRVTGSPLLGEIPFEPGAKGAPLIVGEAATSAR
AEAVRKLRTNLRFVDVNEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDGGIGLTDVL
VGDVQVGDVVQRWGDKSMLVLPSGSTPPNPSELLGSKAMADLLLALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRTQVAAAARSLHSVSVRLLGCVLNMTKVAKADAYQYEAYRIATKPSVPADRASAAHRAGSAGANRVPDRTQELT
RLSR
>gnl|bykdb|A0A1C5HYD2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora echinaurantiaca] (length=486 residues).
MDLYRQLRLVRQHWWIVLLTIMVALGVTAFVTVRAEPRYVASVTFFVTTPSQGVTDAYQGGLLMQQRVKSYAELLTSDRL
AQAVVAENSVGLTAEEIQRRVSTSTETGTVLLRASVTDTDQTRALRVTETLSAKFVELVQKVETPANGQTGPIKIEVVSG
PRVSSSPVSPQPVRNFAIGGLLGLLCGMGLAILRGLADVRLRDAATLQRTTGSPLLGEIPFEGSAKSEPLIVGEAVNSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRTQVAAASRALHSVSVRLLGCVLNMARVPKTEAYQYEAYRVVASTATTSVPADRATSGRHAERAGAGVPDRTQE
LTRLPR
>gnl|bykdb|A0A1C5I042 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora zamorensis] (length=487 residues).
MDLLRHLRHVRRHWWVPLVTIMVALGVSAFLTVRAQPRYVASVTFFVTTPNAGISDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQRRVTTSTETGTVLLRASVTDTDQTRALRVTESLAAKFVELVQKVETTPEGKAPIKIEVVSGP
RVSANPVSPQPVRNLTLGGLIGLLLGVGLAILRGIADVRLRDSAGLQRATGSPLLGEIPFEASARTAPLIVGEAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTPPASVPADRAASGRHVATTDGVNGVPDHTQ
ELTRLPR
>gnl|bykdb|A0A1C5JCL2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora inositola] (length=486 residues).
MDVRAYLRLIRRHWWIVLVTLMVALGTAALVTVRTPPRYVASVTFFVTTPSQGVSDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAGNSVGLTAEQVQRRVTTSTEAGTVLLKATVTDTDQTRALKVTETLSAKFVELVQKVETPPDAATATIKLEVVSG
PRVSSRPVSPQPVRNLVIGGVLGLLLGMALAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGARSAPLIVGEAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLIT
QQGRTSRRQVAAAARSLHSVSVRLLGCVLNMAKVPKADAYQYEAYRVAVPPAPAGPADRAPAARHGDRAGAGRVSDPTQE
LTRLSR
>gnl|bykdb|A0A1C6S5M8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora aurantiaca] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLGLGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIHTTATAGTVLLQATITDTDQTRALKTTETLATKFTDLVRKVETPPDGKAPPIKIEVVSG
PRVTSNPVSPQPTRNLVLGGLLGLLLGVGLAVLRGVADVRMRDGAGLQRVTGSPLLGEIPYETGARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVVPPAAPSVPADRAGTRRGAKAVGDRTQELTRL
SR
>gnl|bykdb|A0A1C6SCX7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora inyonensis] (length=482 residues).
MDLRTYLQLVRRQWWIVLVTVLVALGAAGWLTVRAEPRYVASVTFFVTTPTQGVTDAYQGSLWLQQRVKSYADLLRSDRL
ARTVAADSALGLTPDGVQNRLDASLQNGTVLIEATVTDTDRTRALRLAEAVSVKFADLVRTVETPPEGRSSVKMEVVSGP
GVGTEPVSPRMDRNLLLGGLLGLLAGIGLAVLRGLVDTRLRDGDTLQRATGSPLLGEIPFDPDARTEPLVVGDAATSARA
EAVRKLRTNLRFVDVHEPARIIAVTSALQGEGKTTLSCNLAITLAEAGWRVLLVDADLRRPRVADYLGLERGVGLTDVLL
GDVEVGDVVQRWGDRSLLVLPSGSNPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALMVSQ
QGRTSRNQVARAAKALHSVSVRTLGCVLNMARVAKADAYQYEAYRVAADRRNVPTDRATARHGAGNRSGAGQAAQELTRL
PR
>gnl|bykdb|A0A1C6SUF3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora rhizosphaerae] (length=488 residues).
MDVRTYLRLIRRRWWIVLITLVVALATAALITVRTTPRYVASVTFFVASPSQGATDAYQGSLLSQQRVKSYADLLTSDRL
AQTVVTANPLGLTAEQVRRKVSTSTPPDTVLLEASVTDTDRTRALRLTQTLSVKFTELVQKVETSSGGGSAPMKIEVVNG
PRVSSAPVSPQPLRNLALGTLLGLLAGMGLAVLRGVADVRMRDGDNLQRTTGSPLLGEIPFEADAKSAPLIVGEAALSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSAMQGEGKTTMACNLAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
ISDAQVGDVVQRWGDRSLLVLPSGSAPPNPSELLGSKAMGDLLLTLRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
RQGRTSRTQVAAAARSLHSVSVRLLGCVLNMSKVTKADRYQYEAYRVPAPATGSAVPADRAATAARDGDGAGVDDVGHGT
QDLSRLPR
>gnl|bykdb|A0A1C6TUT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora citrea] (length=485 residues).
MDLYRQLRLVRQHWWIVLLTVMVALGITALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSVVAENPIGLTAEEVQRRVSTSTETGTVLLRASVTDTDQNRALKVTELLSAKFVELVQKVETTQDGKAGPIKIEVVSG
PRVSPTPVSPQPVRNFAVGTLLGLLAGVSLAILRGLADVRLRDAAGLQRTTGSPLLGEIPFESTAKSEPLIVGDAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDAGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRTQVAAAARSLNSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVTATGTPDVPADRAPSARHAERIDGPGDRTQEL
TRLSR
>gnl|bykdb|A0A1C6TZX7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora chersina] (length=483 residues).
MDVLGYLRLVRRHWWIVLVTVMIALGAAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVAEAPLGLTADQVQRRITTSTEAGTVLLKATVTDTDQTRALKTTETLSAKFVELVQKVETPPDGKAPPIKLEVVSG
PRVTSSPVSPQPVRNLVIGGLLGLLLGAGLAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGEAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVGDYLGLDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPAAPSVPTDRAGVARRGEPAAVGDHTQELTR
LSR
>gnl|bykdb|A0A1C6UFA3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora eburnea] (length=483 residues).
MDVVSYLRMVRRHWWIVLITVMLALGTAALITVRAPVRYQASVTFFVTTPTQGVTDAYQGSLFLQQRVKSYADLLTSDRL
AQNVVSENPLGLTADQVRSQTSTTTQAGTVLLKATFTDTNQNRALKTTEALSAKFVELVQKVETPPDGKLPPIKIEVVNG
PRVTSSPVSPQPVRNLILGGLLGLVLGAGLAVLRGLADVRMRDAAALQRVTGSPLLGEIPFEASARSAPLIVGEAANSTR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGVDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLIT
QQGRTSRSQVAAAARALHSVSVRLLGCVLNMAKVAKADAYQYEAYRVVVPPAPSVPADRARVARHGESAGVGDRTQELTR
LSR
>gnl|bykdb|A0A1C6VZN9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora peucetia] (length=486 residues).
MDLYRQLRLVRRHWWIVLLTVMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSVVAENPVGLTAEEIQRRVSTSTETGTVLLRASVTDTDQNRALKVTELLSTKFVELVQKVETTQDGKAGPIRIEVVSG
PRVTPTPVSPQPVRNFAVGTLLGLLAGVGLAILRGVADVRLRDAAGLRRTTGSPLLGEIPFESTAKSEPLIIGEAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDAGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRSQVAQAARALNSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVAATATPDVPADRAPAARHAERIDDVVSDRTQE
LTRLSR
>gnl|bykdb|A0A1C7C3G8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium citreum] (length=474 residues).
MTPLLKALLSRWYIVVAGILLGCAAAMALSATVTPQYRATTKLWVSVGGDAESSALELAQGSNAAQQRIRSYLDLVSQPI
VLEPVIEELGMSTSADALARAVSATSPTGSVVMEVSVTSPDPQRAAALAEAVARSFTEVVQQRLDANANADGNAGAGTGV
TVTETSPPTVPTTPTEPRTTANAALGALAGGAVGVLAAFLWWSLDTKVRGRDEIQSTWDLAVLGDIGFDQEATKRPLILR
DERASVRAEAFRSLRTNVQFLASRPEGARTVAVTSSRPSEGKTTTIANLAVALAEGGLRTVVIDADLRRPNLANVMGVEG
SVGLSDLLIGRAELEDVLQPWGTAGLQLLPAGTIPPNPSELLGSPAFGALIEAVSEDFDYVLVDTPPLGSVSDAALVSAS
VQNVLLVVASGRVRRADVSASIEALRTVGSTVQGAVVTMTRSRAGKDRYTEYAYSAQPVVRGSAQRMRKRGSTA
>gnl|bykdb|A0A1C7CBL2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium citreum] (length=482 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVQTPI
VLLPVISSLKLDMNADQLAKMVSATAPTSTTLISITVNDTNPVQATEIANAVSSSLTNVVQDIEATDANGTSTVKLTRVK
QADVPLSPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRTETDVEKISAKPVVGGIAFDGKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVGEYMEVDGSAGLTDV
LIGRASLEDVAQPWGRGNLVVLPAGQIPPNPSELLGSKAMQDLITTLEGQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLDEAEPTQPETKAPKKARGKLGTLRRA
DR
>gnl|bykdb|A0A1C7FTC7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium animalis subsp. animalis] (length=490 residues).
MAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSAN
SSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNIAVTDADPSTAARIANGVAA
SFSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKPSSPKWSLNLLAGILGGLIIGILAALLKDVLSKKIQDESDVTDIVDAP
IIGRVVKDDILTGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLIVVTSAGASEGKTTTSVNIAAALAEDGSRV
LLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVANAMQQYDY
IIIDTAPMVVANDAVIFMKQGGTLEMVCCRDHTLKRDLREIASELETLDMPVTGVIINCAKENKKALENSNYYYYSNSSP
AEKNRKNRKS
>gnl|bykdb|A0A1C9WMD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. U41] (length=488 residues).
MTGFETADNSGQTSAGLALEDYLRIARARWKGILAFTLALTVLAFCWTLLQPKIYAAQSSGIVVAGGSDNLSLSLMSENL
AQTKAAKYESVAKSRLVAERVVTSLGLTTSPDALLGSVTVAVPKESAQLAVTATSTNPEMARKVADAWVMGLAEQVKELE
SIPAVEGSDVIPVPVIRVVPLGEATLPTAPTSPNVKLSLAIGALAGLALGLAYALIRHRLDRRLRSATAIERRFGVPVLG
TLPVDHRLDGKSTVLDDGFSPVAAGEGSHAITEALRELRTNLQYVDVDNPPRIIVVTSSVPAEGKSTVTANLAVTMAAAG
ENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLSGHAELEDVLQEWSAMPNLRVLGSGRIPPNPSELLGSQAMKTLLRTLAQ
DAIVLVDAPPLLPVTDAAVLTRIADGAIVVIRSGKTTDEELGKSLGNLGRVNGNVLGTILNRVPTTGADSYRYYTAYQSR
EPESQPVR
>gnl|bykdb|A0A1D7UM15 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum] (length=501 residues).
MNKEERSIAVDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGAS
SNAGELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSV
AENLRKQVTSTIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTT
VIDAPVLGSLSRNEAYVGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSAGPSEGKTTLSVNLATAFAEN
DSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMRALIEQVAE
AYDYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLFRQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDE
SDDNGRKRQIQHKKSEKMKKD
>gnl|bykdb|A0A1E4C6A4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. SCN 69-37] (length=463 residues).
MTLHDYFSALRKRWALLLVLTILGAALGYGYGTLQTDTYRAQSSVVIVPARGDTTSELVQGSNYVQGLVATYTVVATSPV
VLDRVIASLSLDTTSRDLARIVSVSSPLDTTVLEIAVTGADPGQITRIANAVSTELADAVENLSPRTTSSGPAVRVEQIS
PASEPRSPIAPNTRLLAVIGALIGLLAAAVIAILRQVLTTRLVSRADIAEVTDIAVLGQIPVNTTGVPLAVAVRDTASGS
LAEAVRTVAASLRFANVDGEAKVVLVTSPESGDGKSSIALTLAAIAAEQDQRVLLIDADLRRGTVADVTGFEGAVGLTTV
LLGDVTVDDAAEAWGESGLRVLTSGATPPNPGQLLASGHLRQLLAQVREEFDLVVVDSPPVLAVSDALWLAPAVEGIIVV
ARSRRTKREALARTLAELEATRTRIMGIVLNDVKRVASSPYYERAEVPHAGRSTWFLRGRRRG
>gnl|bykdb|A0A1E5MI11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. ER1/6] (length=481 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVQTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLITITVNGTNAVQATEIANATSQSLTNVVQNIEATDANGTSTVKLTRVK
QADVPQTPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRTETDVEKISDKPVVGGIAYDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFKVILIDADLRRPRVSEYMDVDGSAGLTDV
LIGRAGLEDVAHPWGRGNLVVLPAGQIPPNPSELLGSKAMQDLITKLEDQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVSSLENVGAPIAGFVITMMPLKGPGAYGYGRYGYGYGYGLDEEQPSQKTPKSSKARGGVGVVRRAD
R
>gnl|bykdb|A0A1E5MK42 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. ER1/6] (length=465 residues).
MTLVQFAAVLRRRWSSLVVLTLVGIGVGATLTLVMTPMFRAQAQVFVSVDAGPTASDLSQGGSFSESRVASYAELAASPS
VLRAAAAAAHVEGTIEQLSRQVRVASSLETVILTITATDPDPQRAAAFADAIAEKTVELVGEIEKTDSAGESLVKLSVYQ
HAETPSAPSSPRVTTNVVVGAFLGLILAIIAAMVREALDSRIRTVDDLRRATERSVLAEIPVADDVVALRRPEVGTKFSE
LAESYRQLRTHLTFTNLDGACQVIVVTSAVAGEGKSSTALNLAFMLAQNGHRTLLIDGDLRRPTVADALDLEGSVGLSTV
LAHQVELEEAVQVVGRDGLHVLASGQVPPNPSELLSSRQMRFIVDSAAAAFDYVIIDAPPALPVTDPAVLGALATGVLVV
SATDGHTTVRELEQSLETIDAVGARVVGLVANRVRAGRKPASYYDYSSAEPIKESRRRTRRASFG
>gnl|bykdb|A0A1E7XZI4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=494 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIVGVFAALIKDLLNTKVEETSDVRGIVRA
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYYYYEDG
APRSSHRAKGKKRH
>gnl|bykdb|A0A1E8FPE8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. SW1] (length=491 residues).
MEIRDYIRILGHNWILLTCLTLLGVLGAVGASIFTKASYTAETQLFVAIQSSGSATDLQLGNSFSQARVQSYVMTVGTPA
VMQPVIEQLGLTESPKELAAKVKATAEDNTVIITIQVTDGSAAQSAAIAQAVADSLIKAVDNLEKSDVGGTSPVKLSIVT
PPSVPEAPSHPNPKLNILVGLVAGLLLGLGATVLRTALDNKVRDESHLRKITAAPLLGSISFDRDAAKRPLVSQVAPQSP
RAESFRQLRTNMQFASISRKSGAIMVTSSLPSEGKTTTATNIAITFSQAGQRVVLIDADLRRPTVGEYMGLDRNAGLTTA
LLGRAGVDDLLQKWGEDELYVLTSGQIPPNPSELLASDEMLQLVRHLELKFDVVIIDAPPLLPVTDAAVLSQHVDGVVLV
VNSQNTRQAQVERSLASLELVNASVLGVILNMLPFKGVDSYAYSYHNLENESPARPAGSASRDARPATVPGQAAAATEDD
HGRHALPAGRR
>gnl|bykdb|A0A1E9T6I0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC072B03] (length=494 residues).
MTILEFFRTTRANLWLLIIGIIIGAAVGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDSNA
AATPPANSNTVRVIPLNNASVNPPLVSPNYQQNTLIGAVIGLVVVYTAIFLRRALDQRIRTRDDATKATGASILGVLPVS
EDLNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARSLADAGSPVILIDADLRRP
TVAKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPV
TDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDG
DKKSSKSKSSAPKA
>gnl|bykdb|A0A1F1GHA7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC068F09] (length=494 residues).
MTILEFFRTTRANLWLLIIGIIVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDSNA
AATPPANSNTVRVIPLNNASVNPPLVSPNYQQNTLIGAVIGLVVVYTAIFLRRALDQRIRTRDDATKATGASILGVLPVS
EDLNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARSLADAGSPVILIDADLRRP
TVAKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPV
TDASLLSHSVDGVILVGSIGRSHREQMAEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDG
DKKSSKSKSSAPKA
>gnl|bykdb|A0A1F1JVB2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kytococcus sp. HMSC28H12] (length=504 residues).
MTLDDILRLTRRHIITLVLSTLAGIALAAGWVAMQTPVYTATATGVVQASSGTGTVGESLSGNSLAITKSSAYVTYFSSQ
PVAERVIKQLNLDTDPAALSSRVSAKVEEETPNITVSAKGGSPQEAKQLADAVVTETAAYVKDLETKNLTDGPSYPAQQE
PSSDESSSQKDKEQRTPATSILPLASADLPSSPTEPQPARALVLGGLAGLALGYLIAWFRHRQDTRIRTQEDIEEASGGT
STLGLIPANEALSSPERAVRDSGEVDFATREALRQFRTNLRFVNVDHAPKSIVVTSARMGEGKSTISSNLSYLLAEGGER
VILVDADLRRPSVAGIFDIDASVGLTQVLAGTADLADAVQPTAHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHR
VILDAPPLLPVTDAALLTTAADGAVLVVAAGDTRKEHVERAAANLRNVNANLLGAVINRASVSRLNRILYGEGYGYGSYG
YGAGYGDGYGDDKKSRKRRKRRKK
>gnl|bykdb|A0A1F1KDB3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HMSC31B01] (length=447 residues).
MDLQQYLQIFRKYWRSILTVLSVCVGAALVFTFLQTPKYSSTSSALIAVDTAASAGELSSGALYAERQVSSFVALADSAL
VLDPVIDELGLDVTPQALRSRVSVSAPAGTSIVDVTVTDTNAGRAAEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
PASESSRPVSPRPVVNIALGLIAGVVLGLGQALVRRLLDSRIRTRDDLEEITDAPVLASVVHHKGSDRAKDEAAPARGTA
WASDESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSTNLAKVLAETGARVLLVDADLRRPQVGARLGLDDELGL
SDVLTGRADLNDVLLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
VARAGVARQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
>gnl|bykdb|A0A1F1KI99 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HMSC31B01] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENESLTRTGEEAMDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLAEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEKYLSSVGSSARKGRRSRRKARTRS
>gnl|bykdb|A0A1F1U7J4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HMSC30C05] (length=447 residues).
MDLQQYLQIFRKYWRSILTVLSVCVGAALVFTFLQTPKYSSTSSALIAVDTAASAGELSSGALYAERQVSSFVALADSAL
VLDPVIDELGLDVTPQALRSRVSVSAPAGTSIVDVTVTDTNAGRAAEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
PASESSRPVSPRPVVNIALGLIAGVVLGLGQALVRRLLDSRIRTRDDLEEITDAPVLASVVHHKGSDRAKDEAAPARGTA
WASDESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSTNLAKVLAETGARVLLVDADLRRPQVGARLGLDDELGL
SDVLTGRADLNDVLLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
VARAGVARQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
>gnl|bykdb|A0A1F1UP25 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HMSC30C05] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKARTRS
>gnl|bykdb|A0A1F1W0J5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. HMSC06H03] (length=520 residues).
MPEHIDPDEGTPVELQQYLTILKERWSTAAIAAVLVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQ
IITYADLAKTPIVLDPVIEELGLDLTADELADRISTTIPEDTLIIDITASSVDPEVASAIANATSESLRTQVSALEAPTQ
EAAATGTTEEGLEAVPSTVELTEISAAATPSSPASPNIPRDLALGVLLTLLAGLAAAVVRDFLDNRVRRPADIEALYDLP
VIGSIPSVHSSQNVALIAAQKPSSVQAEAYRELRTNLHFMLTADRMNTLLVTSSLSGEGKSSTAINLAQVLAQAGGRVLL
VDADLRRPSLATELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVV
VDTAPLLAVTDAVALSRFVDGSLVVAQSDRVKKQQLGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPGEESSEPAVS
VVPAEDRPAEAWPEEARPSESSEHRSEEALGAEEATGDRP
>gnl|bykdb|A0A1F2UPP7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium GWC2_53_9] (length=465 residues).
MEEQIEIVQFLKIIAKRKGIVIIGTVLCVLLAMIATMYMTPQYNATAKILVAQAQAPVNNQSSSESYQAVLLGQQLAKTF
SEIMVSRTLAERVIARLELPLLPDDLMKKVKAQPIRDTQLIVLKVTDTNPKRAKDIVNAYVEEFIDFIPSTVPTTSQMKV
SAIELAVVPLKPVTPKPLLNTVLALVLGLSMSVGFAFVLEKLDVTVKESDMLEQLLGITSLGLVSKSQQPLLLGDNNTDT
SESMRRIRTNLQYLNFDQSIRSFAVASPETGDGKTTVASNLAIVFAQAGQNVLLVDCDLRRPSISQVFHLPDARGLSNVL
IGAADADSVILSSGVDGLSVITSGPIPPNPADLLNSERMDELLARFEGRFDIVILDCPPVLALSDTVILASKADAVLMVS
SFGKSKKADMLAARNALTKVGARILGFVINGARTSKQNGYYNQPYTSRQALRDAPLNQPRDIRGV
>gnl|bykdb|A0A1G4WVQ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. UNC267MFSha1.1M11] (length=457 residues).
MNIQEYAKLLRTRWVTVAVTILVGLLGAVAVTLLTTPLYKASTRLFVSTISGSSIADTYQGNRFSQERVDSYSELLTGQT
LAQRTIDKLGLDMTAAELQANVKATSKPQTVLITVEVLDSSPVRARDIANTLSDEFVVMVRELETPEDGTSPDSRVVLEQ
RASIPDAPSVPKTTRNIAVGLALGVLAGIGLAHVRDLLDNTVKDSDTLEEITGSGIVGNIPLDKDRRKKPAIAFDNDNSP
IAEAFRKLRTNLQFLAVDNPPRVIVLTSSVPSEGKSTTAINLALALAEADHNVVVVDGDLRRPTLHKYLDLVGAVGLSTV
ISGQASLDDALQKSSMPGLTVLTAGAVPPNPSELLGSLSARTALAELRSRFDYVIVDSTPLLAVTDAAVLAAASDGVLMM
TRFGYTKREQLTHAIANLGNVSAPLLGAVFTMVPARSAAYSYSYYYGEESGKKASGT
>gnl|bykdb|A0A1G5PJ37 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. UNCCL28] (length=509 residues).
MELTDYWKVLRAHWISVIAITVLGGIVAFGWTLTQTKVFSADASGIISVGVNKDLGTAMAGESYSKSRAKSYLDVAKSRS
VAETVIQDLKLQGTSPEQLISRISAQNPQDTATLKFSAQASSPEGARDLAEAWVRGVAKQVAELEKGSNSSETSIVSFRS
LDAAQLPTTPTSPNTRLALMIGVVAGLLLAIGYALLRNIFDRRVRSAVQLEAETGVAVIGTVPFHNNFDGVNRLVMSRGG
NDLENKNHQDYAVAEAIRELRTNLQFMDVDEPPRIIVVTSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAKT
FGLLTNVGLTDVLIGRATLNDVLQPWGESGDLFVLGAGSVPPNPSELLGSNVMRTLLEDIAKHAIVLVDAPPLLPVTDAA
ILTARTDGALVVSRAGKTTYDQLKRALQNLERVKGRPLGLIINGVSRKSSKGEDYGYQYYTYYNRKDTGEEAAKANHVPA
AESTPVAATEQVQLTDQRRGRRRESTNAL
>gnl|bykdb|A0A1G6GCY6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Raineyella antarctica] (length=540 residues).
MQLRDFLAIIRARWITIVLTLLLVLAATVVTTLRIPPTYQASARVFLAASSSPKTSANAGGGYLLTSADLNTYVELLNSP
VVLDPLRKTLGVSPSTPLVVTAVVSQSSPVLDITVQAESPKLAADAANAVGPELAKVGGAYAPLLASAGQGVTATAISSA
TAPSRPISPNLPRNVALGLLAGLGLGIGLALIRHFLDTRVRTEADVRALSDRPILGSLRLLPKSNDSDLVVEGDPHGLAA
EEYRRLRTNLQFADVTTGGKHSFAVSSAMPSEGKTTTAVNLALAMADSGARVLLVDADLRHPSVAGAMGIEGGVGLTTVL
LAHTTIENAAQRWGDTTLYILPSGAIPPNPSELLGSSAMEALFAQLLAAYDYVIVDAPPILPVVDPVLIDRLVGGMLIVV
AADRTLKRDLAQAVRSLNVVEARIAGFALNMVQNSDSASRYGAYYPHGRNSRATRGGRASRIEKRRSRPVEAPHAITPAP
VPTSPTTPSVPAPPSPAPTGQPFLSAAEDVLGWSSATQEDFGTSDTSPVDSRGHGRRFAD
>gnl|bykdb|A0A1G6GEF2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Raineyella antarctica] (length=483 residues).
MELRDYIAVLRKYWRSLTALVLLGVIAAATFNLLSTPIYTAKSALFFSVNGSGTASDLAQGTTFTAKQVESYVEVATSPL
VLQPVITKLGLSETPADLAKRLTVTVPTNTAVIDIAVTDPSPQAAAAAADAVSGQLVETVRNLSPSAVNGQKSVVATVIT
PAATPTSPTTPKIAQNLALGLLLGLFLGAGQAILRDSLDTHVRTDADVASVTDAPIIARIALDRTATDAPLLLSDDRTSP
RAEAFRRLRTNLQFLDPGHGGRSFVITSSVADEGKTSTAINTAESLADAGLRVLLIDADMRKPTVAGALGLEGSVGLSTV
LIGRTHLREVVQQAGFSSLQVLPAGHVPPNPAELLGSAAMEHLITTVTQEYDVVVLDAPPLLPVTDAAILSRITNGALLV
VGSGEVRAPELAAAVESLESVEGRILGVVLNKLQAKDMNTGGYYRRYADDVHRQGSLVAPQRAEEVPVPMEGAGPRRSAN
WGR
>gnl|bykdb|A0A1G6RFZ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Auraticoccus monumenti] (length=491 residues).
MELSDYLAVARKRWPSILACALAGVVLAALASLLTTPLYTARTSVFFAVSGAGTSAELAQGSTYAEKQVQSYAELAESPI
VLQPVIERLQLPLTTLQLVEQIEVTVPPETVILTIQVSDPDPIRAAEVTNVLAEELTNAVQRVTPRSPDGEEPVRATVIA
SAVVPIAPSSPDVRRNTVLGLLLGAVVGVGVAVLRTLLDTRVRDEVDVAKVTDHSVMGVVGLDAEAQAHPLVVHTDPHSP
RAEAYRRLRTNLQFLDLAGRPSSIVITSSIPGEGKSTTSINLATTMAETGQTVLLIDADLRRPQVAKYLQLEGAVGLTTV
LIGRADLIDVVQPLGDGNLHVLPSGQIPPNPSELLGSDRMRRLLVEAAERYDIVLLDSPPLLPVTDSAILSRITGGALLV
VGSTDVHRGQLETSLESLKSVDARILGLVLNKAQRRHADRYSYDYTHKHGYAPLQEGDAVDAASGRHARSLPGDDVVATS
LEHSSHRDAVR
>gnl|bykdb|A0A1G6VTP3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Auraticoccus monumenti] (length=475 residues).
MTFAQFVAVVRKRWFLILIPFLLACGSVGTWSMLTTPLYTATASSYFSMQGGGTANELYQGANYTQQQLGSFAELATKPI
VLDAVIDDLDLDTTSGELARSVSADVMAESVIIDLSATSASPQLAADLANAIALRLGVVVKDLSPVVDGQPTIDVVTVAT
AVPPRFQSSPDTRRNVLAAGLGGLLLGLVLVVARERLDTRVRGESDLPGGQGVLASVEDLRDARQNPILPLQSRTPRAQV
RAEAFRRLRTNLRFIDVDHPPRVIVMTSAVAGEGKSSTAVNLARVLVQDGHRVVLVDGDLRRPSVAAYAGLEGSVGLTDV
LAGSLDLETALRRWQHDRLQVLPSGSLPPNPSELLGSDAMASLMGQLRDTFDFVILDTPPLLPVIDAAVAGVLADGVVMV
VRHGHTTRPQLEHAADSLRSVDARLLGFVFNRTPRPSPWRRKQQDYYEQDGRRSDVPRSDEDFSGELSGEAGSRG
>gnl|bykdb|A0A1G7JQ21 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Blastococcus sp. DSM 44268] (length=486 residues).
MGARGPLTAVRRRWRWVVAASMLGLLAALVWSNGQTPTYRSTATVFFSPEYGDSASELVQGSTYTKNQVTSYARLATTPA
VLLPVINELELTATPAELARSLDARVPLDTAIIELSATDPSPERSAALADAVVASLSRVVEDIAPDDDTGQATVRSLPVA
AAEVPSGPVGPNLPLDLATGLVAGILLGLAAALARDALDNRVRDAGVAAELTTLPVVGSIPTRSRRGAPPIVVEADPHAS
EAESFRMLRTNLQFLAVPSDGAGSREARVIAVTSSLQGEGKSTVAANLAASLAETGDRVLLVDADLRRPAVARLLGIEGA
VGLTDVLIGRASAADVVQDWGSRGLQVLASGRTPPNPAELLGSPAMRALLAELRADYDFVVVDTAPLLPVADAAILSRAV
DGMLVLANVTRVRRSQLAESLQTLEQVKGRVLGLVLNQVSRPDDVYAYRQTGEERSSGPAPDAVPLPVMPAVRSLKPVKA
VGRGGR
>gnl|bykdb|A0A1G7N987 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium cellulans] (length=511 residues).
MTLREYGTAVLRHWIVVAVCAVLGAVAGFGYARSEPKVYQSSASVMVVPEQGENAAELVQGSNYVQNLVASYAVLAQSPY
VLEPVIEDLGLDTTPARLARSVSVNTPLNTVVIEIAVSDTSPDRAREIADGISDQLALAVPELSPQLADRSSAVRITTIA
PARQPVNPIAPNTRLLMMVGLAAGLAVGVTYAVLRELLARRVVSSSSIQSMLGVPFLGEVVKVPSRTSLPAVVAAGPGSR
PSESVRTLVANVRFADVDHGRRVLMVSSGDAGEGKSSIAISLALSLAEDGSSVLLVDADLRRPSIARVTGLEGSVGLTNL
LVGDVAQEDIVLPWTRPNLFVLPSGVLPANPGVLLSSERLVAVIGDLRTHYDYVVIDTAPILPLSDPLWLSRAVDGVLVV
ARARKTRISRLRQTVDKFERGEADVIGIVLNDVKPRGRSAYYVNDSRVGVPGAFTREPGSPDVRAAAATGEAAATGDASS
AGDASSAGGASSAGGAAETRAVEDADRRTRP
>gnl|bykdb|A0A1G8AQG9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 77mftsu3.1] (length=468 residues).
MSLNDYFLALRKQWLAILVLAFLGAAIGYGYAQTQTDVYRAQSSVLVLPARGDSTAELVQGSSYVQSLVNTYALVATSPV
VLEPVIDRLGLSISPRALAGQVTVETPLDSAVLNITVTGGSPSGTARIANAIATELADAVEGLSPQTNTSGPAVRIETIS
PAAESRVPIAPNTRLLIIVGALAGLVAGMVYAWLRRLLATRLQSREDIAGVTETPVLGEVTGVARGSTLPDAVRRAETGL
AAESIRGVAAGLRFANVDGDTSVILVTSATSNEGKSSVALSTALILAEQGQRVLLIDADLRRGSIARMTGLEGGVGVTTI
LVGDIGFGDAIQHWGTSNLSVLASGTIPPNPGQLLTSDHLRELVKDARARFDVVVIDSPPVLAVSDPLWLAPVVDGILVV
ARHRFTKRQALRRTLDELESTRTRILGIVLNAVKRVDSSPYHDNAYATSQPSRWRKSERLGGRTKARA
>gnl|bykdb|A0A1G8B900 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agrococcus jejuensis] (length=574 residues).
MELTDLVRILRRRWIPIVAASVVGVGAAAGVSALQAPSYASTTQVFVSTQTGETSNDLAQSNAYTLSRVLTYAELASSER
VLVDVVADLGLDVDVRDLARQVTATPVPETTIIEITATSRDPQRAADIANATATSLAEVVDDVEGTATQASPVRLTTVEA
ARPPESASSPSWPLNMLLGGLAALVLATGFVVVRDLLDTRIRSPHDVELATHHPVIGTIAFDERASDRPLVVHDAPHDFR
AEAYRSLRTNLLFVEVEGGKRTFVVTSSVAGEGKTTATANLAIALAQSGETVLLIDADLRKPKVAETLAIEGRVGLTTVL
IGEADIDDAVQDWGGTGLFVLPAGRVPPNPSELLGSRAMESLLRRLEGEFDWILVDAPPLLPVTDAAVLGTRTAGAIVVA
ASGKTTRGQLDGALARLGTVDVNVAGILLTMLPTSASHAYAYAYGYGYGPGVPADDEPPAVARAADDAVDERDGVDASAD
VLDPGEPDEPAATEVDELTIDEPEAAEPEPEPEPVASEAEAESEPEPEAEPEPESAASDPDPEPTPARGRTTAPAKARPR
RAPRPKRERPARDR
>gnl|bykdb|A0A1G8DY24 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium pygmaeum] (length=575 residues).
MELRNYLRILRAHWVGIVLFVILGVAVAFVWSLVQPRVYTADASGYVAAIRAEGANDAGSALVAENLAQAKVTSFLDLGT
WRSVAEHAIDELGLTTAPEALVNRVSVTNPVGTVNIKVSASASTPEGARDLAQAWIRGMATEIADLEGGDPANATVQLVP
GDSARLPSSPSSPNTRLALALGGLIGLALGIGYAVLRYTLDRRIRSADAVERETGIAVVGTIPDEKSFTADSRLLPLDGE
GSSAANAKLFAVSEAMRELRTNIQFMDVDNPPRVIVVTSPLPGEGKSTTSANLAITLAASGQKVVLIDGDLRRPMVATIF
HLVDGVGLTDVLANRATVEDVAQRVGRKGNLLVLGAGKLPPNPSEVLGSERMRSLLRDLSADYTVIIDAPPLLPVTDAAV
LTHSADGAVVVCSVGSTTFEALGKALQNLDRAGGRALGVVLNRVPRKGRGAAYRDYRYAGDYYRAEDATADADIEVNVAG
PRRSPAPALVAAPPGPVAGPAGPAPVAAPPASAGVAAAPVNEVITAVPPAPVKASAAAAAKVAPNASTPLPAGAGASVAS
TAGPPSTRRSRRVAS
>gnl|bykdb|A0A1G8J4X1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter subterraneus] (length=465 residues).
MGLLLAAAVSLLRTPAYTSQTTLFAATQNTGTVAELQIGNSFTQARVQSYAETASTPLVLQPVIDSLGLELSASELAGRI
KASADLDTVLLSITAEDASPVQAAAIAQSVANSLIEAINTLETTTEGEDSPVKLTVVTPAVAPSQPSSPKTQLNLVLGLL
SGLIAGGVLAVLRATLDVRVRGESDVRKASAAPILGAISFDNDATKKPLLTQTSAQSPRAESFRQIRTNLQFAHVSHASK
AVLVTSSLPGEGKSTTATNLAIAMAQAGQSVVLVDADLRRPRVDEYLGLERNAGLTTALIGRADVKDLLQPWGEDELYVL
TSGQIPPNPSELLGSEAMKQLITQLEQTFDAIIIDAPPLLPVTDAAVLAQQVGGVVLVIGSSKVKIPDLQKSLSSLELVE
ADLLGVVLNLLPTKGPDAYAYNSYSYDAAPLRTAGGASHMRSVRPRSEQHEFDEQVLRPRADQRR
>gnl|bykdb|A0A1G9G6G1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. YR527] (length=473 residues).
MDLRDYVAALRKRWYIVAVLAIIGAGAAFAQAHASPPQYRAQSTVFVSIARGATTQELVQGSTFTQDIVQSYAKLATMPV
VLDQVIYDLDLDTTSKALAEEITAENPLDTVIIEIDAVATTSTGASDLSNAVADELTTTITNLSPSSNKKSAVEVTVVAR
ADPPQEAFAPRTRLAALVGFAGGFGLGVAIAVVRALLDTRVRTAAELEQLTDMGLLGAIPRRRGQRRSRGAVTAIDPHNV
AAEAYRRLQTNLQFLDASSRVRSMVVTSSIGGEGKSTTSINLALAIAEQGQRVLLVDADMRRPAVADYCGLEGAAGLTTV
LIGKAELGDVVQVWGDANLHVLTMGEIPPNPAQLIGSPRMVDLLAEARAAYDVVILDSPPLLPVADGAILSRLTDGALVV
ANCRTIHRPQVLEAIDSLEAVDARCLGIVANQVRDTAAHTYYGQPEQGWFARLLSGLVRPREPRQHGYPAAGS
>gnl|bykdb|A0A1G9HLU0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. ov407] (length=481 residues).
MDFSEYLGALKRCWVLLFVLTLLGGAAGFGYARSTPPMYKASSSIFVSTQRGATPSELVQGSTYTQNLIQSYAELARLPS
VLEPVILRLRLTTTPELLADSVAASAPLNTVLIEITVTDSSPEQAALIANAVTDSLASTVQGISPKTAAGTPAVAMQQVA
EAQAPKFPFAPNTKLLTLTGAVIGLVLAAIYALGGELLDTRIKSLKDLRRVTDLPLLGTIPTRPRRSSPDAIIMRIAPHG
RSAEAYRRVAANLEYINPDATVHSVVVTSAVEGEGKSLTAVNLALALSEKFDRVLLVDADLRQPRIAHYCQIEGAAGLSK
VLAGTAELRDVIVTWSGIDILPSGTVPPNPNQLISSEAMAALIRTCTAEYDIVVIDSAPLLPVTDTLPLSRITDGAVLVT
RAYATRRGLLGSALDAIEGVNGHVLGMVLNGVKAPRNDHSYGYVPGGRRAVAREGQMAPASSAGMHLPEGHSDPAGVATG
S
>gnl|bykdb|A0A1G9N5Q8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus oleiagri] (length=456 residues).
MELQQYLQIVRRYWRSTLATVLACIVLAALFTLLQKPTYTSTSSVFLTVESGGTAGELSQGATYAERQVTSYVSVATTAL
VLDPVIQELELDSTPARLAGKLSVSAPASTSIIKIAAEDDSATGAAELSNAVANSLLNAVDELAPPGPEGNRLVSATVID
SALIPASPSAPRPALNLALGGLLGVVLGLGQAILRSVLDTRVRTTDDVAEITEAPVLASINTIDTSADRAAPVDGVAWAN
AEAYRRLRTNVGFVGLGGERRSSMVVTSSVAGEGKTQTATNLARVLAEAGESVLLVDADLRRPQVANRMRLDSQLGLSDV
LTGRGRLQELVINVIPGRLAVLPAGTVPPNPSELLGSEAMAHLLTSVERQYDYVVFDAPPLLPVTDSVVLAAQAGGAVVV
VRSGVVKTTQLEGAVELLRAGEVTIFGIVLNDVPLSRADAYAGYYSSVHDEGVAWK
>gnl|bykdb|A0A1H0AW68 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium flavum] (length=478 residues).
MELRDYIRILRKSWLLIVALTLVAVAAASVFSITTTPKFSAISKVFVSTQSSGTTSDLVQGNSFTVARVKTYSGLATTPL
VLLPVIEGLNLDLIPAALADAISVSAPLDTSIIDITVTDADPVRAADIANAVSQSLTENVQQIEKPDDPGAAAPVKLTRV
QVASVPNAPVSPNVPLNLALGALVGLALGVGLAVLRETLDIRIRSQRDVEQVTDMPVIGGIVFDPKATERPLIVHADPRS
PRAESFRTLRTNLQYLDLGRADRSFVITSSIGSEGKSTSSANLAIALADAGARVLLVDADLRRPKIAEYMDIEGGVGLTD
VLIGRAELSDVIQPWGLGQLFVLPAGRIPPNPSELLGSAGMATLIDEFNSTFDVVIFDSPPLLPVTDAAILAKSVGAAIL
IVAAGRTQKNQLKGAIAALHSVGAPISGLVLTMLQITGPDAYGYGHYGPYGYGHSYGEVGAEPDMVPPSYARRSRAKA
>gnl|bykdb|A0A1H0AWP0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium flavum] (length=477 residues).
MELRDYIRMLRKSWVLIVLCTLVAVGAASALSILQTPQYSATSKVFVSIQSSGSTADLAQGNNFSVARVKTYSALVTTPI
VLLPVVAALDLGVTAEELATKVTASSQLETSIIEVTVTDTDPVRAADTANAVLASLTLVVEEIETPDTTDATSPVKLARA
QEATVATAPVSPNVPLNIALGALVGLALGVGFAVLRETLETRIRNTRDVEQLTDLPILGGIVFDPKAKDRPLIVHVDPRS
PRAESFRTLRTNLQYLDVGRTDRSFVITSSIESEGKSTTGANLAIALADAGSRVLLVDADLRRPKVADYMDVEGAVGLTD
VLIGRADLADVIQPWGKAQLFVLPAGHVPPNPSELLGSTRMTQLITEFNRAFDVVIFDSPPLLPVTDAAILAKNVGGALI
VVAAGRTHKNQLKGAIAALDNVGAPVSGLVLTMLPTKGPDAYGYGHYGYGYGYGDTTVPAVVPTPTAERTRGSRVKP
>gnl|bykdb|A0A1H0BHY1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus sp. DSM 45219] (length=481 residues).
MNTRGPLQVLRRRWIAILGVTVVGLLGGLVYAWTAPVTYQSTAGSFFSLVSGDSASDLVQGSTYAQNQVESFAQLAVTPE
VLQPVVDELGLPESPAELARRVEVTVPTSTVIVEVTVIDGSAERSATLANAVISSLADVVERIAPQDAAGNPTVVATTVS
PAEVPSGAASPDLPLALAAGLVAGLLAGVGLGWSREALDTHVRDAEVVAELTDLPVLGNVPGWPADTGRVVVAAAPYSQA
AESFRQLRTNLAFLRVVGDTARDGGGAHVVAVTSSLSGEGKSTVSANLATTLAETGARVLLVDADLRRPTVADVLGIEGA
VGLTTVLAGHADVDDVVQEWGGAGLSVLPSGPVPPNPAELLSSPAMRSLLADLRTRYDHVVVDTTPVLPVADASVLSRVV
DGVVVVADVRRVRRRQLSQGLGDLAQVSAPVLGVVLNRVRRDEESYTYGRSESVADPAVPDVPAPRGRSGDTRTAGAPPV
G
>gnl|bykdb|A0A1H0IIE3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nakamurella panacisegetis] (length=526 residues).
MELRTYVAALRKLWWAIVLVTVVGAGTGAYLAYRQTPMYATTVTFFATTQTTSASSSSAFAGDQFAQQRVNTYVYLLSSD
RLARLVIAASKVDLSVEKVESSISGASQLNTVLLTATVTDSVPSRSEAVADALATQFPALVNTIESANGTRTALVHLDVV
DGPHLNPKPVSPRTKLYIALGTLIGLAIGVIVALLRELLDTTVRSVHGLSTLTDVPVLGVINSDSATKRSPLIVQAGSQS
VRAEMFRQLRTSLQFVDVDQPASVIVVTSSVEKEGKSTTAANLAIAFADAGRRALLIDADLRRPKIADYLGLEGAVGLTN
VLANQVDVDVVLQTWGASGLTVLVSGSIPPNPSELLGSQHMVDLTADLRTKFDVIIIDTPPLLPVTDAAVAATFADGAVI
VVKHGKTKRSMVSRSVHSLRAVDARILGTVLNFAPTKGADAQRGYGPYGYASAATIDEAGAEPRTRRRSASRTKSSDRTG
ESDAPKQAWAGPRTEAGEADSSSDAAPDNSGPDGPVTGTEERAARA
>gnl|bykdb|A0A1H0IXS2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium flavum] (length=488 residues).
MEPIDYLRTITRRWLLIVIVGILGGAAGWGYAATLPAQYQATNSVFVTSDRGETTSELLQTSTFTQNLVQSYAQLATTPT
VLDPVISRLGLNVSSQALAARVSAVTPLNTVFINITVTSRSAQQSVDLADAVSQSLANTVESLAPKGPDNLPSITVKTVS
PAQLPGGPFAPNTQLIVLTGLLLGFGLGVLYALAREVFDTRVSTEKDLDRVSSDPLLGMVGYKRRSDPAGLVMRVMPHSA
LAESYRRVRANLEFIDVDRPPRSAVVTSAVSRDGKSTTAINLALAMAERSSRVLLIDADLRRPSIAELCDLEGDVGLTTI
LLGDVGPEDAIVRWSDGLDVLPSGAVPPNPGQVLGSDAMKTLMKTLLQDYDFIVIDSPPLLPATDALGLSHLTDGAIVVA
RYKSTTRQQLATTLESLEAVNARILGIVLNQVRERRAEVYYGPLAAVTGPSVPPSVPANRVTATRAPRTSFDEAGRRNSR
SSESTRSS
>gnl|bykdb|A0A1H0R6Z9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. ok909] (length=488 residues).
MTGFDTAENNGQTTAGLALEDYLRIARARWKGILAFTLIFTVLAFCWTLLQPKIYAAQSSGIVVAGGSDNLSLSLMSENL
AQTKAAKYESVAKSRLVAERVVTSLGLTTSPDALLGAVTVSVPKESAQLAVTATSTDPAMAQRVADAWVKGLADQVKEME
SIPAVEGSNVVPVPVIRVVPLGEAVLPTAPTSPNVKLALGIGALAGLALGVLYALIRHRLDRRLRSATAIERRFGVPVLG
TLPVDHRLDGKSTVLDDGFSPVASAEGSHAITEALRELRTNLQYVDVDNPPRIIVVTSSVPAEGKSTVTANLAVTMAAAG
ENVVVVDGDLRRPTLVDVFNLIPGVGVTDVLSGHAELEDVLQEWSAMPNLRVLGSGRIPPNPSELLGSHAMKTLLKTLAR
DAIVLVDAPPLLPVTDAAVLTRIADGAIVVIRSGKTTDEELGKSLGNLGRVNGNVLGTILNRVPTTGAGSYRYYTAYQSN
APEPAAAR
>gnl|bykdb|A0A1H1CWF7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Quadrisphaera sp. DSM 44207] (length=465 residues).
MELGDYMRILRKRWLSVLVITVLGVAAAAAATLLATPQYRATTQLFVSAQTGDSGSDLLQGGNFAEARVQSYADIATSQS
VLGPVIADLGLETTPAALAQRVEAVAPAGTVLIDITATDPSPEQAATIAEAVTASLIEVVRTLEQPSDAATAAPVRITST
QGAVVPSSPAWPREELNLALGLVLGLGAAVAVVLLREVLDTRVRGEEDVSALSVPLLAAVPQDASARRHPLVVVDDPQGP
LAESFRRLRTNLQFATATNGAKSVVVTSSLEGEGKSTTAVNLALSLADAGARVVLVDGDLRRPSVARYLGLEGGVGLTTV
LVGRAQLDDVLQPWGDRTRLSVLPAGQVPPNPSELLASEQMAKLVRELEGRFDVVLVDGAPLVPVTDSAVLAEVVGGVLV
AVRSGSTRRPLLERALAALAAVDATVLGVVLTMLPTRGADGYRTYSYTSQPQPGGRDLPQEGSAW
>gnl|bykdb|A0A1H1F0B0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cf332] (length=456 residues).
MELHDYIRILRRNIVLIIATTLIGLAAGAASALVTPPRYDASTQLFVATQSSGGASNNELRQGTDFARQAVQSYVNIIPT
GLVLDPVIADLGLDESAAQLAERVSVSATQNTVVISITVSDPGPEGAARIANAVADSFTTVVAEQLERSTAERPSPVRIE
TVQPAQVPVDPAAPNLRLALALGALVGLAAGVAVAILRAVADTRIRTVEDVEKIVPAPLLGGIALDPESKKRPLIVAASA
RDPRAEAFRALRTNVQFLTTSGGPLAFVVTSANPSEGKSTTAANLALAFAETGAKVVLIDADLRRPRTAEYFGIEGGVGL
SDVLVGRASLLDVLQRWGQGTLFILPSGAVPPNPAELLGSTAMSRLLDELRTAFDVVIIDAPPVLAVTDAAVVGRAVDGV
ILVAAAGSTTRARLTSAVKNIETAGSHIAGSVVTMLPTAGADKTTYGVYAYVATGD
>gnl|bykdb|A0A1H1F4A6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cf332] (length=511 residues).
MELRDYLRILRAHWIALSLCVVLGVVVAFAWTLVQPKVYTADASGYVTPVKAEGQTDSSSEYVSDNLAKSKVKSYVDVGT
WRAVGEHAREELGLDVSPESLVRRVTVSNPLDTVVIKVDATGPTPEAARDLAGAWIRGMQIEIENIESGGTGVNPGITLV
TADSARLPTTPSSPNVRLALAIGGLVGLVVGIGYALLRFTLDRRIRSAEGVERETGLNVVGAIPEEKSFTADNRLIPFDG
ANTSSSRNVHLYAVSEAVRELRTNIQYMDVDNPPKILVVTSPLPGEGKSTTAANLAITLAASGQRVVLIDGDLRRPMVAT
IFHLIGDAGLTDILAGRATFDDVAQPVGRTGTLRVVAAGKIPPNPSEILGSQRMRDLVHALSEDAVVIVDAPPLIPVTDA
AVLTNRTDGAIIVTTVGRTTFDALKKAQQNLERAGGRALGVVLNRVPRKGSGAAYYGYQYTGQYYRADDDARDIAPEPAV
APAPVAPPAPVTVPVLAAALPDGRRARRARR
>gnl|bykdb|A0A1H1SPW6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microlunatus soli] (length=513 residues).
MTVIDFLRSVRRRWLYVLLGIVVGGGAGAAAIVLTTPQFEASATVYFSVPAASSANDLAQGGNYAQQQLTSYAQLATEPI
VLDPVIEHLDLDQTADQLAGAVTAVASNNTVLITISATDPSADRAAAIANAVSDELGSTVSRLSPKSESGRATVDYAIAG
RAAAPLYPSSPRKKVDLGAGLLGGLIIGVLAAVTRDRLDTRIWGESDIKELPSLARIPFDKGADKSGHSPLIADWDEGSA
RAEAFRQLRTAIQFADVDNPMKIVAVTSSMSGEGKSGVSANLAMAFAEAGHRVLLMDADLRRPSIADYFGLEGSRGLTNA
LVGQVDIDDVIQGWGDRHRLSVLPAGAVPPNPSEILGSQRMAAMLDDFRSGYDVIVIDTPPLLPVTDAAIIAAKADGALV
IARYGKTKRQEFAGSTDALRAVDARIVGAVINRVPTKKRGAAYDYYGAVSETAPAAAPVPADGRVASEPPNNPARAEHPV
DDEPAPSPARAVDPQRSMRTSAATPREQPIRSS
>gnl|bykdb|A0A1H1UMF0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium paraoxydans] (length=450 residues).
MAESRVSLRVIAGSLRKFWWLIVLCGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRVTGITDDPESAAELANAVAEQLITVVKDVAPKDPQGESTIT
AEVIDDAVVPEFQFTPSKPRDAALGGFLGGVLGLAAAVLIGVLDTRVRNEEALTQAGGDPVLGVVSKSPLLEARGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTVSVNLAMTLAALRNSVLLIDADMRRPRAHEHAGIDGSV
GLTSVLLDEVEFEVAKHRVADTTLDILPAGTIPPNPAELLTSARMAQLLDFAAADYDYVVIDSPPTLSVADANLLATQTD
GVILVVDATKTRRAALEKSIKSLESGGARILGTVLNRARPDRHRSEYYSE
>gnl|bykdb|A0A1H1WZJ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola scoriae] (length=472 residues).
MELRDYLRIARRRWLLILGTLLATTAIAAVITVNTTKQYSSTSRVFISTSPSNSSDAYQGGLFSQQRVASYADLITGLEL
SQRVIDDLDLDLSAAALAGKITASVVPDTIILKIDVTDPSPVQAQRISDGVVSQLQDFVAELETPPGRDNPLLKATIVDP
PRLPTAPVSPQPTRNLGLGLVLGLLLGLGLAVLREVLDTSVKRIEDVPGLKDTPLLSVLAFDNDVARDPLISSLPSHAPR
AEAFRVLRTNLSFVDVDNRSKSFVITSSVPSEGKSTTAVNIAIALSSAGQNVLLVDGDLRRPQIARVLGLEPSVGLTTVL
VGMEDLKNAVQQHVQSGLDVLTAGRIPPNPAELLQSHAMQELLGEARDRWDTVIIDAPPLLPVTDAALMAAQTDGAVLIV
RHGSTTKDQVAGAVERLRSVGSHPLGVVLNMVRSNRGGSYGYGYGYGYGYGPQTEEPARRGWLRRRKGVTVS
>gnl|bykdb|A0A1H1Z766 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces flavus] (length=471 residues).
MELRDYLRGLRRHWLAITLMTLLGVGTAYGWSLLQTPVYEATASGVVQAKTEYEIGQLISDDGAARAKVPTLLDMAGWKE
VAEEAIDDLGLTASPEAVAARVTVENPENTSIIKFTARANTPEEAAALAQAWIDALAVTVTAVDGDDNPTQISIYSAAAA
TVPSAPVFPDTRTALIVGGVLGLGAGIAFALIRTASDRRIRATDDVEAKLHVPVMGTIPSSPVLAGVSSLLTGTPNERSF
PVAEALRTLRTNLRFMDVDNPPRKIVVTSPLPGDGKSTIACNLALTLARSGEPVVLVDGDLRRPMVASNLELPGGAGLSD
VLTGRASVADVLQRTPHDAHLLVLAAGTIPPNPSEVLGSARMRQLLEDLAKHATVIIDAPPLLAVTDGAVLTQQADGALL
VVGVGKTNYDFVEKALDAVHKVNGRALGLVLNKVPLKGGDASPYAAAAYVQDYASGSSRKRATGRAAAETA
>gnl|bykdb|A0A1H3PEL7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora pattaloongensis] (length=489 residues).
MEFRNRLLAVRQRWWLVLMTVVLALGIAGFATIRADPKYATTVTFFVTTPNQGVSDAYQGGLFLQQRVKSYVDLLRSDRL
ARAVVDSRDFGLTTQEARSRITARVQPDTVLVEATVVDSDQARSVDLAREISTRFVELVQRIETPTGTDRAPVRVEVVDG
PRLDPEPVSPRPVRDLPLAGLLGLLAGIVLAALRGITDTTVRDEAGLREAAQTPLLGRVPFENAARTEPLIVDDAAHSPR
AEAVRKLRTNLRFVNLGEAVQVIAVTSAMQSEGKSTMACNLSIALAEAGWRVLLVDADLRRPHVAEYMGMEAGVGLTDVL
IGEVAVEDVLQPWGDVPLSVLPSGALPPNPSELLGSAAMAELLTTLKGHADIVVVDTAPLTSVTDGAVIAAQCDGALLVT
RRGKTTASQVAAATTALRAAGARILGAVLNMSALPKADAYQYAAYRVAPATPVRPRVPGTSGKAMAPAQKTGGDDAKRTR
ARKLSKASR
>gnl|bykdb|A0A1H3U5E8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Herbiconiux ginsengi] (length=580 residues).
MELRSYLPILRAHWLAIILLTLLGGAVAFGWTLIQPKVYTADSSGIVSIGSSSDSGNALVGDNLAKSKVKSYLDIGESRA
VAQHAIDELGLSASPESLVGKISISNPTDTAVLKVTANGATPEAARDLAEAWINGIQAQITSIESTGADPATASPSIVQL
IPLDSAVLPSAPSSPNVRLAIVIGLIIGLIAGIAYAAVRHIFDRRIRSPKVVEAETGHSVVGTIPIDRRFTDKDRLVSMD
GSTDYAAAANDDRAVAEAMREVRTNIQFMNVDNPPRVIVVTSPLPGDGKSTTVANLAIAISASGQQVVLIDADLRRPTVA
KTFNLVGGAGLTDVLAGRSNVGDVLQPWGTSGNLLILGAGQIPPNPSELLGSVRMHELVASLAEHAIVLIDAPPLLPVTD
AAILTHNTDGALIVASVGKTTIDALTKALSNVERANGTVLGVILNRVPRKGAGSSYYGYRYGGDYNSTSAVPESEAATAS
SVSTDAQPKPAKVSKAERKSKPVELAAPPAAGGVYEDVMARAAANPQPGWDAAGIDSVDAGITDDDLQRIFNGPDDESGS
AAAERGIPTRRELRAGRSRK
>gnl|bykdb|A0A1H3U6P2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Herbiconiux ginsengi] (length=473 residues).
MEFRDYVRAIRKGWVIIVVFTLLGIALAALLSIIRTPEYQSTAKVFVSVQSTGSISDLTQGGNFLQNQVKSYADVVNTPI
VLQPVIDSLGLDTTVEELSRSVSSASPSDTVIVEITVSDESPDNSAKIANAVAASFEAAVTDLVPTNAEGVTPVKITVLQ
NASVPAAPFSPNVPLYIVIGALLGLILGLALAITRYVLDTRIRNEHDVEAITDAPIVGGIAFDARTPENPLVLRDDPRSP
RAESFRTLRTNLQFVGVGENARSFVLTSSVPGEGKSTTSANLAIAMALSGQQVVIVDADMRKPRIAEYLGVEGSVGLTDV
LVGRAQPSDVITRWGDTNLYVLPAGRVPPNPSELLGSTAMVNLIRSLEKSFDVVLFDAPPLLPVTDAAILATKAGGALLM
VAAGRAHKNQVRGAVSALTNVGAKVAGVVMTMLPTKGPDSYGYGRYGYSYGYGYGIDEPSQEATLRERKKRDR
>gnl|bykdb|A0A1H4BJZ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomyces nasicola] (length=472 residues).
MTVVDFFRMLKANIVILLLGVLLGAAAGYGYSMLQPKVYTSKSTGFVVVNDSAGGSVLSGSSLAQERANAYLPLINSRAV
QEQISQMNDGNAPAGSLSAEVATGSNLIVVSASSSDPEAAAKLANTALLATAEVANRIEGSQSAVRVEALEDAVVPTAPS
SPNIPLNVAYGAAIGLALALAVAFLRRLFDVNIRTTTDARVAAGAGILGALPSDETFSLTGEGVDHLAPRASEAVRQLRT
NLKFVSVDNPPKTISITSADPGEGKSTVISALATALAASGDRVILVDADLRRPRQASLFNIEGRVGLSEVLAGQVELDDA
IQEVGPYGLLILPAGRTPPNPSELLGSERMRLLLEELSRHCTVLIDAPPVLPVTDSTLLSTSVDGTVLVVRHGKTRRDHV
EVARDMLANVNATVLGVVLNRVPAKGVGSSYYGGGYGASDQSYAPYQSAPRGSRGSNKRSGRRARKTVRHRN
>gnl|bykdb|A0A1H4BPM4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. 21MFCrub1.1] (length=504 residues).
MSSKQYAQAFRRFWYVVVIATIAGALLGFGLSQLAVKSYTATSGLYFSLNFGGSANDLSQGSTYTQNQMLSFAQLAESPV
VLTPVIDQLDLAITPSQLADSISVSTPQNTVILELAVTDTSPRQAADIANAVASSLSSTVEQIAPKTAQGAATVSVRVIE
HAAVPKFASSPNTRLNVLSGLLLGLIAGALIVVLRATFDTGVHNAETATEVAKAPLVGSIQRERNKDGVPVLVSAPLSNA
AEAYRQLRSNLEFVTLGSPTRSFVITSSIPSEGKSLISSNLALALSETGQRVLLIDADLRRPAIAGYTALSGNAGLTSVL
AGRADFEDVVQRWGAGDLDVLAAGPIPPNPSELLSSRAMSDLLERLRARYDVIVIDTAPLGSVADASILARQVDGALVVV
DRTRVRKQQLAQTVDSLQKSGAAVLGIVLNRVASGKERNAYYMAEQPARRLGLPGRRGAGAAAEAGTDTDAEAGSTKRPS
KGGAAQNAADAESASDAARSHSAS
>gnl|bykdb|A0A1H4ND50 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium humi] (length=480 residues).
MELRDYIRILHKNWMLIVACVLVGVAVAAAYSMMTSSKYQTTTQLYVSVQGGDAAGTTVDLVQGTSFARQAVTSYVDVVD
TAIVLDRVIEELGLNTSASQLASHVSADTPINTVLINVTVTDTDPKTAAKIANKIGEVFADVVVNKLEKPAGDAPSLVRI
ATIQPAAVPAAPVSPNVRMNIVLGLLIGLVGGVGIAVLRSILDTRIHSQHDIEQVTDKPLLGGIALDPDAKKRPLVVHAD
PRNPRAESFRSLRTNLQFVNVEGGPRSFVVTSSIPGEGKSTTTANLAISLAETGAKVVLIDGDLRLPKISEYMGIEGAVG
LTDVLIGRAEIGDVLQKWGRRKLYVLPSGQVPPNPSELLGSAAMARLLKTLTETFDYVLIDAPPLLLVTDAAVVSKLTGG
AIMVAASGRTKRQELANAVRTLEGIGSKLVGVIVTMLPTRGPDSYAYGQYSYGTTTDPERLLDEEERQSPSRRRLGRAAT
>gnl|bykdb|A0A1H4T2N1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter woluwensis] (length=509 residues).
MELTDYWKILRAHWVSVLGITVLGVLVAFGWSLLQPKVYSADASGIISVGVNKDLGTAMIGENYSKSRAKAYLDVAKSRS
VAENVISDLKLQNTTPEQLISRVSAQNPLDTATLKFTAQASTPEDARDLAEAWVRAVGKQVDALEKGPANTAEKSIVSFR
SLDAAQLPTSPSSPNTRLALVIGLVAGLVVAVLYALLRNLFDRRVRSAVQVEAETGLSVIGTVPFNKDFDSTHRIVASHG
GNDLENTSQQDHAVAEAIRELRTNLQFMDVDNPPRIIVVSSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAK
TFGLLTTIGLTDVLIGRANLNEVLQPWGESGNLYVLGAGSVPPNPSELLGSNVMQKMLQDIAKHAIVLIDAPPLLPVTDA
AILTAQTDGALVVTRSGKSTYDELKRALQNLERVKGRPLGIIINGVPRKSAAGSGYGYQYYTYYNRKDAGDKSPRASHVP
VTESTPVSETDPVELEPQRHMRRRDRSRA
>gnl|bykdb|A0A1H6FXV2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Thermoleophilum album] (length=539 residues).
MPSEQQPHAPHDARTLGVLSRALRAHAFLIAVITLLVLAAALGWRLLRPPTYEAHAQLLVTPVSADDPTFLGFDVVRDTP
GDPTRTMQTAAALVESPAVAQAVARQLGDGWTSDRVLEAVQVEPIGQSNLLDVGARAGDPRTAQRLADSFARAALDVRSA
ALRQQARIELARLLSQQRSTGVQTLEPSTDLANRIDRLRTVVARGDPTLSISRAAELPRAPLGPPVIFVALAGLVGGLGL
GVASALLLDQLRQKVRDEEEAQQILELPVLTRVPRLAAAPEPRAGGSPSFPSEVWESFRTVVAQLHFNGARAAARGAGGA
GNEPELGRGILLTSASSGDGKTTSATALAMSLAATGHPTILLDLDLRKPDVASRLGVPALQQLAVDDLLELDPEELIARR
LVSVPGSPQLRALVIRRDIADGAPIDLVSSRYRDLLDAARRSATYVVVDSPPLGHVADALAIVRSVDLVLLAVRPGWTDR
RELRLARDLLARARARLGGYIVCGVRTGRRGYYGYGQAAGAQQAAATGEQRKALAQQQR
>gnl|bykdb|A0A1H6IEM3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium rutilum] (length=476 residues).
MGPRKVAGSEGQALNIQDLIKLLRNRWMLICATTAIAVLIAVAISLLTTPLYQATTRLFVSTTTGASATEIYQGNLFSQQ
RVVSYTELLMGETVAQRTIEKLDLDMTAEELRGNVRASAKPDTVLIDVQVLDESPVRARDAADALSDEFVSLVRELETPE
AGAKPDARVVVEQRASIPADPVYPKTSRNVTVGLVLGLLLGVGVAIIRDLLDNTVKDEETLEQITTVGVVANIPLDKSRR
KEPGISFDNDHSSIAEAFREFRTNLQFLDVDNPPRVLVVTSSLPSEGKSTTALNIALALAEAEHSVVLIDGDMRRPKLDA
YLNLVGSVGFSTVLTGRATLKDVLQKTRFPGLSVLTSGAIPPNPSELLGSMSAKKVLAELRANFDFVIVDSSPLLAVTDA
AILAANSDGVLVIARYGETKRDQLSHAVGNLKAVGARLLGAVLTMTPVRAASSYSYSYYGPTGDERKRSSGGEKKQ
>gnl|bykdb|A0A1H6YQS5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Xiangella phaseoli] (length=493 residues).
MDLYRQLRVVRRHWWIVLVTLIVALGVTALVTVRAQPRYVASVTFFVTMPSQGVTDAYQGSLFLQQRVMSYAELLTSDRL
AQAAAADRQLGLTSEEIQGRVSTSTETGTVLLRASVTDTDQTRALRVTEALSAKFVELVQKVETRPDGSPGPIKIEVVSG
PRVTPTPVSPKPLRNAAIGTLLGLLLGVGLAILRDMADVRLRNAAGLQRVTGSPLLGEIPLDTTARSAPLIVGAAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGIDSGVGLTDVL
VGDVLVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSELLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLIS
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMAKVPKADAYQYEAYRVATGTISSSMPADRAAGGRHAKRAAAREASEVSE
VSDHTQELTRLPR
>gnl|bykdb|A0A1H6YS68 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Lysinimicrobium mangrovi] (length=511 residues).
MELNDYLHVFRTRWIAIVVITVLTGILAGAWTLTQDKVFTATGSAIITTGASQDLGSALVGDNYAKSRVKSYLDVAKSRK
VAEFAAEQLGISVRPDALVARVTVTNPTDTAVLRVAANGPTPEAARDLAEAWIAGMTQTVADLENEGSAASVDMSVVKLQ
TLDSAVLPTSPTSPNVRFAVSLGLLMGLALGIGYALVKAALDRRLRKPGDVEREFDVPVVGALPFDEAIGASGSPTATTD
FAMKEAVRQLRTNLQFMDVDNPPRVIVVTSALPGDGKSTAVIKLAEAIAESGQDVVLVDADLRRPVIAKKLRLVEGAGLT
DVLVGRAKAADVLQAYGPTDHFYVLASGAVPPNPSELLGSDAMKTVLYGFPKKAIVLVDTPPLIPVTDAAVLTARTDGAL
IVARSGKTTIDLLDRALQNLDKVKGRALGVILNSVPRKGAHRDQYAYAYEYERKATEGDAEPATVPTAQAKPAPHTPKHA
TRRQAAAEPPAGILDWDTAAKGESRRAAGES
>gnl|bykdb|A0A1H7FB36 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nonomuraea pusilla] (length=463 residues).
MDLLYYAQFIRRNWSVLLISLVIGAGAAALVTANTPPKYVATISMLVSGQDKEGSISAAYQAGMLSQQRVQSYATLLSSR
RVVSQITRPEYVGLVQSRISAEVVPGTVLLRASVTDYDPAQAAALANALGTKFSQLIDQLERPTPQSRPTVKVSVVDQAE
VPRLPVSPRPELNLLVGVLLAFILTTGALLIRDHLDTTVKNTEVLQATAGSSTLGVIGYERAARRQPLILRAGGRSSRAE
AFRALRTNLQFIGVDRQPRSLVVTSCLAGEGKSSTSCNLAITLAQSGWRVLLVDGDLRRPSVPDYLGIEGAVGLTDVLIG
REKLDDVVQSWGNPRLHVLPSGQVPPNPSELLGSQTMRQVLDRLTAEYDMVIIDAPPLLPVTDAATLAAVCDGTLLVARY
GKTRQEHVQRAAQQLDSINARIVGTVLNFVPAKADRYHGYGYGYGYEPETPKAGERVTTAART
>gnl|bykdb|A0A1H8A5X8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium luteum] (length=478 residues).
MELRDYIRILQKSWMLIVALTLVAVAAASVFSILQTPTFSATSKVFVSTQSSGTTSDLVQGASFTVARVKSYSGIAVTPL
VLLPVIESLKLDVSAAELADSVAVSAPLDTSIIDIAVTDADPRRAADIANAISQSLARNVQQIEQPDAVTGAPAVKLTRV
QVASVPSSPVAPNVPLNIALGALVGLALGVGLAVLRETLDTRIRSQRDVEQVTDLPIIGGIVFDPKATERPLIVHADPRS
PRAESFRTLRTNLQYLDVERADRSFVVTSSIGGEGKSTTSANLAISLADAGARVLLVDADLRRPRIAEYMNIEGAVGLTD
VLVGRAELEDVIQPWGRGQLFVLPAGHIPPNPSELLGSSRMAQIIEDFNRTFDVVIFDCPPLLPVTDAAILAKSVGGAIL
IVAAGRTQKNQLTGAIAALDKVGAPISGVVMTMLPTKGPDAYGYGNYGQYGYGQTYGDVGPAPEIVAPNYSRRLRSKA
>gnl|bykdb|A0A1H8A6U6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium luteum] (length=481 residues).
MELRDYIRILRKSWVLIVLCTLVAVGAASAYSILQTPQYSATSKVFVSTQSSGSTADLAQGNNFSVARVKTYSALVTTPI
VLLPVIASQGLAVPADALAEKVVASAQLDTSIIEITVTDTDPVRAADTANAVSASLTLVVEDIETPDTADAASPVKLTRA
QEASVATVPVSPNVPLNIALGALVGLALGVGIAVLRETLETRIRNTRDVEQLTDLPILGGIVFDPKAKDRPLIVHVDPRS
PRAESFRTLRTNLQFLDVGRVERSFVITSSIESEGKSTTGANLAIALADAGSRVLLVDADLRRPKVADYMDIEGAVGLTD
VLIGRADLADVIQPWGKGQLFVLPAGHVPPNPSELLGSTRMTQLIVEFNRAFDVVLFDAPPLLPVTDAAVLAKNVGGALV
VVAAGRTHKNQLTGAIAALGNVGAPISGLVLTMLPTSGPDAYGYGHYGYGYSYGETDPVAPASIPTADAAPARARGARVK
P
>gnl|bykdb|A0A1H8BMX3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium luteum] (length=488 residues).
MEPIDYLRTITRRWLLIIIVGLLGGAVAWGYAATLPAQYQATNSVFVTSDRGETTSELLQTSTFTQNLVESYAQLATTPT
VLGPVISRLGLDISTPALASRVSAVTPLNTVFIEITVTSRSAVQAVELADAVSDSLATAVENLAPKGPDNLPSITVKTVS
PAQLPGSPFAPNTQLIVLTGLLVGLVLGVLYALAREMFDTRVSSEKDLDRVSSDPLLGKVGRKKRTDPAGLVMRVMPHSA
MAESYRRVRANLEFIDVDSPPRSAVVTSAVTRDGKSTTAINLALAMAERSSRVLLIDADLRRPSIAELCDLEGDVGLTTV
LLGDVGPDDAIVRWSDGLDVLPSGAVPPNPGQLLGSDAMKTLMHRLLQDYDFIVVDSPPLLPATDALGLSHLTDGAIVVA
RYKSTTRQQLATTLESLEAVNARILGIVLNQVRERRAEVYYGPLAPVTGTAPRPPGTTNRVTATRVPRTTFDETGRRSSR
TSEPTRSS
>gnl|bykdb|A0A1H8W5Q2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Blastococcus endophyticus] (length=497 residues).
MELRELGLVLRRGWWLILAGIVLGVGGGGAICFLMTPTYESTTQFFVATPNSTDSNNNSALQGGVFSQQRAQSYTRLLSG
PDMTSRVIDRLGLPMSNEDLAENIEATADLQSVLIDVTVTDESATRAQAIAETIGLEFPDLVEELETAGRPELSAPVAVL
VTGQPEVSDEWASPQVLLILLIGAGVGLVLGFGAAIARGQLDRSVKDPAEAGELGGAAVIGTIVRDASLSKRHVLAEDLR
SATGESFRQLRNNLQFLSVDEPPKVIMISSSLPSEGKTTTAINLGLALARAGRKVVIVDADLRAPRVSSYLDLVEGAGVT
SVLSGAAELEDVLQRYGDADGECAVLAAGPTPPNPSELLASGNMGAMLGTLRDAYDYVIVDSAPLLAAADSTGLATHADG
VLLTVQFGRTRKDELRRAVDALQRVGGRVLGIVFNSVPPRSDLVKSFGYAYGYGATAGDKKSKKAKKHAKADTDRKADTA
APASEPSDRAPETADVG
>gnl|bykdb|A0A1H9RLP3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Phycicoccus cremeus] (length=508 residues).
MPQTNPKGVERPLASILLHFALLGGALRGEFIRVELTDYLRVARAYWRGIVAFVLLGVAVAAGVSLVTPKVYQADASGFV
SAGTATNPGEASVGDSLAKSRATSYVDLAQSRATAQDVIKTLGLDAQPAGLIGRITVKQPLDTVLIKISARASTPKESQE
LADAWVAALARQVQAVENPTGKSEQALRIVPIESAALPSSPVSPNTKRNVALGFVLGLMLGLGYALLRSQLDRRVREPET
VERDFGVTVAGAIPETSALVRKKGGLVPLVVTGPRKDKDPVHSAESFLKLRTNLQFMDIDNPPRIIVVTSPLPGDGKSTV
AMNLAAALSMSDRRVILIDGDLRRPVIADSFGLIEGLGLTDVLIGSVQFDEVAQQVGGLPNLRVLAAGRVPPNPSEMLGS
KAMRRLLERLGETCTVIIDAPPLLPVTDAAVLTASADGALVVVSAGQTLDTQLRDALANLAAVNGHTLGVVLNRVSPKSS
SAGYYSGNYSTVQEQRPERSAASEPAGR
>gnl|bykdb|A0A1H9SLE3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium cyclohexanicum] (length=479 residues).
MDLHDCIEVLRKRWRWAVLGLVVAVGVSVLATVLMPRKYTSQTQLFFATTGAQSNADINEGSSFTQQQMKSFAQVATSRS
VLQPVIDKLDLGVTPAKLAQRITATVGANTVVMDLSVEAASPQSAQLIAGELSNQLVTVVEGLSPVRADGTAFIKVSTIA
APNLPIAPSSPQPLRNIALGVLIGSVLGIALAFLVESVDTRVRTRGDVERFGVPLIGSLPSAGADDRAGLIGNADTTTPW
AEAVRRLRTNLQFATATARGCVFQFTSAIPGEGKTTTSVATAVALAATGVRVLLVDADLRNPSVARTMGIESHVGLTTVL
VGSARLEEVVQPWLDTTLDVLPLGHRAPNPSELLGSDQMAGLIKEMADAYDIVIIDTPPVLPVTDTVVLTRFTSGVLFVA
CANKLRRPEMSTALESLRQVDAKVLGVVVNRLDDHHDGYGYGYGSSHRPAGPESASRVQVEAHRRSGTVPSRATAMSGQ
>gnl|bykdb|A0A1H9TXR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium cyclohexanicum] (length=516 residues).
MTLDTFLKIVRRYWLILVTGLILGVLVALGLSLVQPKVYSANSSGFVTTASGSSQGSNGVGTALAGDSYAKSRVKSYADL
GTKRVVAEQVIKDLGLTTTPEDLVQKITVTVPTDTVTIKVTAKASTPREASDLANEWIIAMAAEIKQLEGGNTGTAAATL
TPLESAALPTHPSSPNTRLYLALGAVVGLALGLGVALVRKQYDRRIRSTSDVTALTDVPVVGMLPAEQELENAESRLIPS
DYEGAHDTRRSSSTRQFDEAMRELRTNLEFLDVDNPPRAIVVTSAVPGDGKSTVAANLAVTIAETGRKVVLIDGDLRRPT
MARSFGIPGEVGLTDLLAGRLDLEAVLQRWHDDSTLFLLPAGSIPPNPSELLGSASLRELISELTKQSATVIIDSPPLLP
VTDAAVLTARNDGALVVISAGRTAIDELGGALDALDKVKGKPLGIVLNRVPTTGADKYGYKYYRGNYYYYDSVDENGQQV
KHRRKPKEHEPTATAPAPSAGPNSAPARPRRAASSS
>gnl|bykdb|A0A1I1EJA4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides terrae] (length=473 residues).
MELQDYWRAVRNHWIGVLLLIVGTCAAGALFTALQTPVYAANAAGFVGTGSSDNAALGSVTDQLAKSRATSYIAVAKSRA
TAQTVIDELGLHTTPSALVSHITVSQPVDTVYLNIVAESASPKEAQQLADAWVAALAVQVQAIESPAGPPSDGTPRIVPQ
ESAALPGSPASPRPERNLAIAFVLGCLLALGYAVLRSTLDRRLRSADDVESHFGIPVVASIPTAPTLRHEPGAAATLALH
DTDEAGSAAAEAFRKLRTNLMFMDVDNPPRSLVITSPRPGDGKSTVAANIAAALESTGQPVILIDADLRRPTVAASFAVD
GAVGLTNVLTGQVSVEDALQTPAGFTSLRVLAAGAIPPNPSELLGSRAMRTLVEKLAQDHIVVLDAPPLLPVTDAALLST
ATDGVMLVISSGATVDAELETCLGSITTVNGRVLGVVLNRVSARHDRAGSYAYYGYRRDRTPQSAEPVAEPGA
>gnl|bykdb|A0A1I1HU33 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides terrae] (length=487 residues).
MDLREYIAALRKRWYLVAALTLVGTFFGVYQAESAEPQYRATSKAFVSLSRGANTQELVQGTTYTQSLVQSYVALATMPV
VLDPVIQELHLPVSARALAGSITAATPLNTVIIEISATTSDAALAADISNAVAQHLSETITDLSPESGAAETVRVDVVAP
AVPPSFPVSPNKRLLVLVGFIGGLVAGVALAVVRGLFDTRIRSGTDIGQVTDAALLGTIPVLRGRMGRAVTAIAPRSVAS
ESYRRLQTNLQFLDASAPVQCIVMTSSVGGEGKSTTSINLALAIAEKDLRVLLVDADMRRPAIADYCNLEGSAGLTTILI
GKAELHDVVQSWAQPTLDVLTLGEVPPNPSQLIGSRPMQMLLTRMREDYDFIVLDAPPLLPVADATILARLCDGAVVVAN
CQKVHRGQLSDALATLESVEARCLGVVANRVRATADESYYGHRVRNSLFGRFRANLASRRDRSARQPKTSAPDIPTLQPV
PDSGRDE
>gnl|bykdb|A0A1I1J043 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Verrucosispora sediminis] (length=488 residues).
MDLYRQLRLVRRHWWIVLVTLMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQAAVADNQLGLTAEEIQRRVSTSTETGTVLLRASVTDTDQTRALRVTEALSAKFVELVQKVEARPDGSPGPIKIEVVSG
PRVTPTPVSPQPVRNTAIGALLGLLAGVGLAILRGMADVRLRDAAGLQRVTGSPLLGEIPIDTSARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGIDPGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKAEAYQYEAYRVVAAATGGQSVPSERSRGGRHAERANTGEVSDHT
QELTRLSR
>gnl|bykdb|A0A1I2GS79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sanguibacter marinus] (length=505 residues).
MELQDYVAILRKRWVSILLITLACVGAAVGATMLMTPTYEARAQVYVSVRTGGTTSDLVQGSNFTQNQVKSYTDLVTSPR
VLQPVIDEFSLPVTSDELAESVSASSPLGTALINISVSDPDARAASDIANAVADSLATEVTALEKPVGEVSPVQVSTTRG
ATPPEDPASPSLKLNLALGLLVGLAAGLGYAVLRHVLDTKVRTDADIAQVTDASVIGTIAYDNDAPEHPLIVQTDPHSLR
AEAFRRLRTNLQFLDVEDRSNVTVITSSVPGEGKTTTSINLAATVADAGQRVLLIDADMRRPSVAKYMGIEGHVGLTTVL
IGRATMEDVVQPFGAGSLDVLAAGQTPPNPSELLGSGAMGELLERASAAYDVVIIDTPPLLPVTDATILARRTGGAIVVV
GAERIQRAQLAESLSSLETAGARALGVVLNRAKRTKSDSYSYYDYRSDLAPSAKSNKTRTKPAKARRSTPAEPSFVPPAP
ATAPRHVPSRSQQRGAARPSWPPLQ
>gnl|bykdb|A0A1I2I8S9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sanguibacter marinus] (length=558 residues).
MELSDYVGALRKRWLVIVVLAVLGAGAGFALARSSTPEYRSTSKVFVSLTRGETVSELVQGATYAQNLVESYVQVATMPA
VLDPVIDELDLGVSARALAGRVTATSPLNTVIIEITAVDTEPGRAAQIANAVAEQLAATVTTISPTAEDGGETVQMSVLA
EAQVPGAPFQPRTPLLMVTGGAAGVALGVMVALLTTLLDTRVRSAKDFPRVPERAVLGSIPFDRASSRRSAPTMVSQPHG
INAEAYRRVQTNLQFLAAASTLRSIVLTSSVSGEGKSTTAINLALAVAEKRERVLLVDADLRRPSVARYCGLEGAAGLTT
ILIGSATLADVVQPWGAAGLDVLTSGGQPPNPGQLIDSAAMEAFLAEAVASYDLVIFDAPPLLPVSDAAVLARLTDGAVV
VAGCRTVHRGQLVDALGGLDAIGATCLGLVANAVPTSESEQLYYAADAPLRPSRAGRRSRATQDRETTARGAVAPGVTAG
VEVGRGKSTEAPSDGPADEASAMVTAPEGPTEVSGASSTEVSTTELSVPDVLDDAPDASSDTSVGGAHRQAGPVDGGT
>gnl|bykdb|A0A1I2LBW7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinopolymorpha cephalotaxi] (length=520 residues).
MDEQWTEETGDNESDSVNLRDYLKVLRRRWRWLIPGVLVAVVAAAVVTFLTTPQYASTIRLFVSTPETNTTAAYQGGLFS
EQRAASYADLLTGPEVAERVVHALGLHESPSALQKHVTASVVPNTVILSVTVTDPSPGRAERIAKAYADQFKTFVEQIEA
PSKKSGSPITTSVLGTPDTTSSPVSPQPVRNLGLAAVLGLLLGIGAAALRESLDTSVRQAEELAALAAAPVLGSVGFDPN
VDKRYTIASAGRSAPRVEQFRVLRTSLTFVDVDQPSKVFVITSAVEGDGKTTTASDLAISLAQSGKHVLLVDGDLRRPKV
ASTLGLEQAVGLTTVLIGQAALSDAIQEWGDAGLAVLASGGLPPDPVQLFQSRAMSDVLRDLRRAFDVVLIDAPPLLPVA
DATILASQADGALMVVRYGRTTREQVRAGVERLTSVHGRLTGTILNWCPRSEASMTYTYHPDAVPDSTLVQPGAAGPPSN
GGAAPHANDAAHTNGAARYNQGAVEPAGTYEGRRRANRLS
>gnl|bykdb|A0A1I2T4Q4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Corynebacterium spheniscorum] (length=539 residues).
MNEIATLVTVVTRRWITVLVCALLGLACAIGYAGIRPQEYQSSVTLTVSTTNADGGGNAYQASMAANQRVRTYAAMVAQS
DVFNRVAADSEGQLKIGQLRGAVRAMAQADTSLIRITAMDEDPDTAEEMVSLTSIALTDLVAEVETPAGSDVPTAYLYMV
GQPSTTDSPVGLKAWEIVALGLFIGLVLGLIAAVIREYYDRTLRTVDDAVDITGAGVLGKIMVAKEIPEPGHQVKTGEAN
AEAFRHLRTNLAFVAVDHTPRVLLFTSSVPNEGKSFISLNVAAVLAEAGNKVVLVDADLRAGQANASFGTAAHVGLTNVL
AGSVEVDDVLQTLNAGVDLLPAGSPPPNPSELLGSQAMSRVLAALKEQYDYVIVDSPPSLPVTDALILAPQVDAVALVAR
LGLVQTTQLQQSMELLEKTGSQIAGIIVNGLKASKSEGYGYGYGYDSQAEAMVTTAPQKEHSLAQQARNAVHDEAVVRRH
RAVATRAQENEVRQTPPVAEFWEAPASAEDLGESFDYPSIDHTIDSGADEPEDGHHARW
>gnl|bykdb|A0A1I2YE61 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium levicorallinum] (length=478 residues).
MELRDYIRILQKSWMLIVALTLVAVAAASVFSILQTPTFSATSRVFVSTQSSGSTSDLVQGASFTVARVKTYSGIAVSPL
VLLPVIETLRLDQTAAELARNIAVSAPLDTAIIDIAVTDDDPRRAADIANAVSESLAVGVQEIEQRDAVTGAPTVKLTRI
QVASVPSAAVAPNVPLNIALGALVGLAVGVGLAVLRETLDTRIRSQRDVEQVTALPIIGGIVFDPKATERPLIVHADPRS
PRAESFRTLRTNLQYLDVERRDRCFVVTSSIGSEGKSTTSANLAISLADAGTRVLLVDADLRKPRVADYMNIEGGVGLTD
VLVGRAELEDVIQPWGSGQLFVLPAGRIPPNPSELLGSSRMAQIIEEFNRTFDVVIFDSPPLLPVTDAAILAKSVGGAIV
IVAAGRTQKNQLTGAIAALDKVGAPISGVVMTMLPTKGPDAYGYGHYGQYGYGHTYGDTGSAPEVIAPAYSRRSRAKA
>gnl|bykdb|A0A1I2YEQ7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium levicorallinum] (length=477 residues).
MELRDYIRILRKSWVLIVLCTLVAVGAASTYSILQTPQYSATSKVVTLTQSSGSTADLAQGNNFSVARVKTYAELATTPI
VLLPVIASLDLGITPAELAKKVAAAAQLETSIIDVTVTDTDPVRAADTANAISNSLTVVVEEIETPDTVDATSPVKLTLT
QEATVPIAPISPNVPLNIALGALVGLALGVGVAVLRETLETRIRNTHDVEQLTDLPILGGIVFDPKAKERPLIVHVDPRS
PRAESFRTLRTNLQYLDVGRVDRSFVITSSIESEGKSTTGANLAIALADAGSRVLLVDADLRRPKVADYMDVEGAVGLTD
VLIGRADLADVIQAWGKAQLFVLPAGHVPPNPSELLGSTRMTQLITEFNRAFDVVIFDAPPLLPVTDAAILAKNVGGALI
VVAAGRTHKNQLTGAIAALDNVGAPISGLVLTMLPTSGPDAYGYGHYGYGYSYGDPEAIAPSIPAEPARARGARVKS
>gnl|bykdb|A0A1I3D4A2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium levicorallinum] (length=485 residues).
MEPIDYLRTITRRWLIILIVGLLGGAAAWGYAASLPPQFQATNSVFVTSDRGETTSELLQTSTFTQNLVQSYAQLATTPT
VLGPVITRLELDTTPQSLAAQVSAVTPLNTVFINITSTSTSAEQAVELADAVSLSLATTVESLAPKGPDNLPSISVKTVS
PAQLPGAPFSPNTRLIVLTGLLLGLMVGVLYALAREVLDTRVSTQKDLDRVSSDPLLGMVGRKRRSDPAGLAMRVMPHSA
LAEAYRRVRANLEFIDVDSPPRSTVVTSAVARDGKSTTAINLALAMAERSAKVLLIDADLRRPSIAELCDLEGDVGLTTI
LLGDVGPEDAIVRWSDGLDVLPSGAVPPNPGRLLGSAAMKTLMKRLLEDYDFIVVDSPPLLPATDALGLSHLTDGAIVVA
RYKTTTRQQLTTTLESLEAVNARILGIVLNQVREHRAEVYYGPLAPVKRVSAPMTGPVNRVTATRAPKAAFDDSGRRDSE
SARTK
>gnl|bykdb|A0A1I3XXQ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Streptosporangium canum] (length=460 residues).
MDLLYYIRLARRNWLLIVFSLFLAAATATVVTAGTPPKYVATITMLVSGHDREGSLTTAYQAGMLSQQRVQSYSELLTSR
RMISQIAAGDDVQRLQENITAEPIPDTVLIRVAVVDTDPARAARLANALGAEFPKLIDQIERPTPTGRATVKVTMVDRAD
VPGAPVSPRPLVNFGLAMVIALSVAVGSLILRDRLDTTIKTDEALRQASKSAILGTIGYERNARRLPLIVRDQGRSSRAE
AFRSLRTNLQFIGVDRQPKSLVVTSCLPNEGKTSTAANLAITLAQAGWRVILVDGDLRRPRIPRYLGIEGTAGLTDVLID
RARLQEVIQTWGEAKLSVLPSGQIPPNPSELLGSHGMRNVLAELTETYDMVIVDAPPLLPVTDAATLAAICDGTLLIARY
GKIRREQVARATEMLSAINARVVGAVLNFAPATSSQHYGYGYGYEPEVKGKRKDKTPVNA
>gnl|bykdb|A0A1I4JX94 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. CL147] (length=582 residues).
MPAPARHIPQAPLTAEAGSSTPTAAQHQFGAALKRFWYIVAIGAVAGLAGGWGLAQVATPVYTATSSLYFSLNFGGSAND
LNQGSTYTQNQMLSFAQLAESALVLQPVIDQLDLQTTPADLGDSIAVSTPQNTVIMQLSVSSPDAQQAADIANAVAATLG
KKVEEIAPKSVAGAPTVSVRTIQTAVKPDTPSSPNVRLNLVAGFVIGILIGVLAVVLRELLDTRVRSAEIASRVTGVPML
AQIQRLRRRLPSPILLADPLSSAAEGYRRLRSSLEFVSVDSDRLAFVVTSSIEDEGKSLVSLNLALTLTEGDRRVLLVDA
DLRRPTLADATGLPGGSGLTSILVGRVALADAVQQWNGLDVITSGPIPPNPSELLSSRAMADFIAQVSHDYDVVVFDTPP
MTAVVDAAIVARSLEGALVVADRTRVSRQQLAQTMDLLEKSGVHILGLVLNRVAPTKSSSSYYRPAAASPQSRWRRLTMR
RARQSAPPLPLPPLPALPMEDEELALVPEDAVDDAPLDEEFDADLSLAEADADAEDAADGAADGAGAADGAGDAAARGRT
DMDDEDFELANTGGTPEAKPGR
>gnl|bykdb|A0A1I4KI63 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. 98AMF] (length=507 residues).
MSSKQYAQAFRRFWYVVVIATIAGALLGFGLSQLAVKSYTATSGLYFSLNFGGSANDLSQGSTYTQNQMLSFAQLAESPV
VLTPVVDQLDLSITPSQLADSISVSTPQNTVILELSVTDTSPRQAADIANAVAASLSSTVEQIAPKTAQGAATVSVRVIE
HAAVPKFASSPNTRLNVLSGLLLGLIAGALIVVLRATFDTGVHNAETATEVAKAPLVGSIQRERNKDGVPVLVSAPLSNA
AEAYRQLRSNLEFVTLGSPTRSFVITSSIPSEGKSLISSNLALALSETGQRVLLIDADLRRPAIAGYTSLSGNAGLTSVL
AGRADFEDVVQRWGAGDLDVLAAGPIPPNPSELLSSRAMSDLLERLRARYDVIVIDTAPLGSVADASILARQVDGALVVV
DRTRVRKQQLAQTVDSLQKSGAAVLGIVLNRVAAGKERNAYYMAEQPPRRLGLPGRRGGAAPESADTAEAGSAAKRPAKG
KAAESAPAENAAAPDSPSDAARSHSAS
>gnl|bykdb|A0A1I5DH92 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus obscurus] (length=479 residues).
MSTRGPLHVLRRRWVQISGVTLVGLLGGLTYAWTAPVTYESTAGAFFSLVSGSTASDLVQGSTYAQNQVESFAQLAVTPE
VLQPVIDRLDLPESPAALARAVEVTVPTGTVIVEVTVTDGSAERSAELADAVITSLSDVVERIAPQDEAGDPTVVATTVT
PAEVPSAPASPDVPLVLAAGLVAGLLAGLGLAWLRETLDTRIADAEDVAEVTPLPVLGNVPSWPRRTGRVVVAAEPFSQA
AESFRQLRTNLQFLRVAEGGSGGTGAHVVAVTSSFSGEGKSTVSANLATTLAETGARVLLLDADLRRPTVAGVLGIEGGV
GLTTVLAGQAALDDVVQEWGSAGLAVLPSGPVPPNPAELLGSPAMRALLAGLRTRYDHVVVDTAPVLPVADASVLSRVVD
GVVVVANARQARRRHLGQSLDDLSKVSARVLGVVLNQVRRDEESYSYGRDEDRAQPADGDVRSGSGRVGRAPVGRQPVR
>gnl|bykdb|A0A1I6IZH2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces sp. CF514] (length=485 residues).
MELRDYIRILRQSWVLIALLTLLGVAAGAVFSIMQTPLYSSSAKVFVSTSSGGTIGEMTQGNTFTQQRVKTYADLTTTPI
VLLPAIAALQVDMTSDELAREVIAVALPDTTLIEITVTDADPALAAEVATAVSESLTKVVEAIETTGGAAADAAGDDAAA
DTAEPATASPVRLTLVQHAAVPQKPVSPNVPLNIVLGGLIGLALGVGAAVLRETLDTRIRNERDLEQVTDTPVIGGIVFD
PKAKDRPLIVHADPHSPRAESFRALRTNLQFLDAGRPERSFVVTSSIESEGKSTTAANLAIALADAGARVLLVDADLRRP
KVASYLGIEGAVGLTDLLIGRAELQDVIQPWGRSQMYVLPAGRVPPNPSELLGSAAMVGIISELNRAFDVVLFDAPPLLP
VTDAAVLTRAAGGAILVVAVGRAHKGQVKGAFAVLDNVDANVSGIVLTMLPTKGPDAYGYGRYGYGYGYGYGYGYAPKEE
TAAGA
>gnl|bykdb|A0A1I6JEQ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cl127] (length=497 residues).
MNLEDYGRLVRRHWGAIALSIGLGLAVAFGVSVLIPKVYTADASGFVVSQSSGSTGIASLGDAYAKSRAKSYIEIAKNRT
IAQAVIGQLGLKTTPQSLVNQISASVPLDTVTLRITAQAATPQQAQDLANAWIRALAVEVQKLESGQVLAQGGVAAPVEG
DPAGAAVVALVPGDTAVLPSAPSSPNLKLNLLLGALIGLALGIAWALVRSTVDKRIRSAAAVESTYDVSVVGTLPVDDVL
AGAGRRLISTSSARADNEHLRLAEALRELRTNIQFLHVDDPPRVIVLTSPVPGDGKSTVVANLALAIAESGRRVVLVDGD
LRRPTVAESFGVSGAAGLTDVLVGSAQIGEVLQRTAWHRNLYLLTSGTVPPNPSELVGTQVMRDLLRELSEHAIVLVDAP
PLLPVTDGAILANQADGAIVVVRAGRTHIDELGKALSNLAKAGAVALGIVINRIPVKGMDRAGYGYYGGGYVGKNAGYVS
ADPDAAPLHEVLAEAER
>gnl|bykdb|A0A1I6JH27 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cl127] (length=578 residues).
MDIRDYLRALRRNWIAIILMTAVGLGAAYGWAKIQTPVYEASVSGLVKSRVTPTDPQEQLAQSTDTYARAKVPTYLVMAG
WRSVAVNAGSTLGLSDSPESLVKRITVTNPEATNIINIAATASSPKAAQQLADAWMKGLVSVIDDTDGIDRQPGTSPVMI
YVAQTAALPEAPIFPSVPTALLIGGLLGLGGGIAFAMIRAISDRRVRGTDDVEQRLGMPVVGIIPKVDSVAVERRIVAED
DARADSRTDFAVRESLRALRTNLQFMDVDHPPRTIVVTSALAGEGKSTVAANLAMTLAAAGTNVVLVDGDLRRPTVASTL
GLVAGAGLTDVLAGRAKLTEVAQTAPDIPNLAVLTAGTIPPNPSEVLGSARMHQLVKDLTKHATVIIDAPPVLAVTDGAV
LANQADGALLVVAVGKTTYDVVDKALNTLEKARGRVLGVVLNRVPVTGRQAGYAYDYREKSSPKETAGKAGKSAEAASGP
KRTGAQPVPVVPADQGPLLPDEEASAQPVDEAVAAPAASKPRRATARAARAARTAAPAERGKDPALAADPGAGDLDSLLG
DFIADDAATGPRRQRGRT
>gnl|bykdb|A0A1I6KI27 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. cf046] (length=501 residues).
MELRDYLRGIRRHFLAILIMTAVGVGVAYAWTLVQNPVYEASADGIIQAQNTTEGQTSLSGDAMAQQMVETYLEMASWQD
VADAAIQKLGLQITADQAFARIVVVNPANTAILRVTAQGSSPEDAVALAEAWIQALATVIDDYEGDGTQGTAPLTITVAS
SASLPTTPVFPDLSTSLIVGGVLGFGFGIAFALIRTVSDRRIRSADEVEARTNIPVVGTIPTAEALGGESRLFDPTAAGP
KGTGFAVSEALRSLRTNLQFMDVDNPPRTIVVTSPLPGDGKSTIACNLALTLAAGGKPVVLVDGDLRRSTVAASMGLPGG
AGLSDVLSGRAELADVLQRTPRSPNLYVLTAGSVPPNPSEVLGSGRMRKLLADLAVHATVIVDAPPLLPVTDGAVLTHQA
DGALVVVSLAKTTYDLLEKSLDTLQKSNGRALGVVLNKAPLKGMDASPYSYEYRREYGKAAKADAAPAVRDDHPADANLN
ALFGSPEAELAEERRPRARRA
>gnl|bykdb|A0A1I6LA98 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agrococcus baldri] (length=465 residues).
MELSDYIRIIRKYWVLLVAATLVGVGVGAVASLVQTPTYSASTQVFVSVQSGETTAELAQGNTYSLSRVQTYANLVDSQR
VLDGVIAALQLDVERGALDSRISATTVPETAIIEITATSSEPAEAAALADATAASLSTTVDEIESRPELASPVQLAVVEQ
ATVPASPVSPRTTVNVALGALIALALAAGFALLREVLDTRIRGERDVRAVTDAPMIGSIAFDPKAKQRPLIVHVDPQSPR
SESFRTLRTNMQFIEVDDGARTFVVTSSMPGEGKSTTTANLAVALADAGQTVILVDADLRKPKIASYMNLDGGVGLTDVL
IGRAELVDAVQQWGTKSLYVLPAGQIPPNPSELLGSKAMATLIKDLQSEFDWILFDAPPLLPVTDAAVLSKHVEAVIVVA
SVGKATRTQLESAVQLLETADTQVGGVVLTMVPTRGADAYGYGHYGYTERKKLERKPRLSISRQR
>gnl|bykdb|A0A1I7MGN5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus terreus] (length=482 residues).
MDLKDYLRILRENWLPILLITLLGLGVAAGATALTKPKYTATTQVFVAVGGGDSATEILQGSSFSEKRVTSYVSLATSPR
VLQPVIEELDLDTTPRNLAETVTANAPLQTVLINLSATHTDPETAAQIADATAASLIRTVGEVETPGDEREPLVDLSIVD
PAGVPTSPSSPRTLLNLALGLVVGAALGVAYALLKTILDTRIRRREDIERITDAPVLGVVAEDKSAEDEPLLTVDDSTWG
HRAESYRQLRTHLKFTNVDGGTQTVVVTSSVPGEGKTTTATNLAVMLAESGTRVLLVDADLRRPRVAKTLGVEGAVGLST
ILSGQIDVEDAVQVWGDSAELDVITAGEVPPNPSELLGAEAMGRFLDWARENYDIVLLDAPPLQPVTDPTVLAAQCSGVI
LVCRVDGYNHRDQLRGALENLEATGSRLLGLVLARVPIKRSGYQYYDYQPDAAEPTASHRSGGSRKRARQRSGASVTGMR
FR
>gnl|bykdb|A0A1I7MP88 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus terreus] (length=476 residues).
MTVLDLVKLLRANLVLLAVSTLVGILAGWGLSLAQKPLYTSESTGFVVVDAQGDGQTGAPSQVLSGSDLAQERAQSYLPL
IHSRAVQEEILHVTGQPVEQGRLSARVEPNSNLITVAATATDPQAAADLANSALQATAAVANRLEGGSVVRVEALEDALV
PSAPSTPNTLRNVVYGAGIGLLAGLVVAFLRRLLDVNIRTTTDVQKSAGAGLLGTLPKDESFTGTAAGIENGSPRALEAV
RQLRTNLKFVSIDNPPRTISFTSANPGEGKSTVVSSLGLALTAAGDRVMIIDADLRRPRQHTLFDVDGRVGLSEVLAGQV
GLEDALLEVGDDGLKLLPAGRTPPNPSELLGSARMKTLLEQVSRDHLVIVDAPPVLPVTDSTLLATSVDGTVLVVKHAKT
RREHVEVARDMLGKVQANVIGVVLNGTPAKGVGSDYYGGGYGATHQAYDAYLDASRQARGGPRLLKNRRPGRRARD
>gnl|bykdb|A0A1J0UA55 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. WY10] (length=506 residues).
MNIRDFAKLLRTRWITVCVTTLAVVLGAVLYTLLTTPLYQASTRLFVSASSGGASVSDLYQGNLFSQQRVLSYAELLGGG
TVAQRTIDKLKLDTTADALEKRIKATVKPNTVLIDVSVLDESPVRARDIANALSDEFVALVGELETTTPGAQADSRVVVE
QRASVPTKPLVPNPVRNIGIGLGLGVLLGVGLAVLRDMLDNTIKSQQTLEEIAGSSVVGYIPLDKDIRKVPALSFVSDNS
GTAEAFRKLRTNLQFLAVDNPPRVIVVTSSSPAEGKSTTAINIALALAEAEHNVVLVDGDMRRPSLDKYLDLVGSVGFST
VLSGTASLAEVLQKTEFPRLTVLTAGSIPPNPSELLGSLAARKVLDELRAQFDFVVVDSSPLLAVTDGAVLAATADGALI
VARFGKTKRDHLAHAVENLNSVGASVLGAVMTMMPARGGSSYSYHYSYGGSSGDGNRDQRKEPANFHSADAETNRPDVNT
TADATSPRHLTERKDGDASPVKRSLD
>gnl|bykdb|A0A1J4MWA9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides luteus] (length=474 residues).
MDLRDYVAALRKRWYIVAVLAIIGAGVAFAQAHASPPQYRAQSTVFVSIARGATTQELVQGSTFTQDIVQSYAKLATMPV
VLDQVIYDLDLDTTPKALAEQITAENPIDTVIIEIDAVATTSSGASDLANSVADELTTTITNLSPSSNKKSAVEVTVVAR
ADPPEEAFAPRTRLAALVGFAAGFGLGVAIAVVRALLDTRVRTAAEIEQLTDVGLLGAIPRRRGRRRSSGAVTAIDPHNV
AAEAYRRLQTNLQYLDASSPVRSIVVTSSIGGEGKSTTSINLALAIAEQGQRVLLVDADMRRPAVADYCGLEGAAGLTTV
LIGKAELDEVVQVWGDANLHVLTMGEIPPNPAQLIGSPRMADLLEEARASYDVVILDSPPLLPVADGAILSRLTDGALVV
ANCRTIHRPQVLEAIDSLENVDARCLGIVANQVRDTAAHTYYGQPEQGWLARLLTGLGLVRPRVPQHGHPAAGG
>gnl|bykdb|A0A1L3MI59 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter indicus] (length=470 residues).
MQLSELLAVIRQRWRLIAACVVLAVAAAVAVTLTTTPVYEARARIYMSAERTSGSSNGSVFVLTSEDLDTYVSILDTPAV
LGPLRKELGLEPGHPVQVSAQTSGSTSILNITARASDGQEAADVANEVGPQLGKVAGEFSTLLKSSGQKVVSTPIQPATA
PSRPVSPDPVRNIGLGLLAGLVLGLGLALIRHALDTKVRGEEDIRAHSDAPMLAGLPLESRGSKRGLISVEEDPHGRHAE
AVRRLRTNLMFVDVTTGRHSFVVTSAVPGEGKTTTAVNLALAMADSGRRTLLIDADLRNPSVAKTLAMEGSVGLTTVLLG
DADVHDVIQTWGSAGMDVLPAGPIPPNPSELLGSAPMEALLTRLVQEYDFVLIDSPPVVPVIDAVVIERLTGGLLMVVGV
DRTKKKDLTAALKQLNTVGAHVCGFARNFVVSKSSDYRYGYHTYEQAIAQDKRRGRRRSAERAAKQRARA
>gnl|bykdb|A0A1M3AX45 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 70-38] (length=501 residues).
MTDVKPQVTPSRLLGVLLRGWWILLVAAVLGGGVAYGYSSLQAPIFQSTASTYFSMKSASSGSDINQGSAYTQNQMLSFA
QLAMSSMVLDKVRADLNLDLTNAQLRNMTSVSIPQNTVILDISAASTDKQFAADLANSISSNLASEVEVIAPRDDAGKAT
IVARVIEPGVPAVYQSSPNKSRDAVLGGIAGLLIAALALTIWALLDTRVRSEDVLRRITELPVLGAVPSRKDNGRRPIVV
SEPNGAGAEAHRGVRSSLRFSAVGHEITTIAVTSSIPGEGKTTVAINLALTYAEAGVRVLLVDADLRRPMVAQSLGLENS
VGLTTMLVGAVGFDDAKLPWGDTRLWVLPAGVVPPNPAELLASERMAEILRDLRTDFDVMVVDTAPLLSVADATIIAPLV
DTTIVVADVTKVRIAQLTRALSTLTAVRAQIAGVVFNRVRRGRRDDYRYYYSPTAERATTRRKLRRRAVADAAPTATPAV
EASKKAKGKGKGQTPDEVAEP
>gnl|bykdb|A0A1M3LQG0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. 71-9] (length=528 residues).
MNRNPYLALFRHFWYVVVIGALVGAVAGWGLSQLSTREYTSTTSMYFSLSAGVTGNDINQGSTYTQNQMLSFAQLATSSV
VLQPVIDGLGLDTTAGALAKQISVTTPQNTVVLQLDVTDTSPTEAAAIANATAASLRTQVEDIAPKNAQGNPTVATRVIA
PAVEPAGPSAPNERLNILIGLIVGILIAAGGLLLSETLSTRVDSEEKAIAVSGAPSLGTVRRRRGATPGLAMVGDTRSSS
AEDFRQLRANLEFVAVDVPSPVFVVTSSILGEGKSTVAINLAIALSEGDKRILLIDADLRRPGVAGYTGLVPGTGLSTVL
AGRVTLADAVQPWGDDGALSVMTAGRIPPNPSELLSSRAMTALIEEARGMFDVIVIDTPPLGAVADAATLVPEADGTVVI
VDRTAVRRNQLLHAVEAVRRAGGSVAGIVFNKARAKRSGDAHYYYRLDDEQAPRPHGAERAPRLPAADRPASDRPTGPVR
PVPAPPPAPAPQRAHGHADTRADADDADASDVDEANGPATPASGIARM
>gnl|bykdb|A0A1M7A465 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITGNLPAEGRAQAYVALINSQAVR
ERVAQDTGQDSDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGAVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEKYLSSVGSSARKGRRSRRKARTRS
>gnl|bykdb|A0A1M7BYB6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=447 residues).
MDLQQYLQTFRKYWRSILTVLSVCVGAALVFTFLQTPKYSSTSSALIAVDTAATPGELSSGALYAERQVSSFVALADSAL
VLDPVIDELGLNVTPQALRSRVSVSAPAGTSIVDVTVTDTNAGRAAEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
PAAASSRPVSPRPVVNIALGLIAGVVIGLGQALVRRVLDSRIRTRDDLEEVTDAPVLASVVHHKGFDRPKDGAAPTRGTA
WASDESYRKLRTAVGFVAFGGERRSSIVVTSSVQGEGKTETSTNLAKVLAEAGARVLLVDADLRRPQVGARLGLDDELGL
SDVLTGRADLNDVLLSVDDLSVLPAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
VARAGVARQNQLTEALAILEAADASVYGVVLNDVPVSQIDGYSQYYR
>gnl|bykdb|A0A1M9PW13 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=453 residues).
MNLRDFGKVLRSRWLIVVTTMLVALLAAIASTLYTTPLYQASTRLFVSTSSGGASLADNYQGTLFSQQRVLSYTRLLMGE
TLAQRTIDKLGLQMGATELASRVTASAPVDTVLIDVKVLDESPTQARDIANTLSDEFVAMARGLETPEDGSAPGTRVVVE
QRASAPNSAVVPRKVRNIAMGLGIGVLLGVGLAVVREYLDNSVKDPEIVEEIAGVGVVGSIPLDKDCQKMPAIAFDGNTS
IIAEAFRKLRTNLQFLAVDNPPRVIVVTSSLEGEGKSTTAINIALALAEAEHNVVIVDGDLRRPSLAKYLNAIGSVGLSS
VLSGAASISESLQKTKYSGLSVLTSGTIPPNPSELLGSLAAEKVLNELRAQFDYVIVDSSPLLAVTDASILAASSDGVLV
MARFGHTKREQLAHAVASLADVGASLLGAVITMTPTRGNGSYGYTYYAERKNA
>gnl|bykdb|A0A1N5VMM0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora cremea] (length=486 residues).
MDLLRQLRHVRRHWWIPLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTSNQGVSDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAENPVGLTADEVQRRVSTSTETGTVLLRASITDTDQTRALRVTETLAAKFVELVQKVETPPEGKAPIKIEVVSGP
RVSASPVSPQPVRNMTLGGLIGLVLGVGLAILRGVADIRLRDAAGLQRATGSPLLGEIPFESGARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEVYQYEAYRVVASTATPSAPTDRATSARHSEGTGVNGVSDRTQE
LTRLPR
>gnl|bykdb|A0A1N5XHQ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. abscessus] (length=486 residues).
MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILSGDSAAQAKASAYLPLVTSGP
VAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATASSPQDAATLANNALQATADYVSDLEGRESAVKVTPLDDAQA
PDGPVSPSYRNYLLIGAAVGLVLAYLIAFLRKFADVRVRTTDDLENATEAGTLGILPKSSALDENTFLSDRADHQSEEAL
RQLRTNLRFVSVDAPPRSIIVSSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFGLDDAVGLSQVLSGQI
GPEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDGSLLSANVDGAILVSVCGRT
RKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGYGGYRSGYQAYYGQDGEGSGSGSSPAAGGKHGAKGRGRRA
RTSHSS
>gnl|bykdb|A0A1N6RXV3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium aquatile] (length=564 residues).
MELKDYLLLLRRRWVTVAVAAALGLVLAGAYSLLSTPTYSARSQVYVSVQGSDSTTDLLQGSNFTVRQVKSYIELVTSPR
VLDPVVDELGLADDAASLAQRVQADSPLDTALVNVTATDESPQLAAEIANATARSLASVVAELETPVGGGDSPVQISTVR
AASVPTAPASPNLRLNLVLGLVIGLAVGVAVAVVRELLDTRVRSTADVEDVTDAPVLGVIGYEADAPEHPLIVQESPQAV
RAEAFRRLRTNLQFLELGPAARTYVMTSALPGEGKTTTSVNLAITLADAGQRVVLVDADLRRPAVARYLGIEGSVGLTTI
LIGKVAVEDAVQPWGNGNLDVIASGQIPPNPSELLGGESMAQLLERLRTEYDVIVVDTPPLLPVTDAAILAKGVGGAIVV
VGAGTVHRNQLETALSALGTVGVRPLGIVVNRVPVKGPGAGPYEYGYYEYTADAAGEASQGRSARRSAVRGSRHARGAAR
QAAPATGTGPWAPVASEGPAGGAPAAEATRGAVPAPPPTGVATAVDGAEADLGPGRPGSEAAVAVGSRPATGTFDEVVLP
RERR
>gnl|bykdb|A0A1N6VAF4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium aquatile] (length=487 residues).
MTLREYVTAVLRHWVVVAVCAVLGAVAGFGYARSEPKVYQSSASVMVVPEQGENAAELVQGSNYVQNLVASYAVLAQSPY
VLEPVIEDLGLDTTPARLARSVSVNTPLNTVVIEIAVSDTSPDRAREIADGISDQLALAVPELSPQLADSSSAVRITTIA
PARQPVNPIAPNTRLLTMVGLAAGLAVGVTYAVLRELLARRVVSSSSIQSMLGVPFLGEVVKVPSRTSLPAVVAAGPGSR
PSESVRTLVANVRFADVDHGRRVLMVSSGDAGEGKSSIAISLALSLAEDGSSVLLVDADLRRPSIARVTGLEGSVGLTNL
LVGDVAQEDIVLPWTRPNLFVLPSGVLPANPGVLLSSERLVAVIGDLRTHYDYVVIDTAPILPLSDPLWLSRAVDGVLVV
ARARKTRISRLRQTVDKFERGEADVIGIVLNDVKPRGRSAYYVDDPRVGIPGAFSRETGSADVRPVATADDAAAPRAVED
ADRRTTP
>gnl|bykdb|A0A1N7D4C7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora avicenniae] (length=486 residues).
MDLLRQLRHVRRHWWVALVTVMVALGVSAFLTVRAQPRYEASVTFFVTTPNQGVADAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAENPVGLTAEEVQRRVTTSTEAGTVLLRASVTDTDQTRALRVTETLSAKFVELVQKVETPPEGKAPIKIEVVSGP
RVSSSPVSPQPVRNMTLGGIIGLVLGIGLAILRGVADVRLRDAAGLQRATGSPLLGEIPYEGGAKSAPLIVGEAANSSRA
EAIRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGIDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALVVSQ
QGRTSRTQVAAAARSLHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVAATETPEVPADRVATARHGESGAANGVSDRTQE
LTRLPR
>gnl|bykdb|A0A1P8M4B6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. QXT-31] (length=510 residues).
MRRSWLLITCLALLGLLGGGASALLVKPTYESETQLFVAIQNSGSVQELQQGNTFSQARVQSYVKTVATPAVLQPVIDSL
GLSESPLQLAERVKATSDLNTVLITIAVEDSSPVQAAAIAQATGTSLIKVVDSLERSDKTSESPVKLSVVTPAVAPTTAI
SPNTKLSLSLGLMGGLVVGLGAAVLRHRLDNRIGGESDLRAITDSPILGGISFESEAKGRPLITQIAGQSPRAESFRQLR
TNLQFATVGQKSAAVLVTSSLPGEGKTTTATNLAIALSQAGQSVVLVDADLRRPMVSEYLGLERNVGLTTVLIGTAELND
VLQPWGDDNLYVVSSGRIPPNPSELLGSEAMVQVIKRLEATFDVVIIDSPPLLPVTDATVLSQSVGGVILVVDSKNTTQA
SVQRSLQSLSMVDANLLGVVLNRLPVKGPDSYGYSYPAYAARTDEAMQTSVSPTESGWAGRRRAKRDGRSAAKVESEPAS
PGQDVAAETLYDEAMNSRSRSATRFPSRGR
>gnl|bykdb|A0A1P8U1C6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium acidipropionici] (length=486 residues).
MTSEPSGWTLSRIWGALRKLWVVIVASMLIGGVVTFGVTSVMTPDYESTSTLAFSAGRGSTSKELADGSTYTQTQMPTFA
QLASSSAVLQPVIDDLGLGMSVNALKKQMVVTIPQNTLVLEIQVSWTSAQESATVANAVAQSLTTVVRQVSPKPSAGQQS
AVNVTLVDKAVAPDHPTSPDKVKDPILGGLAGFVIGVLIVLLWSLLDTRIPTVGALRAMTGSPVLGSVSRTRSTARLWTV
ADPAGQTAEEFRRISSALTYATFGRQAHSIVVTSAGPGEGKSAVSANLALTLAGLGSKVLLIDADLRRPRVAANFELVDV
VGLTTVLMGRTSLQQAIQQHPGSDLDVLTAGALPPNPAEFLTSERMHALLEETVAGYDFVIIDTPPVLSVADAGLLAPIT
DGALIVVDAKHTRQAALTSAMTGLEDAGGRITGMVLNRARIDRMGAARYGEYLAPASRHSRRTDAVAQDAAPASPDTPVQ
AARRAR
>gnl|bykdb|A0A1P8UAU0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium aurum] (length=496 residues).
MELRDYLRILRAHWLGIVLLTLLGAAVAFGYSALQPRVYTASASGIVQATGGGTDVGSSLVGNQLAQSKVSSYVDIGGWR
SVAEHAIDELGLDTTPQALVSHVSVSNPLDTVIINVSADADSPEAARDLAEAWIDGMVAEINNLETGDSDTAGAVTLVAG
QAAALPSAPSSPNVRLNIALGTLIGLALGIGYAVIRHVLDRRVRHPRDIERETGAAVVGTIPLEKQLTGTRRVFAFDGSS
PESTSTAITEAMRELRTNLQFMDVDDPPRIIVVSSPLPGDGKSTTAANLALGLAAAGQQTVLIDADLRRPVVGSIFGLPE
GAGLTDVLAARATLDDVIHRADASGNLLVLTAGRIPPNPSEVLGSQRMRDLLSSLARTATVIVDSPPAIPVTDAAVLSTA
AHGVLLVVSAGRTTYEMLQKALENIARANGRVLGVVLNKVPRRGGEAGYYGYQYRGDYDSTAPTAAHRTGEAAPADEAAG
STPRARRRGKVTAPSP
>gnl|bykdb|A0A1P8XIF4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. MS1601] (length=467 residues).
MTLQDFVKMLRARWLTVCATTVLAVFGAVVISLLTTPMYQASTRLFVSTAAGASVSEMYQGNRLSQERVVSYTELVKGTT
LAQRTIDKLGLDMSPGQLVANITTSARPDTVLISVSVLDESPVRARDIANTLSDEFVVMVRELETPEDGTAPNARVVVEQ
RASIPSSPVIPKTTNNLLMGFGLGLVLGIGVAVIRELLDNTVKTREALEEITGVGVVGQVPLDRDRRKQAAISFDFDNSA
IAEAFRKLRTNLQFISVDNPPRVIVVTSSTPAEGKSTTAINIALALAEADHNVLLVDGDMRKPTLHKYLDLVQPVGFSTV
LSGQASLEDAAQKTRFSGLTVVTSGGIPPNPSELLGSQSAKKLLAEMRNLYDYVIIDTTPLLAVTDAAILAAGADGALIM
TRFGQTKRDQLTHAIKNLDDVGAPLLGAVFTMMPTRGSNTYNYSYYGEEGRTATTQRPSKAPGSSDD
>gnl|bykdb|A0A1Q3L510 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 69-10] (length=507 residues).
MELKDYLRIFRAHWLGMLAVIVGAVVLAFGWTLTQPKVYTADSTAIVQANTGSEDLGMQSVGNNIANQKVKTYVELGSSR
SVASRVIKELSLDEKPDTLVSAINVTNPLDTTSLRVTANASTPEKARDIAEAWVRGMAAEVNDIEAGDATKQGAVFLRPI
DSARLPSSPSSPNTKLALAIGALVGLALAIGYGLLRYTLDRRIRSVESVERETGVAVVGTVPEEKSFTADDRLIPFDGGN
SANSSKAHLFAIAEAMRELRTNIQFMDVDNPPRVMVITSPLPGDGKSTTASNLAITLASSGQKVVLIDGDLRRPMIDTVF
GLPKGAGLSDVLAGRAELAEVAHRVGGNGRLLVIGAGKIPPNPSEVLGSARMKELLEAISREAIVIIDAPPLIPVTDAAV
LAHSTDGAIIVATVGKTTFEVLGKALSNLERAGARALGIVLNRVPRRGSGAAYYGYQYHGDYYRVEKPEDEAAELLASTP
SSEPVRAEPSARDDDGTPPRRSTHRAS
>gnl|bykdb|A0A1Q4HCJ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium diernhoferi] (length=474 residues).
MNLQEYVKLLRSRWITVAVTILVALAAAATYTFLTTPLYQASTRLFVSTSAGGSVSETYQGNRFSQDRVVSYAELLKGET
LARRTIDKLGLDMRPAELQSAIKAKAKLDTVLINVDVLDPSPVQARDIANALSDEFVNMVRELETPEGATTPDSRVVVEQ
RASIPEKPVVPRTARNMGLGLLVGIALGIALAVARDMLDNTVKKREQLEDLTGTGLVGSIPLDKERRKQPAISFDNDNSA
IAEAFRKLRTNLHFLSVDNPPRVLVLTSSVPSEGKSTTTINVALALAEAGNNVVIVDGDLRRPTLHKYLDLVGAVGFSTV
LSGATTLNEALQKSRFSGLTVLTSGAVPPNPSELLASQAAKSLLAELRAEFDYVIVDSTPLLAVTDAAILAAGADGVLLM
VRSGHTKSEQIGHAVANLESVGAPLLGAVFTMVPASGSAAYSYSYYGESSPRQPAARGKHSSTGQTNPTPHEGD
>gnl|bykdb|A0A1Q4TN14 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. SWH-M1] (length=499 residues).
MNLQDFVKLLRNRWITVCVTVVLAVSTALAVSLLTTPLYQASTRLFVSTNSGSSSLSETYQGNRFSQERVKSYTELLMGQ
TLAQRTIDKLGLDMSAQTLQSNIKASAKLDTVLINVSVLDASPVRARDIANTLSDEFVGMVRELETPEDGAAAEARVVVE
QRASIPDSPVIPKTARNLGIGLILGIALGIGLAVIRDLLDNTVKDRETLEAITEVGLVGSIPSDKELRKQTAIAFATDNS
PLAESFRKLRTNLQFLAVDDPPRVIVVTSSTPSEGKSTTAINIALALAEADHSVVLVDGDMRRPMLHKYLELVGTVGFST
VLSGAVPLSDALQKTRFPGLTVLTSGAIPPNPSELLGSLAARNALSELRNQFDYVIVDSTPLLAVTDAAILAAGADGALI
MARFGQTRRDQLTHAVGSLKSVGARLLGAVFTIAPTRGGSSYGYGYLYYGDDAPKRSAANERRNTPTTSQPEQGALPQRD
STKDVHALGASKHRQGSGD
>gnl|bykdb|A0A1Q5CDD9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. CB01531] (length=485 residues).
MDVLSYLRLVRRHWWIVLVTVMVAVGAAALITVRTPPSYQGSVTFFVTTPSQGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVTESPLGLTADQVQRRISTSTEAGTVLLKATFTDTDQTRTLQTTEALSAKFVELVRKVETPPDGKSPPVKIEIVSG
PRVTSSPVAPQPVRNLVIGGLLGLLLGAGLAVLRGVADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGEAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGVDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVA
QQGRTSRSQVAAASRALHSVSVRLLGCVLNMAKVARADAYQYEAYKVVVPPAASSVPTDRAGVARRGEPEAPLGDRTQEL
TRLSR
>gnl|bykdb|A0A1Q5HLU3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. TSRI0369] (length=483 residues).
MDVLGYLRLVRRHWWIVLVTVMLALGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRNRIRTASTTGTVLLKATITDTDQTRALKTTETLATKFTELVRKVETPPDGKAPPIKIEVVSG
PRVTSNPVSPQPTRNLVMGGLLGLLLGAALAVLRGLADVRMRDGVALQRVTGSPLLGEIPYETGAKAAPLIVGAAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAANALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVLPPAAPSVPADRAGSRRGAKAVKGDRTQELTR
LSR
>gnl|bykdb|A0A1Q6F212 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacteriales bacterium 56_10] (length=506 residues).
MSRGNMAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYS
DSSVQDNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVNITAETGDAKQAS
DIANSVAESLSNVVEKSLYASGKESPVKLSVVQRAAEPISPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASD
LQDIINAPIMGRIPTDESLQSNKPIIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAA
LAENGAKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLD
AALQTYDYVIIDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYY
YYYYYDEDGKKSKHAHKNSRKKSKHN
>gnl|bykdb|A0A1Q7LXJ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium 13_1_40CM_3_66_19] (length=778 residues).
MLLRRRIGLVAGIAALIVFVVALFVVLERPVYRSTATVRLAYPRRALTVGVEDLPAKDQRSDPLLSLIELLRGRGIVGAV
VDSLALRLQPLGSRFGGSSRVVRAALRDVRVSPGAQQDTLRLTFGGDRVTAQGLQGEAQSPYGTPLAVGSVQFTIPSPPS
VKAGALAVRSREEVIDDVLKSLAVLRRKSTDIVDVTYSDPDPLLAQRVANLLVWVFQARDAGSAQEQARSRAEFLAAQLS
ATDSEMSIAQAELSAFRRQRLLGSSRDKLAVEQARLTALDARLGELEAERSVYESFLTKFNTSNDSLRLDVARDLSYTPE
LAADPVVSRISQQVLVYRTRLDSLTTGPLPAAPTNPDVLGLKALIRSTQEELVRAVRAHLTSIGAQSQALAALRSRTGAS
FQRLPATEAEGGRLERLVEDLRSTGDRIRQDYKNARMAEAISAGDARVIDWAPLPYKAAGIPPWAKLGLGLLLGLLLGCG
AAGLAESGNSLLMRPEELERALNVRDLGVIPPLLETSASRPLRRLPIPLFISASRRPEAASRGEQATWEVVADSAPLSSA
AEAFRLLYSGLLFGWGEGQRTILVTSAAPQEGKTVIAANLAVTFAREGVRVLLVDCDLRRPRLHRVFGVAPAPGLIELLK
ADRATLADSPGGPLRRPTKIAGLWLLPCGALPRRTSEVLQPHQLRRLLDDLSGHFDVIILDTPPVLVSADAALLAPLADG
AILVVRAGQTNRSSAERACQYLIAAGAHFLGAVLNDPAGELARYGKYYYSYGYPTPSD
>gnl|bykdb|A0A1Q8LIL7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudonocardia sp. Ae717_Ps2] (length=521 residues).
MTVQSFLRTLREQYVLVAVTVLIGVAAAGAVFAVQPASYTASTSLYVSAQAGREDAQQAYLGAQLSAERVRSYTNLITGS
RVLGGAAQALGSGESVEDLRQRVSATSPTDSVLIEVSATDSTPERAAQLADAVAAAGAGVVSDLERPTDPGAAALITLRV
VQPADVPTEPSSLSLPAMLAIGLILGAGAGILLALARRAVDTRVTSDAELVAATRSPVIGRVLADPGAEQHPLVVNHASS
GREAEAYRQLRTNIQFIDVDNPRKVVVVTSAMPGDGKTTTVANLAIALGRAGSRVLLVDADMRLPRVASLFGLDNSVGLT
RVISGQVPFDRAVQSWNGGVIDVLTSGPVPPNPSELLASASMRATIAHARDRYDMVLIDSPPVLSLSDTTVLAGTVDGAI
LVCRAKKTTRRQAESAAEALRLVGLAPFGSVLNRVDPAKSEVYGKYHRYHADGSAAAASTDSADGPSRAVTAPARAADTS
RIQQPSGRPPGQPQPPGSGGPQPWPRRLDPDHRPDHRPDHR
>gnl|bykdb|A0A1Q9SDR8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria sp. CNJ-770] (length=547 residues).
MEHLDAEREAPALDARDLLRLVRTHWRAITLITLLCTLLALGWTLIQPKIYSATASGLVVATGEQDLASALAGNNLAQSK
AVSYESLATARPVAVAVIDELGLDATPEELLPRIATDVPVDTPEIRITADAEDPTEAADLANAWVVALSEQAREVESQGD
EDAINRVAVQPLSNASLPLAPSSPNLKLNLALGLVGGLGLGLLYAFARYKMDRRIKSVEEIRDGFGVAVLGVIPTDERLV
DHREIIETGYSGGRGHHEFSEALRELRTNLSFVSVDNPPKMIVVTSSLPGEGKSSITANLAVAIASTGRNVVVVDGDLRR
PVMTDLFGLVPGVGVTDVLTGQVQVDEVLQTYDKFPNLQVLGAGRTAPNPTELLSSKAMHAMLEALAEDALVLVDAPPLL
PVTDAALLTASADGAIIVATAQKTTTDELSKALENLHQVHGHVLGVVLNRVPTTGADAGYYGYYGKSYYASSDDQPAPRT
GAQPVVPVAAAAPAASWKEPTAPAAEDAAPAPRAEQAKSEDSAEHETFGIEAWGRSGSSSGSTSTGH
>gnl|bykdb|A0A1Q9TIH3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kytococcus sp. CUA-901] (length=552 residues).
MTLDDILRLSRRHIITLVLSTLLGIALAAGWVALQKPVYTATATGVVQANAGTGTVGESLSGNSLAITKSKTYVTYFSSQ
PVAERVIEELGLDTSPSSLADRVTAKVEEETPNITVSARGDSPERAKELADTVVAETAEYVRELETQNMSAAPGQPEGEE
GQQDQAPATSILPLANAALPSSPTEPQPARALVLGGLAGLALGYVIAWFRHRQDTRVRTQEDIEEAAGGAPTLGLIPANE
ALASPERAVRNSDEVDFSTREALRQFRTNLRFVNVDHAPKSIVVTSARMGEGKSTISSNLAYLLAEGGERVILVDADLRR
PSVAGIFDIDSSVGLTQVLAGSADLADAVQPTEHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHRVILDAPPLLP
VTDAALLTTSTDGAVLVVAANDTRKEHVERAAANLRTVNARLLGAVINRASVSRLNRILYGEGYGYGATGTATATATAAT
RRARARSAAQSDRRRAPARPCGRVNDEEGPREQSRDPSCVPECGTPGAQPSTISRWPWRRPPRGRPRDGRAR
>gnl|bykdb|A0A1Q9VQM7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium sp. CUA-896] (length=527 residues).
MTLLRKRWLSVAVLTALGVLGGVVASLATTPTYEARSQVFVSVQGSSDSASDLLQGSSFTVRQVKSYTELATSPRVLDPV
VEELGLTDDAASLAERVRAESPMDTVLINVIATDESARLAASTADAVASSLADVVGELETPAAGGDSPVQISTVRSATVP
TEPSSPDLRLNLALGLVVGLALGIGLAVVRELLDTRVRSAPDVEAVTDAPVLGAIGYEADAPEHPLIVQESPQALRAEAF
RRLRTNLQFLDLGDGARTVVMTSALPGEGKTTTSINLAITLADAGQRVLLVDADLRRPAVARYMGIEGSVGLTTVLIGKV
GLRDAVQPWGSSMLDVLAAGQIPPNPSELLGSETMTALVGRLGEEYDVVVVDSPPLLPVTDAAILARRAGGAILVSGVGT
IHRQHVAGAVAALGTVGARLLGVVLNRVPLKGPGASAYGYSYYEYASEPAPTGRRRARPAHGSRRRPGPGRRGRSGAAAS
LPEQPLPARGQAGSRRAPELVPERVPVGTGPGGTASFDEVVAPREGR
>gnl|bykdb|A0A1R1I632 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus sp. ZS01] (length=454 residues).
MELQQYLQIVRRYWRSTLATVFLCIALAAGFTLLQSPTYSATSSVFITVESGGTAGELSQGATYAERTVGSFVSVATSAL
VLQPVIDELGLDLTVKQLASKLSVSTPAATSIIKVAAEDDSSLGAAELSNAVAASLQRSTEALAPAGPDGTRLVSATVID
AAVAPASPSAPRPAMNLALGALLGLLLGFGQAVLRSVLDTRVRSAEDLAQITDASVLAEIGHHEKPVAGRAAGKDGVQWA
SAESYRKLRTSIGFVGLGGERRSSMVITSSVEGEGKTETATNLARVLALAGERVLLIDADLRRPQVGERLRIDSQLGLSD
VLTGRGSLQDLIIDVAPGYLSVLPSGTVPPNPSELLGSEAMGHLLATVERQYDYVLLDAPPLLPVTDAVVLAAEAGGAVV
VSRSGTVRRQQLAAALDVLESADATLLGVVLNDVPASHSDTYGYYYTAKKPVSA
>gnl|bykdb|A0A1R1LV55 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tersicoccus sp. Bi-70] (length=474 residues).
MEPSEFVRVVKRYWVLVVVAGLLGAVVAGALAMTTRESYRATSSVYVSSQRGQTVQELVQGSTYTQDQVESFSRLATMPV
VLDPVIKKLGLDTTAQALDNQVSANIPLNTVIIEITVTSGSPGEAARIANAVSESLGTEVERLAPPGPNNRPSVVLNTVS
AATQPNAPFAPNTRLYVIAGLAIGILLAVLYVLIREVLDTRIRRDRDVHRVADTPVLASLARLANRRTASSVMITAPQST
AAESYRLLRTNLEFMEVDARLRTVVVSSPAAGEGKTSTAVALALAIAESGARVLLVDADLRRPGVADRLQIEASVGLSSV
LIEQATLQEAVVRVETIDVLPSGPVPPNPNQLLNSASAENVLTELGRSYDLIVVDSPPLLPVTDTLPLAKLADGTILVVR
AGATRRAQLRDAIEALNTINAKVLGVAINGVRLPRSGAYYRTDARSEPLWRRAVETMRPENDADTRERVDSTAG
>gnl|bykdb|A0A1R4J952 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus lylae] (length=450 residues).
MMELKQYSQIFRQYWISAMATLLACIGLAAAFTFLQTPKYTASASVFITVESGSSAGELSSGATYAERQVASFVSMADSA
LVLDPVVDELDLDMTTAELAEKVSVMAPADTSIIELKVEDEDPARAAEMVNAVADSLSNATSEVVPQGPENTELVTATVI
EPGVEADSPSSPNLLINLALGALVGLLLGCGQAILRSVLDTRIRTTDDVENISDAPVLASVDRNTASPEAKEQDGPSRGV
QWANAEAYRKLRTSIGFVGLGGERRSSMVITSSIQGEGKTETAVNLARVLAQAGERVLLIDADLRRPQVGPRLGLDSELG
LSDVLTGRVDLEDVLIDADGDYMKVLAAGTVPPNPSELLGSEAMAHLLALTERQYDYVILDAPPLLPVTDSVVLGDQTGG
AVVVARSGYARKQQLSDALGILKTADVTVLGLVLNDVPASKSGGYSQYYY
>gnl|bykdb|A0A1S1CQC5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp. HMSC062F03] (length=494 residues).
MTILEFFRTTRANLWLLIIGIIIGAAVGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDSNA
AATPSASSNTVRVIPLNNASVNPPLVSPNYQQNTLIGAVIGLVVVYTAIFLRRALDQRIRTRDDATKATGASILGVLPVS
EDLNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARSLADAGSPVILIDADLRRP
TVAKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPV
TDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDG
DKKSSKSKSSAPKA
>gnl|bykdb|A0A1S1WCJ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. WMMB235] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLGLGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIHTTATAGTVLLQATITDTDQTRALKTTETLATKFTDLVRKVETPPDGKAPPIKIEVVSG
PRVTSNPVSPQPTRNLVLGGLLGLLLGVGLAVLRGVADVRMRDGAGLQRVTGSPLLGEIPYETGARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVVPPAAPSVPADRAGTRRGAKAVGDRTQELTRL
SR
>gnl|bykdb|A0A1S2H0H4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBA15_001] (length=480 residues).
MELRDYISVLRKGWALILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVTTPI
VLLPVISSLKLDMTSDQLAKLVTADAPLNTTLIAISVNDTNAAQAADIANATSQSLTNVVQNIEATDANGESTVKLTRVK
EAQVPSSPVSPNVPVNVALGLLIGLAIGVGLAVLREALDNRVRTEADVEKISDKPIVGGIAFDNKAAERPLIVQVDPRSP
RAESFRTLRTNLQFVDIGTGARTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRAALDDVAAPWGRGNMVVLPAGPIPPNPSELLGSRAMQDLITTLEGQFDYVLFDAPPLLPVTDAAILAKKASGAIVV
VASGKTLKGQLAGAVQSLENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGIDEDVDRPKAPKEPRRGRLRTARGAER
>gnl|bykdb|A0A1S2HTT8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBA15_012] (length=482 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVQTPI
VLLPVISSLRLDMNADQLASMVSATAPTSTTLISITVTDTNPVQATEIANAVSASLTNVVQDIESTDANGKGTVKLTRVK
QADVPLAPISPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRTEVDVEKISDKPVVGGIAFDGKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVGEYMDVDGSAGLTDV
LIGRATLEDVAHPWGRGNLVVLPAGQIPPNPSELLGSKAMEELIATLEQQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLDDEQPPQPSAKPPKKARGKLGTLRRA
DR
>gnl|bykdb|A0A1S2HW50 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBA15_009] (length=470 residues).
MTLAQFVDLLRLRWLSVVAVVVLAAGLAAAVSAVQSPQYRASSAVFVSVASGASVNDLSQGNNFSAARVKSYEELALTPR
VLGLAARQLGLPADADLSRVVSAESTTDTVLITITATDTAPEQAAAIANAVADQLVKVVEQVERSTSAADSLVNLSVFQR
ASPPTVPFAPRLPVNIAIGVLAGLALGVAQAVLREVLDTRLRSFEALRRLTDASILGEFAVDDTIAKDPLVSFDNRYSTR
AEAFRQLRTHLTYTNLDGAAQSIVVTSATPGEGKSSTAVNLALMLAQNGSKVVLVDADLRRPTTGVYLGIESRVGLSTVL
TRQVDLDDAVQEIGADNPLHVLAAGRVPPNPSELLSSSRMVDLIRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
VSVQGQTKRADFTTAERTVAQVGARLLGLVVNRLPPQRRAKTYYNYEPSAPVSESPRRASRARLSSKDPR
>gnl|bykdb|A0A1S2HXH4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBA15_009] (length=479 residues).
MELRDYIAVLRKGWVFMLVLALIGVAAAAGYSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDELAEIVSSDAPLNTTLISITVDETDPKQAADIANATSESLTNVVQNIEATDADGTATVKLTRVK
EAQVPNTPVSPNVPVNVVLGLLVGLALGVGVAVLRETLDNRIRTESDVEKISEKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGSRTFVMTSSVESEGKSTTVANLAIALDNAGFRVVLIDADLRRPKVAQYMDIEGGVGLTDV
LIGRAEIEDVAQPWGRGNLVVLPAGPIPPNPSELLGSRAMQDLIAALEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDDDQAEPPKPPKRGRAAAARGAVR
>gnl|bykdb|A0A1S2I9A7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. MCBA15_019] (length=465 residues).
MRVTDILRALLASWLLVVVGLLAGGGVGYAVSAVATPTYVSSAKIFVAVRGQSDTTAMEIASGSNAAQQKIKTYTTLVTT
PRVLDPVVADRGPSVTVDDLASQVTASSPTASTLMTVAVTDVDPQRAAELANAVTESLRTVVTTELEPEFAPGVPSVTME
VVEPAAPALSPATPRTVANVALGLLLGLSAGAAAALARRALDTKVRGRDDLVVEGELAVVGEIPFDAQVRRRPVVARDGG
SSVHAEAFRMLRTNIRFLGAGSTARSFAVSSAGPSEGKTTTTANLAVSLAEAGLRTVVVDADMRRPNLAKILGIEGAVGL
SDVLIGRFELDEVLQTWGHDGLTVLPAGEVPPNPSELLGSGAMRALLDDLGGRYDVVVVDTPPLLSVTDAALISEMVTGV
LLVVASGRTRRAQVASALERLDAVGGTPRAAVLTMGRRRRADSRYYYYSETDAPRRPLRGLLRRA
>gnl|bykdb|A0A1S2J0P7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MMLR14_010] (length=482 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLVKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISTLKLDMSPDQLAGMITATAPTSTTLISISVDDTDPVQAADIANAASQSLTNVVQDIEATDANGTSTVKLTRVK
QAEVPSVPISPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTELDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVTNLAIALDSAGFRVILIDADLRRPRIAEYMEVEGNAGLTDL
LIGRAELEDVAHPWGRGNMVVLPAGPIPPNPSELLGSQAMQKLIERLEQEFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGIGEGDDSAAADRSPKPRGRKLAALRRA
EH
>gnl|bykdb|A0A1S2JF47 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MMLR14_014] (length=478 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDELAEIVTSDAPLNTTLISITVNDTSAKQAADIANATSESLTNVVQNIEATDAEGTSTVKLTRVK
EAQVPNSPVSPNVPVNVVLGLLVGLALGVGVAVLRETLDNRVRTESDVEKISDKPVVGGIAYDNKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPKVATYMDLEGNAGLTDV
LIGRATVEDVAVPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIAGLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGHTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDDDTPMPKPPKRGRIGAFRGAER
>gnl|bykdb|A0A1S2JHN3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MMLR14_014] (length=469 residues).
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGDSVTDLSQANTFSAARVKSYEALAVTPQ
VLGQAAKQLGLPGGGGLSRVVTAESKRDTVLISISATDGSPSQAAAIANAVTAQLVKVVEQVENEGAATTGLVHLSVFQP
ATAPSTPFSPRLTVNIAIGVLAGLALGIAQAVLREVLDTRLRSFEALRRLTQASVLGEFALDDSVVKEPLVSFGNRYSTR
AEAFRQLRTHLTYTNLDGDAQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
TRQVALDDTIQQIGADTPLHVLAAGRVPPNPSELLSSSRMVDLVRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRRSSRARRTPEDH
>gnl|bykdb|A0A1S2MX30 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. LCT-H2] (length=450 residues).
MAESRVSLRVIAGSLRKFWWLIVLCGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRVTGITDDPESAADLANAVAEQLITVVKDVAPKDPQGESTIT
AEVIDDAVVPEFQFTPSKPRDAALGGFLGGVLGLAAAVLIGVLDTRVRNEEALTQAGGDPVLGVVSKSPLLEARGIAVSQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTVSVNLAMTLAALRNSVLLIDADMRRPRAHEHAGIDGSV
GLTSVLLDEVEFEVAKHRVADTTLDILPAGTIPPNPAELLTSARMAQLLDFAAADYDYVVIDSPPTLSVADANLLATQTD
GVILVVDATKTRRAALEKSIKSLESGGARILGTVLNRARPDRHRSEYYSE
>gnl|bykdb|A0A1S2N0P2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia kristinae] (length=486 residues).
MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILSGDSAAQAKASAYLPLVTSGP
VAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATASSPQDAATLANNALQATADYVSDLEGRESAVKVTPLDDAQA
PDGPVSPSYRNYLLIGAAVGLVLAYLIAFLRKFADVRVRTTDDLENATEAGTLGILPKSSALDENTFLSDRADHQSEEAL
RQLRTNLRFVSVDAPPRSIIVSSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFSLDDAVGLSQVLSGQV
GPEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDGSLLSANVDGAILVSVCGRT
RKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGYGGYRSGYQAYYGQDGEGSGSGSSPAAGGKHGAKGRGRRA
RTSHSS
>gnl|bykdb|A0A1S2VWI2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. suis] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPSNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTSQSSPNIPLYLAVGLIFGIIVGVGVALLRDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVIVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVISSTSPSEGKTTVSANVAVALAEEGKSVLFIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASEATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGKKKARK
>gnl|bykdb|A0A1S2VZH5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. infantis] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAATFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQAAILDDSRPVVAA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSCNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVDQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELRSTATALQTAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A1S7B6R2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter flavus] (length=480 residues).
MDLGDYIATLRKQWIVIVVLALVGATGAYVFAQTMAPQYRSTTSVFVTTEAGNSTTELVQGSTYVQNLVQSYAVLASSPI
VLEPVINELGLDMSVQDLAEAVTADAPLNTVIVEISAVSTSADQAQSIAAAVANSLSSAVDGISPRDDQDRPAVQLTIIA
PAKLPIFAFAPNTKLLVAGGGLGGLLIGVLYAFGRELLDTRIRSLRELQQVSDTPVLTTVSRTRKGELPTQAMMRNPNGM
IAEGFRSLATNLSFADVDERITSVIVTSALPGEGKSTVALGLALAMTERAPRVLLIDADLRRPSIAGYTQIEGEVGLTSV
LVGDITLDEAVQSWGRGNLDVLASGGVPPNPSQLLASDAMRQLVDRAKESYDFVIIDTAPIIPVTDPLWLTHMTDGAIVV
SRYKSTRRQQLHRALETLDGANARTIGLVLNGLKQDETSSYYRYNSYRSAPDTVPLGPPAAGGATPAANDAARTPSMAGR
>gnl|bykdb|A0A1S7B8B7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter flavus] (length=468 residues).
MDLKDYLRILRHRWLLIVAITAGAAALAHGYTLITQPVYQSTGQLFVAVTGGDTVGDLNQGNAFAQSRVASYVILATGST
VRSTVAERLDLDPTSLVGTISASNPAQSVLIDISAVDSDPVAAARIANTAAQVLVDLVDDVESANEVGAADAPGDPTPVG
LTIVEQASPPRSPVAPNALQNLTVGVLIGLALGVGITLLIDVLDTRLRGRAAIEKLTDTSILGAFHTEPADTAQLILGST
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSVPGEGKSTTSANLALVLAEAGNSVLLVDADLRRPRQHEMFGLEDAV
GLTTVLTGRISLGDAAQAVDGAGRLAVLTSGELPPNPSELLGSAAMERALSEMERAYDVVIIDTPPLINVSDPTALSTLA
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEVARGEQSSSYAYYHRTAPTRRPRRTTA
>gnl|bykdb|A0A1S7BBR9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter flavus] (length=460 residues).
MELTDYLRVLRKYWVLIVALVLVGVAAAAAYSLAKTPEYSSSAKVFVSTQSSDNVSDLTQGNTYSQQRVKTYVNLVSTPI
VLQPVIAALELNITAGQLGGQVSAVATPDTTIIQITATSEDPVLAAELANTTAESLTGVVAKIESTDDGATSPVKLTRVQ
EANVPTTPGSPNVPLNLALGVLVGLALGVAFAVLRETLDTRIRNERDIEGLTEIPIMGGIAFDPKAKQRPLIVQADPKSP
RAESFRSLRTNLQFLDVSDQPRSYVVTSSIQSEGKSTTAANLAIALADAGHRVIIIDADLRRPKLATYFDLEGAVGLSDV
LIRRATLEDTMQPWGRGALTVLPAGAIPPNPSELLGSSVMQKLISGLEKQFDYVLIDAPPLLPVTDGALLARHTGGALVV
VAAGRTHKNQLKGALEALVHVNASVAGLVMTMVPTKGPDAYGYARYGYGAGYGYTEDVKA
>gnl|bykdb|A0A1T4WXV8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia sp. VKM Ac-2052] (length=478 residues).
MLDDLEGKAAEVELRDYIRILRKSWVLIAVLLFVGIGAAAGYSILQTPTYSSSAKVFVSTSGGSTVSDLQQGNTFTQQRV
KTYADLATTPIVLLPVISELGLKVSSSELAAMVTASAPLDTTLIEISVTNVDPALAAQIATSVSESLTLAVENIETSASD
AANVSPVKLTLVQHAEVPQKPVSPNIPLNIALGGLVGLALGVGLAVLRETLDNRVRNERDVELITDVPILGGIVFDAKAP
ERPLIVHDDPRSPRAESFRTLRTNLQFLDLGRENRAFVITSSIQSEGKSTTAANLAIALSDAGARVLLVDGDLRRPKIHE
YLGLEGAVGLTDLLIGRAEPEDVIQPWGKGDLFVLPAGKIPPNPSELLGSDALVNLIGEFNRAFDVVLFDAAPLLPVTDA
AILARTVGGTIVVCAAGRTHKNQLKGAFAALGNVDAPVSGLVLTMLPTKGPDAYGYGRYGYGYGYGYGDTSVPASVIS
>gnl|bykdb|A0A1T5J523 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter cousiniae] (length=480 residues).
MDLGDYIATLRKQWIVIVVLALVGATGAYVFAQTMAPQYRSTTSVFVTTEAGNSTTELVQGSTYVQNLVQSYAVLASSPI
VLEPVINELGLDMSVQDLAESVSADAPLNTVIVEISAVSTSAEQAQSIAAAVANSLSSAVDGISPRDDQDRPAVQLTIIA
PAKLPIFAFAPNTKLLVAGGGLGGLLIGVLYAFGRELLDTRIRSLRELQQVSDTPVLTTVARTRKGELPTQAMMRNPNGM
IAEGFRSLATNLSFADVDERITSVIVTSALPGEGKSTVALGLALAMTERAPRVLLIDADLRRPSIAGYTQIEGEVGLTSV
LVGDITLEEAVQPWGRGNLDVLASGGVPPNPSQLLASDAMRQLVDRAKESYDFVIIDTAPIIPVTDPLWLTHMTDGAIVV
SRYKSTRRQQLHRALETLDGANARTIGLVLNGLKQDETSSYYRYNSYRSAPDAGALGPAATGTAAPAANDSARTPSMAGR
>gnl|bykdb|A0A1T5JTI1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter cousiniae] (length=468 residues).
MDLKDYLRILRHRWLLIIAITAGAAALAHGYTLITQPVYQSTGQLFVAVTGGDSVGDLNQGNAFAQSRVASYVILATGST
VRSTVAERLDLDPASLIGTISASNPAQSVLIDISAVDSDPVAAARIANTAAQVLVDLVDDVESANEVDSAGALSDPTPVG
LTIVEQASPPRSPVTPNVLQNLAVGILIGLALGVGITLLIEVLDTRLRGRSAIEKLTDTSILGAFHTEPTDAAQLILGST
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSVPGEGKSTTAANLALVLAEAGNSVLLVDADLRRPRQHEMFGLEGAV
GLTTVLTGRISLRDASQAVNGAGRLAVLTSGELPPNPSELLGSAAMERALSEMERAYDVVVIDTPPLINVSDPTALSTLA
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRIDVARGEQSSSYAYYHRTAPTRRPRRTTA
>gnl|bykdb|A0A1T5KAP0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Okibacterium fritillariae] (length=488 residues).
MELRDYIRILRKSWLLIVLLTLVGVAAAATFSLLQKPMYTASTKVFVSTSSGQNVSDLAQGNSFTVQRVKTYSDLVTTPI
VLQPVIAALELNMTSDDLASAVSASAPLDTTLIEISVSNEDPVLAADLANAISQSLTAVVQDIEAPEAGSENTSPVKLTR
VQDAPVPQSPVSPKVPLNVALGALVGLALGLAIAVLRETLDNRVRNERDVAQLTDAPIIGGIAFDPKAKTRPLIVQADPR
SPRAESFRTLRTNLSFLDIGSEDRSFVVTSSVQSEGKSTTAANLAISLADSGARVLLVDADLRRPKVAEYMGLEGAVGIT
DVLIGRAELLDVVQPWGRSKLFVLPAGKIPPNPSELLGSSAMADLIALFNREFDAVIFDAPPLLPVTDAAILSKSVGGSI
LVVAAGHTHKNQLKGAVSALENVGAPISGLVLTMLPTKGPDAYGYGRYGYAYGYGYGDEETVDQSAVAEDGSRPAKPTPS
KKTTTKGA
>gnl|bykdb|A0A1T5L385 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter cousiniae] (length=460 residues).
MELTDYLRVLRKYWVLIVALVLVGVATAAAYSLAKTPEYSSSAKVFVSTQSSDNVSDLTQGNTYSQQRVKTYVNLVSTPI
VLQPVIAALELNITAGQLGGQVSAVATPDTTIIQITATSEDPVLAAELANTTAESLTGVVAKIESTDDGATSPVKLTRVQ
EANVPTTPGSPNVPLNLALGVLVGLALGIAFAVLRETLDTRIRNERDIEGLTEIPIMGGIAFDPKAKQRPLIVQADPKSP
RAESFRSLRTNLQFLDVSDQPRSYVVTSSIQSEGKSTTAANLAIALSDAGHRVIIIDADLRRPKLATYFDIEGAVGLSDV
LIRRATLEDTMQPWGRGALTVLPAGAIPPNPSELLGSSVMQKLISGLEKQFDYVLIDAPPLLPVTDGALLARHTGGALVV
VAAGRTHKNQLKGALEALVHVNASVAGLVMTMVPTKGPDAYGYARYGYGAGYGYAEDVKA
>gnl|bykdb|A0A1U4M0Y5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacteroides abscessus subsp. bolletii] (length=472 residues).
MTILDFLRMVRANLKLLLIGLLVGALLGFGYSLLQPRVYASSSTGFVTVGEDSGITDVISGSVAAKEKANAYLSLIKSSA
VADEIIAANPEINLTKGEIQGSLTASVDSNSALISVSATASSPEAAQALANSSLEAVAKVVNDLEGSSSVRVIPLEDAAL
NPSPTSPNTPKLVLLGAGLGLALVLAAVMLRRTVDTKLRTRDDATKATDAGVLGILPVSDEISEESILYTNSDHISQEAI
RQMRTNLRFVNVDNPPRSFIVTSAEPGEGKSTVSSSLARALADADQPTVIIDADLRRPTIAKKFKVDSKVGLTQVLAGQV
ELADAVQQFEDTQLFILPAGRIPPNPSELLGSDKMRQLIHELSQEFTVVIDVPPVLPVTDASLLSNSVDGVVLVGAVGKT
RKENLAEAAKNLRAVNAKILGLVINRAPRTGLGNSYYGFAYSSNGAYASYYGKDEQSKKGSKRSAKKAKSKA
>gnl|bykdb|A0A1U7MRN3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Ornithinimicrobium sp. CNJ-824] (length=508 residues).
MTVRDFLTTLRQRWRLVLATMLVVVAATALATLQTRPVYESSTRVYLLANNQSDSANVYNMPAAELATVIQVATSPIVLD
PVREQLGVAPGTMLNVSAERSGDTPLLDVRVRAHDAQVAADAATAVPQQLAAVARNFSPMLATSGQSVSAETIVPASVPN
RPIEPDPLRNLALGALAGLLLGVAFAVARQALDQRVREVRDIDALSDRPVLSSVPFRKDDDPHALYLDIDPFGPQAEAVR
RLRTNMMFVDVTTGKHSFVVSSTLPGEGKTTTAINLALAMSDAGTKVLLIDADLRHPSVATNMGLEGAVGLTTVLLGDAE
LEDVVQRWGGTNLHVLASGETPPNPSELLGSTKMQDLFDRLSEDYDFILVDTPPVLPVTDAMVIEKLTGGMLLVVASGET
RKRHLSEALRTLETTETHIAGFVLTKSPPQPSAYYNYYNGDDAPTRPEGARNRRRRPSRRDRRMQASRPHAEAAARARAD
RARLTESSEGLEFRARSRRRIDERADQS
>gnl|bykdb|A0A1V2NCT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. ALI-44-B] (length=488 residues).
MELRDYIRILRKSWLLIVLLTLVGVAAAATFSLLQKPMYTASTKVFVSTSSGQNVSDLAQGNSFTVQRVKTYSDLVTTPI
VLQPVIAALELNMTSDDLASAVSASAPLDTTLIEISVSNEDPVLAADLANAISQSLTAVVQDIEAPEAGSENTSPVKLTR
VQDAPVPQSPVSPKVPLNVALGALVGLALGLAIAVLRETLDNRVRNERDVAQLTDAPIIGGIAFDPKAKTRPLIVQADPR
SPRAESFRTLRTNLSFLDIGSEDRSFVVTSSVQSEGKSTTAANLAISLADSGARVLLVDADLRRPKVAEYMGLEGAVGIT
DVLIGRAELLDVVQPWGRSKLFVLPAGKIPPNPSELLGSSAMADLIALFNREFDAVIFDAPPLLPVTDAAILSKSVGGSI
LVVAAGHTHKNQLKGAVSALENVGAPISGLVLTMLPTKGPDAYGYGRYGYAYGYGYGDEETVDQSAVAEDGSRPAKPTPS
KKTTTKGA
>gnl|bykdb|A0A1V2NL87 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. CSI-V] (length=515 residues).
MELRTYWRIARTGWWMILLGILLGVLAAAGWVSLQKPVYTADAGGFVSASTGASSDTGSALIADNLAKSKVKSYIDVGTW
RSVADEVISDLGLQSQPESLVRQVKVTNPLDTVNIVVQASASTPEGARDLAQAWVRAMSSEINKLESATGGEALVQLVPG
DSAQLPDSPSSPNLRIALIIGAVVGLAAGVGAATTRYIVDRRIRSAEVVERETGHAVVGTIPFEKSFTSAGRLIPLDGGF
DEGARAKHYRVAEAMRELRTNIQFMDVDRPPRIIVVSSPLPGDGKSTTSANLAIILAASGQRVVLVDGDLRRPMVASIFG
LVEGVGLTDVLSGRADFEDVAQPVGLDGNLRVLGAGKLPPNPSEVLGSARMHDLLHRLAADATVIIDAPPLLPVTDAAVL
AHNADGAMIVASVGKTTVETLQRAIQNLERAGARCLGVVINRVPVRGRGKGYDDYRYAGDYYATSAASASVPLDTPAPTE
PRTARSTHVAVPASESPTTAGSTSRRSRREGRPSS
>gnl|bykdb|A0A1V2ZB83 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. VKM Ac-2630] (length=497 residues).
MRRSESVKEPATLELRDVLRLLRDHWLPIVAAILLGTLVAFGWSLTQKPRYEADSKGLVTVTVPDSGDGSQDLYGEQIAE
ALAKSRLTTYVPIASSRDVAEIAIENLGLDISPSALISAITVTPEVAAPVLSVTAEASTADGAQKLADAWVSAVATRIQQ
INAETGTGDTVNLSVIQDAALPSAPAFPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVD
KRLSETNRIIPEADTTDYVKADGKHALAESLRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTV
VVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIV
IVDAPPLLPVTDGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSE
KTGARTEPSSEPAPSAV
>gnl|bykdb|A0A1V3ZHZ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus rhodochrous] (length=462 residues).
MNVIDFLRVLRANRLVILGCAALGLALGLLYSLLQPTLYTATSTAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IASEGLDTVGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVKVTAMEDALAPAAPSSPDRV
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQAMQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMRDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVVRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAAARTGGDASR
>gnl|bykdb|A0A1V3ZKT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus rhodochrous] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGAVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLSGVGSSAKKERRSRRKARTRG
>gnl|bykdb|A0A1V4EHL7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbispora sp. GKU 823] (length=458 residues).
MDLLYYVRLIRRNWLLLLLSLITGVTAALVITANTPPKYVSTISMLVSGDDREGSISAALQAGALSQQRVQSYATLLTSR
RVVGQIAQGADIPSLQESITAESIPSTSLLRATVTDTDPRRAAVRANALGAAFSALVDQLERPSPKSRATVRVSVVDAAE
VPKVPVSPKPLLNVALGLLLALFAGIGTLVLRDRLDTTIKALETLQQVSRSAVLGMIGFERDARQHPLIVRSDGRSSRAE
SYRSLRTNLQFIEVDRQLKSLVVTSCLPAEGKSSTSANLAITMAHAGWRVILIDADLRRPRLATYLGIEGGTGLTDVLIE
RARLHDVIQTWGQPALSVLPSGRIPPNPSELLGSQGMRSVLAQLTEEYDMVIIDAPPLLPVTDAAALSAVCDGALLVVRH
GRTRREQVARAEELLSSINARLVGTVLNFVPAKRGDYYEYRYTGTEQETPKLPEPVEA
>gnl|bykdb|A0A1V4PL64 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia sp. i37] (length=469 residues).
MLVRASSPRFDGVVGSFGLRAIIGGWWIVVCGGLFGAVVGLAVCILQSPVYEASSTLYVTSGSGSDHASDAYQGSLASQQ
RVASYADLARSDAVLTKAIQLSDLGLNTAQAQRMVSAVGNPDTVLLVVTARSGDASESMRLANGVASAMSDYVADLETPA
SGGAPLAKLTVVSPAKLDPDPVSPRPSKNLSVGLLGGVLLGCLAAVFRAYLDRRVRSVEDVSELIPEPVLGAIEESEEIA
RSPLDFDSSGIAVEQFRRLRINLGFIDVDKPIRSLVITSASEGEGKTTVAVNLALALASAQKRVLLVDGDLRRPAIARFL
GLSSAIGLTGFLRGDEVEDQIQTSAHIGVDVMASGPEAPNPAELLGSDRLKLFITNVGRTYDFVVVDAPPIGPVADALVL
GEVVDGVLLVSRVGVGTKAGLRAASAELASSPSNVCGVLVNGVGRSTIGYGYYGSSELDRDVRARGSSV
>gnl|bykdb|A0A1V4PWI5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. AT1] (length=469 residues).
MDIRGFVRLLRSRWLIVCVTVLVAVLGAVTVTLLTTPLYQASTRLFVSTTSGASVNELYQGNLFSQQRVLSYTELLQGET
LAQRTIDKLGLDTTAETLSANVEATAKPDTVLIEVKVHDESPVRARDIANTLSDEFVAMSRELETPGDGSIPDARVIVEQ
RATVPAEPVVPNTKRNLLAGLGIGLLLGVGLAVIRDRLDNTIKDQETLEEITKTGLVGTIPLDKERRENPSIAFENDNSA
IAESFRKLRTNLQFLAVDNPPRLIVVTSSLPGEGKSTTAINIALALAEGEHNVVLVDGDMRRPMLAKYLDVVGTVGFSTV
LSGAATLSEVLQKTSTPGLTVLASGPTPPNPSELLGSLAAQKILSELRSQFDYVIVDSSPLLAVTDAAILATSADGVLMM
ARYGQTKREQLAHAVRNLEGVGVSPLGTVFTMTPHRGNDYYSYSYYSEDTPKQAAGTSGKRGRRRRSDT
>gnl|bykdb|A0A1V8PLX8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium catenulatum] (length=486 residues).
MTSAENTNVQQVVVEDDSEDGITLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGDDAGI
SQQYTGGTYIAGQITSYTTLATTETVLEPVIKDLGLDTSVKSLAEQLTVTNPTNTAFVNISAEDGDAQQASDIANAVAAS
MQNVIQNDLYSAADKSPVKISIVQRARVPESPSSPNKPLYLAVGVVAGLVLGVFAALLKDMLNTKVEETSDVRSLVGASS
LGSVPQDNSLGEKRPVLVSQPNGPIAEEFRRIHTNIEFLQTDKVAGKGQLLVITSAQPSEGKTTMSINVAAALAENGARV
LLIDADLRHPSVAHHLGLEGSAGLAHVLSGQMSPKDVVQNYWKPKLHILPAGKRPANAGVLLGSDTMRIMVEQALTQYDY
VIIDTAPLSVSNDGVVFGRWAKGLVLVTGRGVCEKKELKEISESLHAAKVPVLGFIFNYDDLKKTHSNSNYYYYYEDAPR
KKSHKK
>gnl|bykdb|A0A1V8Q806 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASQNGVDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIVGVFAALIKDLLNTKVEETSDV
RGIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADSKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A1V8RGW6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKGVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A1W1Y507 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter indicus] (length=492 residues).
MTLEDLWKLTRRQFVVIVVAALVGLLLAFVWMSLQPKVYTATAAGYVTAGGGSSIGESYSSQTLAQQKAQAYVTLFTNRR
VTEAVIKDLGLDATPQALAARITATVPPEGVSISVTASGPSPQEAKSIADSVVTAAAAEAKRIEESGPTRRVVQADGSTR
TVKSQAQVLIEPNESAILPTSPSSPNPTRILPLGLVLGLLVGYGIAALRHYNDTKLRHVDDVEETAGAGVLGVLPMSKDL
GSERGEARRSKAFHEREALRKLRTNLRFVDVDNQPRSIVVTSANQGEGKSTVAANLATVLAESGERVVLIDADLRRSAVA
RAFDLDGEVGLTEVLAGTITLADALQDTDVPGLQILAAGATPPNPSELLGSHRMEQLIEELSQRHFVILDAPPLLPVTDA
VLLTRSADGAVLVVAAGRTHREALDRAAASLRAVDAKVLGAVLNQASTKKVDRIRYGDVEYGHVTSYEKDYAAESDGAVS
RRDVKAARRGRT
>gnl|bykdb|A0A1W1ZPI5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Janibacter indicus] (length=471 residues).
MRFTEFVSVVTSRWRIIVACVVVAMAVAGVTTYLTTPVYTAQATVYLSVEPVQGRGDGTVVLTTSDLETYQSILGTPAVL
DPLRKDLGMVEGHPIDVEASVSSSTSIVDITARSSSPQEAAEVANGIGPHLADVAGDFSTVITSSNNRVVSRPLQPASVP
TSPTSPNLRNNLALALLGGLVLGVGLALVRHALDTKVRSEEDIKSLSDAPVLATLPAERTSGGVLLSIEHDPHGQHAESV
RRLRTNLLFVDVTTGRHSFVVTSAVPEEGKTTTAVNLALAMADAGTKTLLVDADLRSPSVADVLGIEGAVGLTTVLLGHA
TPDEVIHRWGASGVHVMPAGQVPPNPSELLGSQPMEDLFATLVEDYDFVIVDSPPVLPVVDAVIVQRLTGGILMVAGHER
TKKRDLASAMKQLSTVDAAVSGFALNFAPARGHRAYGYGGETKKQAAGRDPAIARKVVPEPGSPSGRGRPR
>gnl|bykdb|A0A1W6DP77 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium sp. TH-20] (length=487 residues).
MTLREYVTAVLRHWVVVAVCAVLGAVAGFGYARSEPKVYQSSASVMVVPEQGENAAELVQGSNYVQNLVASYAVLAQSPY
VLEPVIEDLGLDTTPARLARSVSVNTPLNTVVIEIAVSDTSPDRAREIADGISDQLALAVPELSPQLADRSSAVRITTIA
PARQPVNPIAPNTRMLMMVGLAAGLAVGVTYAVLRELLARRVVSSSSIQSMLGVPFLGEVVKVPSRTSLPAVVAAGPGSR
PSESVRTLVANVRFADVDHGRRVLMVSSGDAGEGKSSIAISLALSLAEDGSSVLLVDADLRRPSIARVTGLEGSVGLTNL
LVGDVAQEDIVLPWTRPNLFVLPSGVLPANPGVLLSSERLVAVIGDLRTHYDYVVIDTAPILPLSDPLWLSRAVDGVLVV
ARARKTRISRLRQTVDKFERGEADVIGIVLNDVKPRGRSAYYVNDSRVGVPGAFSREAGSPDVSPAATADDAAAPRAVED
ADRRTTP
>gnl|bykdb|A0A1W9Z322 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium bacteremicum] (length=487 residues).
MNLQDFVKLLRTRWITIAATAIVTLMAAVIITLITTPLYETSTRLFVSASDGATLAETYQGNRFSQERVLSYTELLMGRT
LAERTIEKLDLDLSADQLQDRVKASAKPDTVLIDVAVVDESPVQARDIANTLSDEFVAMVRELETPEDGTAPDSRVVVEQ
RAAIPESPVAPQPARNLAIGLGLGLLLGIGVAMLRDMLDNTVKDREILEEITGTGTVGTIPLDKDRRQHPSIAFDSDNSA
IAEAFRKLRTNLQFLTVDNPPRMIVVTSSIPSEGKSTTAINTALALAEAGNRVVIVDGDLRRPALHKYLDLVGTVGFSTV
LSGAVQLDEALQVSRFPGLSVLTAGTIPPNPSELLGSQSTKKLLAELRAEFDYVIVDSTPLLAVTDAAILATSADGALMI
TRYGSTKRDQLAYAVSSLQGVGAPLLGTVLTMTPARGSASYSYSYYGEAGNQRTVKPTRVKRNRPKDAHAAVPSEIPGVP
ADTSQKS
>gnl|bykdb|A0A1X0D907 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium elephantis] (length=484 residues).
MTVQEFAKLLRTRWLIICVTVAIAVLGAVVVNLLTTPLYEASTRLFVSTTSGATLAETYQGNRFSQERVISYTQLIMGET
LAKRTIDKLDLDMAAEDLRENVHASSKRDTVLIDVRVTDESPVRARDIADALSDEFVIMVRELETPPTGGGQPDARVVVE
QRASIPDEAIVPKTARNIAIGFALGVALGIGLAVLRDLLDNTVKDRHSLEEITEVGVVGSIPVDKERRKEPPIPFDSDDS
AVAEAFRKLRTNLQFLAVDNPPRVMVVTSSMPNEGKSTTAINIALALAEAEHNVVVVDGDLRRPRLHMYLDLVGSVGLST
VLAGQTTVDDALQKTRFSRLSSLTSGVLPPNPSEVLGSAAAKKVLDDLREKFDYVVVDSSPLLAVTDAAVLAAAADGVLI
IARFGETKREQLTQAVRHLHDVGAHLLGSVLTMTPARGRTTYSYRYYGDGRTGQPTTNKITSRGLLGFRSRSKSLHENSS
RNLR
>gnl|bykdb|A0A1X0H5J5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium monacense DSM 44395] (length=462 residues).
MLNFQDFVKSLRARWIVVSVATVIGVLAAVAVTMLTTPLYQASTRLFVSTTAGTSATEIYQGNRFSQERVVSYAELLNGE
TVLQRTIDKLGLQVDPESLQKRVKATAVPDTVLISVTVLDESPVRARDIANTLSDEFVSMVRSLETPEGRSQPDARVVVE
QKASIPEEPVVPRKLRNIVGGLALGLLLGIGIAIVLDVMDNTIKSRETLEELSGTGIVGTVPLDKQRRRQPAIDFEKDNS
GIAESFRKLRTNLQFLAVDNPPRVIVVTSSVPHEGKSTTAINLALVLAEAQHKVLLVDADMRRPMLHKYLGLVGSVGFST
VLAGSASLDEALQDSSTPGLSILASGPVPPNPSELLGSKAAKKLIGDLRARFDYVIVDSTPLLAVTDAAIVAAEADGALV
IAKYGQTKRDQLRHAVQSLRNVGAPILGAVFTMMPVRGSSAYSYQYGYYGEGTEKQDSSRKL
>gnl|bykdb|A0A1X1B7C9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Williamsia sp. 1135] (length=497 residues).
MTHSSQQTSSEGANPLRSTVAVVRRGWLVVLLITAICGGAAFTFSVLQEPIYRSTASLYVTSGSEANAQSAYQGSLASQQ
RVTSYTKLVSSEAVVGDALERSGLNISMADAKAAVTASTTPDTVLLNISVEDSNKAMAADLANAIADSMTTYVSTLETPS
GGGAPLAKMTVVTPAGESSNAISPQIFRNTLLAVAVGLLLGLVVVFFRDRYNNRVRGEQDLSAVAKSPVLASVPTDELLK
KQGLIDFRTGATLAAEAYRKLRTNLAFTSVDNPSRRIIVTSALPAEGKTTTAMNLAAALAETGKRVVLVDADLRRPQVYH
RTGGMGDVGFTNYLKGDGSMADLLQPSEVSGLQILASGPQPPNPAELLGSKKAGQGIENLSAMFDYVIIDSPPLLPVTDA
AVLAQWADGVVLVARANQSRVPDIGAAIEQLEAVQATLMGVVLTDVPTTGGAYKYGYYYTSSDVVKKPKFWSRIGKKKAH
QHQNIEVALEPTTTNAS
>gnl|bykdb|A0A1X1TB04 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium doricum] (length=473 residues).
MTIQELLKVLRARWILIAATIVVAVLAAVAVNLLTTPLYEASTRLFVATSSGDSVTEMYQGNLYSQQRVVSYTELVMGET
LAQRTVDKLGLDMTAAELQGNVKATSKPDTVLIEVTVTDESPVRARDIANALSDEFVVMVRELETPPGGLEPDARVVVEQ
QASIPDAPVVPKTARNIAIGLALGVLLGVGLAVLRDMLDNTVKDRETLEEVAGVGVVGSIPLDKERRKEPAISFETDNSG
IAEAFRKLRTNLKFLAVDDPPRVIVVTSSMPNEGKSTTAVNLALALAEDQHDVVIVDGDLRRPRLNTYLDLVGSVGFSTV
LAGSVSLDEAIQKTRFDRLACLTSGPIPPNPSELLGSMAAKKVLDELRSLFDYVIVDSSPLLAVTDAAILAANADGVLIM
ARFGQTKREHLMHAVGNLQDVGARPLGAVLTLTPARGGSSYSYSYYGDGGLPSSRPNRWPHGRNTTRTAPDSQ
>gnl|bykdb|A0A1X2YST6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=486 residues).
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE
EFRRLCTNLSFVENGNEDRPDNDHSNVIIVTSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKGNYYYYEESEVKNRRTKASTGDSSQNSASRNARRGRR
TTADGR
>gnl|bykdb|A0A1X2YSY1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=495 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
VDINQQSAGGSYISNRITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRGIVRA
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMSINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLNSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATAQVPVLGFIFNRADPKKVNSHSNYYYYYEDG
APRSSHRANGKKKRI
>gnl|bykdb|A0A1X2YTE2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASQNGVDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RGIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIEFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A1X2ZA33 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=525 residues).
MRSMYEGMRNSSRGKILVGKDIVNVRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLVTAIIAFVVVV
AGVSAYTFLAPAKYTATAQTMATYNASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQV
TVTNPTNTAFVNIAVVDGDPKQAADIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLG
IIIGVFAALIKDLLNTKVEETSDVRSIVRASSLGSVPMDASLDDKRPVLVSQPNGVIAEEFRRIHTNIDFLQTDRTEGVG
QLLVITSAQPSEGKTTMSINTAVALAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHI
LPGGKRPANAGVLLSSETMKLMVEQALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATA
QVPVLGFIFNRADPKKVNSHSNYYYYYEDGAPRSSHRANGKKKRI
>gnl|bykdb|A0A1X2ZAM7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=501 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASQNGVDINQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RSIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNINFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATAQVPVLGFIFNRADPKKVNSHSNYY
YYYEDGAPRSSHRANGKKKRI
>gnl|bykdb|A0A1X2ZG21 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTALQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASQNGVDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RSIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVE
QALTQYDYVIIDTTPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A1X2ZNC3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=501 residues).
MAAAESTAPQNGQVVVEPTETEDNGITLMDLFRIVRKHIVVGIITFVVVFAAVCAYTFLVPPKYSATSQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVAGLAGQLTVTNPTNTAFVNITAQSGDAKQSSDIANA
VAESLSNVVEKSLYASGKESPVKLSIVQRASVPLSPSSPKVALYLAVGLVGGLILGVFATLIRDLMATRVEEANDLQDII
NAPIMGRIPTDDSLKGIKPIIISSPAGRISEEFRRIRTNLSFTSKVEGSNARMIVITSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVADRLGLEGGAGLAHVLSGQATVKDVVQRYWKPNLHIMPAGPKPPNASMLLNSKTMTEMLDMALQT
YDYVIVDTSPMVVANDAAVFGAKSDGVVLVSGRDVTMKRDLKDIAVQLENLNVPVVGFVFNFEKERKTSNNDNYYYYYYY
DEGGKKSHKAPKSRSGAKRKK
>gnl|bykdb|A0A1X2ZYS4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=486 residues).
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE
EFRRLCTNLSFVENGNEDRPDNDHSNVIIVTSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTM
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKGNYYYYEESEVKNRRTKASTGDSSQNSASRNARRGRR
TTADGR
>gnl|bykdb|A0A1X3A4T4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=501 residues).
MRWGSAVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPTKYTATAQTMATY
NASQNGVDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RSIVRASSLGSVPMDASLDNKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMSINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATAQVPVLGFIFNRADPKKVNSHSNYY
YYYEDGAPRSSHRANGKKKRI
>gnl|bykdb|A0A1X3A989 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATY
NASQNGVDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RGIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIEFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|A0A1X6X4B5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium nesterenkovii] (length=596 residues).
MTIEDFLRLLLRNALLLTISLVLGAGLGYAYSHTKPEAYQASALGFVRGASGGTDPTQGDTTQAQYSKAQFFLPLFNTRA
VGEGIVEKLGLEQGPDAVAGSLTASLDPNAPIITVTATAGTPQEASDIANASIETVAAEANELEPGTGDQLVAYQTALAP
GPPISPDRRKFALAGAVAGLLLGLLLAWVRNRNDSRVRTVDDIRTTVAVPSLGVLPDSKDFARVKGGLLKDPKSFQAREA
LRKLRTNLRYADVDDPPRSIVVTSSAPGEGKSTVAANLARVMARAGQRTLLIDADLRRPVEAAQFGVDGSLGLTQLLAGT
VSIHDVIQADPRSKLSLIPAGEVPPNPSELLGSRRMHELVTELSREYFVIIDAPPVLAVTDAQLLARHTDGAIIVAVPGR
TRVEGISRAVESIRAVGGTVYGAVMNRASANRLTRLAYGDAEYGYSAYGYASKAYSYGYAKGQATGPEAEVEVAEDVLTA
PVPATVVPETPRPVTGAPASQGDAGAPRAYTAASSANDPEPQADALTDPVPAAVGDPGDEDDDGEDDDGEALYGPDGRAL
DVYGQDADPREDSTSGGPHQRRGRRAAAVDPDAASR
>gnl|bykdb|A0A1X6XXM6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Corynebacterium xerosis] (length=451 residues).
MYEPRVNLRFLIAAARKFWWLVVLTAVIGAVGMFGYSSTQTPMYKATTSLHFALNQGISATDLNQGSAYTQSQMLSFAQL
VTGSSVLEPVIQELDLETTPQELGKELEVSIPQDTVTMRITATTPDPEGSADLATSVGEHLIDEVQGVAPKNPDGTSTIT
AVIYDDAVPPTYQSSPDKKKDALLGGLLGGVVGAAAALLIALLDTRIRSEETLAEASRHPVLGVVSKSPLLSGRTIAMAQ
QPLSHTAEEFLRIRSALTYASVNSRVKVLLVTACMPGEGKSTVSVNLAMALAGKQDSVLLIDADLRRPRAHEYAGIDGSV
GLTNVLLQEVDVDIAKHRIRGTGLDILPAGKIPPNPAEMLTSQRMADLIAAMSDDYTYIVIDTPPVLSVADANLLAPVVD
GVVLAVDASKTRRANLVRSMKTLESGGARILGTVLNRARAGSRREKYYSET
>gnl|bykdb|A0A1X6Y1Z1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium faecium] (length=453 residues).
MSEQRMSVRSLISAVRKFWWLVVVLAIGGGAASFAYAASQTPMYQATSSLHFALDQGASAVDLNQGSAYTQSQMLSYAQL
VRGSRVLEPVIDELDLDTTPRELARLIQVTIPQDTVTLKITATTPGPESSADLATSISEHLIDEVQEIAPKNPEGGSTIT
VVVYDDAVAPQHQSSPDKTKAAGIGLGAGAAIGIAAALLIVALDTRLRTEEQLANVTGLPVLGAISRSPLLARRSIAMIQ
QRLSRTTEEFLRIRSALTFANIASEVKVLLITACKPGEGKSTISANLAMALAGEEESVLLIDADLRRPRAHEYAGVDGAV
GLTNVLSGEVDLDVATYRFPGTALDLLPAGTIPPNPAELLTSAAMKDLVTEMSRRYRYVILDTPPVLSVADANLLSPLAD
GTIITVDAQKTRRASLAQTTKILTGGGARILGTVLNRARPVRDREGYYSETRE
>gnl|bykdb|A0A1X7CQL8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium cellulans J1] (length=577 residues).
MELADYVLLLRKRWVSVVVVAALGLVLAGAYSLLATPSYAARSQVYVSVQGSDTTTDLLQGSNFTVRQVKSYVELATSPR
VLDPVVEELGLTDDAASLAQRVRADSPLDTALIDVTATDESPQLAAEVANATAASLATVVRELETPAGGGDSPVQISTVR
AAAVPDAPASPNLRLNLVLGLLVGLALGVALAVLRDRLDTRVRSTADVEAITDAPVLGVIGYEEDAPEHPLIVQESPLAV
RAEAFRRLRTNLQFLELGTAARTYVMTSSLPGEGKTTTSINLAITLADAGRRVVLVDADLRRPSVARYLGIEGSVGLTTV
LIGKVGLEDALQPWGNGNLDVVTAGQIPPNPSELLGAEPMTRLLERLRAEYDVVVVDTPPLLPVTDAAILARGVGGAIVV
AGAGSVHRHQLETALSALGTVGVRPLGMVVNRVPVKGPGANAYEYGYYAYTADEPSQGGAAGTRADRRTARAGRRHARAT
ASRGAATASGPWAPVAAGDESEPGGPGAAGTAPVPAPPHPAGDAATVPAPPDAAGAPSARARTGARGETVAVLPPPPPAA
LEETASFDDAVLPRERR
>gnl|bykdb|A0A1X7IN36 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia pratensis] (length=483 residues).
MLYDLEGKADSVELRDYIRIFQKSWVLIAVFLFLGIGAAAGYSIIQTPKYSSSAKVFVSTSGGSSVSDLQQGNTFTQQRV
KTYADLTTTPIVLLPVISELGLDLSSTELANMITASAPLDTTLIEISVTNVDAALSAEIATAVSENLAKAVENIETASNE
TGAESPVKLTLVQHAEVPQTPVSPNVPLNIALGALVGLALGIGLAVLKEALDNRIRNERDIELISEAPILGGIVFDPKAS
ERPLIVHDDPKSPRAESFRTLRTNLQFLDIGRENRSFVITSSIQGEGKSTTVANLAITLADAGARVLVVDADLRRPKLHE
YLGLEGAVGLTDLLIGRAEPSDVIQPWGKGDLFVLPAGKIPPNPSELLGSEALVTLLAEFNRAFDIVLFDSAPLLPVTDA
AILARLVGGTIVVCAAGKTHKGQLKGALANLSNVDTPVSGIVITMLPTKGPDAYGYGRYGYSYGYGDTGEPTESSPKVVA
SRP
>gnl|bykdb|A0A1X7P790 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter oskolensis] (length=484 residues).
MELRDVLRLLRDHWLAIVAAILLGTLVAFGWSLTQKPRYVADSQGIVSVALADSEQSQAVYQQQIATTVANSALKTYLPI
ATSRDVAQIAIENLGLDVSASTLIGAITVQAETDAPVMKVTASASTAEGAQKLADAWVSAIATRIQQVNAETGVGDTVSL
SVVQAASLPSSPAYPNLRLVLAVGALVGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVPEA
DTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAK
SFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDG
AILTARTDGALVVISAGKTTTDELAKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSERSGARPEPAAEPT
PSAV
>gnl|bykdb|A0A1Y0HXU8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulosimicrobium cellulans] (length=553 residues).
MELRDYLVLLRKRWVTVVVAGALGLALAGAYSLLTTPTYSARSQVYVSVQGSDSTTDLLQGSNFTVRQVKSYIELVTSPR
VLDPVIEELGLADGAGSLAQRVRADSPLDTALINVTATDESPQLAAEIANATARSLAAVVGELETPAGGGDSPVQISTVR
AASVPASAASPNVRLNLALGLVVGLALGVAVAVVRELLDTRVRSTSDVEDVTTAPVLGVVGYDEDAPEHPLIVQESPQAV
RAEAFRRLRTNLQFLELGPAARTYLMTSALPGEGKTTTSINLAITLADAGQRVVLVDADLRRPSIARYLGVEGSVGLTTI
LIGKVSIEDAVQPWGNGNLDVIASGQIPPNPSELLGAAPMAQLLDRLRAEYDVIVIDSPPLLPVTDAAVLAKGVGGAIVV
VGAGTVHRNQLETALSALGTVGVAPLGIVVNRVPVRGPGAGAYEYAYREYTADEPSPSPGTTRRGTRGRAGGARRHARRP
APQGTTSPTGPGGWARVGDGGPSGAGPSDDAAGGAAPDTARGDGDAADETAVSVGRPVRAGTFDEVVLPSERQ
>gnl|bykdb|A0A1Y1RLX5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia nasimurium] (length=472 residues).
MTILDVVRMLRVNFKFLLAGLIIGALLGYGYSLTQPKIYASSATGYVTVGEGAGIGDVISGSAAAKEKAAAYLAFVNSGP
VADEIIAANPNLNLTRGEIQGNLTATVDENSALIRVSAQGSTPESAQALANSSLQAVAKVANDLEGTSTVRVIPLEDATL
NSGPISPDTRKLMLAGGGAGLALVLAVILLRRTIDTKLRTRDDATKATESGVLGVLPISEELTEENILRAHSDHVAQEAI
RQMRTNLRFVNVDRPPKSLIVTSAEPGEGKSTVSTSLARALADAGQPVIIIDADLRRPTIAKKFKIDSKVGLTQVLAGQV
ELADAVRQFEDTQLFILPAGRIPPNPSELLGSDKMRQLISELSGEFTVVIDVPPVLPVTDAALLSNSVDGVVLVGTVGKT
RKENLAEAADNLRKVNATLLGVVINRAPRKGLGNSYYGFGYSSNTAYSSYYGQDKDGHKKDSRRRKKAKSGS
>gnl|bykdb|A0A1Y2KJJ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. LEMMJ01] (length=450 residues).
MAESRVSLRVIAGSLRKFWWLIVLCGVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRVTGITDDPESAAELANAVAEQLITVVKDVAPKDPQGESTIT
AEVIDDAVVPEFQFTPSKPRDAALGGFLGGVLGLAAAVLIGVLDTRVRNEEALTQAGGDPVLGVVSKSPLLEARGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTVSVNLAMTLAALRNSVLLIDADMRRPRAHEHAGIDGSV
GLTSVLLDEVEFEVAKHRVADTTLDILPAGTIPPNPAELLTSARMAQLLDFAAADYDYVVIDSPPTLSVADANLLATQTD
GVILVVDATKTRRAALEKSIKSLESGGARILGTVLNRARPDRHRSEYYSE
>gnl|bykdb|A0A1Y3F8X2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSSNVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDQFGLDVSSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGESLKTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A0A1Y3M0W1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter agilis] (length=486 residues).
MELSDYLRILRRNWLLITVCAVVGLLLGAVASFAVRPTYTAQTKLFVATQSSGSVQDLQQGNTFTQARVQSYVETVTEPL
VLQPVVDSLGLDMSSAELADKVSATADLNTVIITIAVEDTSPVQAAAIAQATADSLVDSVGGLESPAEGGNSPVNLTVIT
PAIAPAQPSAPNTLLNLALGLLVGLALGLGAAVLRTALDTKVRGESDLRRISDAPLLGGISFDADAQKKPLLTQAPTQSP
RAESFRQIRTNLQFAHVSHKSKSVLVTSSLPGEGKSTTATNLALAIAQGGQSVVLVDADLRRPRVNEYLGLERNAGLTTV
LIGRADLEDLLQPWGTDELYVLTAGQIPPNPSELLGSEAMKNLIARLEQKFDAVIIDAPPLLPVTDAAVLAQQVGGVVLV
VGSSKVNLPNLQKSLQNLEMVNAELLGVVINLLPSKGPDAYAYNYYSYDSKVTLPEAEAPATTRSSPKSSRSDFDERIFG
LRSQEE
>gnl|bykdb|A0A1Y5PAX5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][uncultured Mycobacterium sp] (length=483 residues).
MNLQQFAKLLRTRWVTIVVTILVAVLGAVAFNLLTTPLYQASTRLFVSTTAGASVTEIYQGNLFSQQRVKSYAELVTGTT
LAQRTIDKLNLDMSADSLRDKVKATTGPDTVLIDVDVLDTSPVRARDIANALSDEFVNLVRELETPEKSATPNARVVVEQ
RASIPDHPVIPKTARNLAFGLALGALLGIGLALLRDLLDNTVKSQEMLETITGTGVVGYIPLDKDLRKTAAIAFDSDNSG
TAEAFRKLRTNLQFLAVDNPPRLIVITSSSPSEGKSTTSINVALALAEAEHNVLLIDGDMRRPSLAKYLDAVGSVGFSTV
LSGAAPITDVLQKTRFPRLTVMTAGPTPPNPSELLASHAAKKLLADLRSQFDYVIIDSSPLLAVTDGAILAANADGALVV
ARSGHTRREHLTHAVGSLNDVGATILGAVFTMVPTRGGQAYNYYSYGYGGEPSDQVSQSALATGVTEADAKAGTAKSADE
KSA
>gnl|bykdb|A0A1Y6E6V4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agreia sp. VKM Ac-1783] (length=466 residues).
MELRDYARILQKSWVLIAVLLFVGIGAAAGFSILQTPKYSSSAKVFVSTSGGSSVSDLQQGNTFSQQRVKTYADLATTPI
VLLPVIAELGLDLSSADLAAMVTATAPLNTTLIEIGVTNVDPALASQIATAVSESLTKVVEKIETPADTGSTTSPVKLTL
VQHAEVPQVPVSPNIPLNIALGGLVGLVLGIAIAVLREASDNRIRSERDVEAITDAPILGGIVFDSKAAERPLIVHDDPR
SPRAESFRTLRTNLQYLDVGRESRSFVITSSIQSEGKSTSAVNLAIALADAGSRVLLVDADLRRPKIHEYLGLEGAVGLT
DLLIGRAEPEDVIQPWGQRDLFVLPAGTIPPNPSELLGSDALLKLVSEFNRAFDVVLFDSAPLLPVTDAAILARTVGGTI
VVCAAGRTHKNQLRGAFTALANVDAPVSGVVLTMLPTKGPDAYGHGRYGYGYTYGDALLPGEIASK
>gnl|bykdb|A0A1Y6EYH1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. VKM Ac-1784] (length=468 residues).
MDLKDYLRILRHRWLLIIAITAGAAALAHGYTLITQPVYQSTGQLFVAVTGGDSVGDLNQGNAFAQSRVASYVILATGST
VRSTVAERLDLDPASLIGTISASNPAQSVLINISAVDSDPVAAARIANTAAQVLVDLVDDVESANEVGSTGALGDPAPVG
LTIVEEASPPQSPVAPNVLQNLAVGILTGLALGVGITLLIEVLDTRLRGRSAIEKLTDTSILGAFHTEPTDAAQLILGST
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSVPGEGKSTTSANLALVLAEAGNSVLLVDADLRRPRQHELFGLEDAV
GLTTVLTGRISLGDAAQAVNGAGRLAVLTSGELPPNPSELLGSAAMERALSEMERAYDVVVIDTPPLINVSDPTALSTLA
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEVARGEQSSSYAYYHRTDPTRRPGRTTV
>gnl|bykdb|A0A1Y6FE39 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. VKM Ac-1784] (length=480 residues).
MTVHDYLGAIRKQWAVILILALLGAAGGYVYAQSMPSMYRSTSSAYASAAYGESTSELVQGSTYVQNLVQSYALIAKSPY
VLQPVINDLDLDLSVAQLARTVTADTPLNTVVVDISVVNSDPELARAIADGIAKSLSDAVANISPKDAAQAASVQLTIIS
PASAPVNPVSPDVRLITGIGGVIGILLGLAWAVLRELVDTRIRSNSDIDLVTDLPLLAEIGRTSRDRRIAQVIRSSPNGI
TAEAFRSLCMSLAFADVDKPVASMVVTSALPGEGKSSVSVGLAMSLAESSGSVILVDGDLRNPSIAEYTGLDGTVGLTSV
LLGDASLDEAVQPWGVPGLDILVAGAVPPNPNQLLASDTMRSTLDRLKSQYDFVVIDTSPVIPVTDPLWLVHETDGAIVV
VRERRTKRQQLQKALSTLDSVGARVLGVVANDVRHHERTTYYTDDENARPRQSAPVLGARRRRPVAATTTEPTPETAGER
>gnl|bykdb|A0A1Y6FHM1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. VKM Ac-1784] (length=460 residues).
MELTDYLRVLRKYWVLIVALVLVGVAAAAAYSLAKTPEYSSSAKVFVSTQSSDNVSDLTQGNTYSQQRVKTYVNLVSTPI
VLQPVIAALELNITAGQLGGQVSAVATPDTTIIQITATSEDPVLAAELANTTAESLTGVVAKIESTDDGATSPVKLTRVQ
EANVPTTPGSPNVPLNLALGVLVGLALGIAFAVLRETLDTRIRNERDIEGLTEIPIMGGIAFDPKAKQRPLIVQADPKSP
RAESFRSLRTNLQFLDVSDQPRSYVVTSSIQSEGKSTTAANLAIALSDAGHRVIIIDADLRRPKLATYFDIEGAVGLSDV
LIRRATLEDTMQPWGRGALTILPAGAIPPNPSELLGSSVMQKLISGLEKQFDYVLIDAPPLLPVTDGALLARHTGGALVV
VAAGRTHKNQLKGALEALVHVNASVAGLVMTMVPTKGPDAYGYARYGYGAGYGYAEDVKA
>gnl|bykdb|A0A212TD96 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kytococcus aerolatus] (length=541 residues).
MVRATHPRRQEQRNSGTNGLECTERLGRGADSPNPPEHVLTLDDILRLSRRHIITLLLSTLLGIALAAGWVAMQTPVYTA
KATGVVQASSGGGTVGESLSGNSLATTKAQTYVTYFNSQPVAERVIKEMGLKDSPNALASRITATNEQETPNIEVSAKGG
TPQEAKELADTVVQQTAEYVEELETKNISSTGVYPGAPEPEDEEGKEAEEQKKVPATSILPLASAQLPQSPSEPQPARAL
VLGGLAGLALGYVIAWFRHRQDTRIRTQEDISEATGGASTLGLIPANEALSSPERAVREGGDVDFATREALRQFRTNLRF
VNVDHAPESIVVTSARMGEGKSTISSNLSHLLAEGGERVILVDADLRRPSVAGIFDIDSSVGLTQVLAGTADLADAVQPT
EHPNLTVLPAGTIPPNPSELLGSQRMRDLIATLTQTHRVILDAPPLLPVTDAALLTTSTDGAVLVVAANDTRKEHVERAS
ANLKNVNAHLLGAVINRASVSRLNRLLYGEGYGYGSYGYGYGYGYGDADSKKKKGRKNKRK
>gnl|bykdb|A0A220UD04 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. VR2415] (length=451 residues).
MSDSSAGLPVLLAALRKLWWVVVIGGVLGAAGSLGYSSLQTPLYTATSSLHFSITQGSSATDLNQGASYTQSQMLSYAQL
VEGSLVLQPVIDELDLGTTPSELSRSISVSIPRDTSTMKITATATDPQRAADLAAASSEHLIEVLDEEGSKTADGSPSVT
VAIYDEAVPPRYQSSPDKTRDAFLGGVIGGMVGIATALLIALLDTRVRNEEILVEAGGDPVLGVVSKAPLLQARTLAVAL
EPLSRTAEDFHRIRSALTYANVSSRVRVLLVTAGMPGEGKSTISVNLAMTLAGLRHSVLLIDADLRRPRVHFHAGIDGSV
GLTNVLLEQVSLDVATHSVSGTTLDVLPSGEIPPNPAEILTSHRMEELIAAVSSKYDYVIIDTPPTLSVADANLLAPIAD
GVLLVVDATKTRRAALAESMKTLEMGGARILGTVLNRARPVRRRDSYYAES
>gnl|bykdb|A0A221NN83 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. YN] (length=509 residues).
MELTDYWKVLRAHWISVIAITVLGGIVAFGWTLTQTKVFSADASGIISVGVNKDLGTAMAGESYSKSRAKSYLDVAKSRS
VAETVIQDLKLQGTSPEQLISRISAQNPQDTATLKFSAQASSPEDARDLAEAWVRAVGEQVAELEKGSNSSETSIVSFRS
LDAAQLPTTPTSPNTRLALMIGVVAGLLLAIGYALLRNIFDRRVRSAVQLEAETRVAVIGTIPFHNNFDGVNRLVLSRGG
NDLENKNHQDYAVAEAIRELRTNLQFMDVDEPPRIIVVTSALPGEGKTTVVANLAQTIAASGQRVVVVDGDLRRPTVAKT
FGLLTNVGLTDVLIGRATLNDVLQPWGESGDLFVLGAGSVPPNPSELLGSNVMRTLLEDIAKHAIVLVDAPPLLPVTDAA
ILTARTDGALVVSRAGKTTYDQLKRALQNLERVKGRPLGLIINGVSRKSSKGEDYGYQYYTYYNRKDTGEEAAKANHVPA
AESTPVAATEQVQMTDQRRGRRRESTNAL
>gnl|bykdb|A0A221R7G9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sinomonas sp. R1AF57] (length=581 residues).
MGRTVFVEHETDARKGGELTLGDYVAVMRRHWRGILLITTLATAMAFGWYLVQPRQYAAEASGVVITVGGDNLSLSLAGD
NLAKSRAKNYKSVAESALVAERVARDLGLDRSPQDLASAVTVTVPVDTTEIRVSAKSTDPSEAQRVADAWISALSAQVSE
IERSAGQTGLPPVRVVTLSRAVLPTEPVSPNIRLTLGVGVVGGLLLGFAYAMVRNHVDRRIRTAAEVERQFAVPVLGTLP
VDHDFGPQAEVIGADQWGSALGEAFRELRTNLQFVDVDQPPRVILVTSAMPSEGKSAVVANLAAGMVAAGEKVVVVDCDL
RRPMVDKVFDLVPGVGVTDVLSGRADIEDVRQGWAGSENLTLLGSGRIPPNPAELLGSRAMQALLRRLAEDAIVLVDAPP
LLPVTDAAVLSRAVDGTLVVARAGQTTTDQLERAFGNLSRVNGRILGVVLNCVPTAGPESSAYSYYGTYGEDAPGGRTKG
RRPSVKRKPSRAPRRPVDAPNAELHEPAPDSRPLAEAPYEPAYRPAAVPGHYADRQDRHAPASERLGQLADADDRLGEDG
LADDLWLPAQLRDQRGRRSAG
>gnl|bykdb|A0A222XDN9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas sp. PSBB021] (length=601 residues).
MEIGDYLTALRKRWWAVALLAVLGAGLGYVQASGATPLYRSTAKVWVSLAQGSDVTELVQGSTYTRNLVESYVQLTTVPL
VLEPVIQDLGLTVTSRQLAAVVSAEAPMDSMIIEISATSRSATRAADIANAVAGQLATAVEQLTPTSAEGQATVKITLVG
PATPAAAPFAPNTKLLVATGGAVGLGLGVLVALAWVRLDTRVRTTRDLPDGRVVLGEVPHDRAVTRDGPRSVLDQPRSAL
AEGYRRVRANLDFLDSTEPVRGFVVTSTLPGEGKSTVSVSLALALADTGRRVLLIDADLRRPNIANVLGIESAVGLTTIL
ARRATLEQVTQQWRLENLHVLPSGPVPPNPTQLIDSAAFADLLAHAQEVYDMVIVDTSPLLAVSDGAVLARRTSGAILVA
RARKVSRRELAESLDELDALGADCLGVVLNGAQRRRRATSYGYMEPTGRRLAPPRRPRRRGGRPDVPVASAPSRHTHDET
PDRAPVSPTRPPVEPAGPSLEMDRLSVEPTRQYVGSVRSPAAPDRERAAGPEETRAPVTTADATETTEPTRAPSSEPTPL
PTPEPEPELEPEPTHARSSEPTGAPEPSRASTEGAHSRADA
>gnl|bykdb|A0A225CHC3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. tessellarius] (length=459 residues).
MTLHEFTALLRRLWYVVVAATLVGGGIAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDRTPQELARAVSVTTPQNTVIMEISVTEESPADAAEIANAVATSLRDTAEAYAPKGAEGSPTVSVRVIQ
EAPEPLSQSAPNGRTNTLAGLLLGLLAGLLGIALVRLLDTRVRSAETVAHLTSAPLLGALERERGVTGLAMALRPLSTAA
EGFRQLKANLRFVLLGDRASSIVVTSSIPGEGKSTVAANLALSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEEVVQPWGDGTLDVLTSGEIPPNPSELLASTRMEELVARAREAYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRGQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRVETEQAGRAGRRRTPAR
>gnl|bykdb|A0A225CJH5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. tessellarius] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDQFDLDMTSRELAETVRAAAPLDTTIIDITVKNESRQDAATLADAIGASLTTVVGQLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGAIIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGTKTKAPIEKIKA
>gnl|bykdb|A0A229HLR2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. KBS0714] (length=465 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHDKYLQGTGKGGKKSRRAARAKKG
>gnl|bykdb|A0A229VWJ7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium vansinderenii] (length=492 residues).
MEKNDAEEKDVISIDIIGAVRKHLAALIVTFVVVTAAVCGYTFMQTPQYSATAEVFASYKGVSSDNNQNTDMTTRSYATS
YINTQLQSYPQLVKTEAILQPVIDEMGLNTTVSALAGKITAQQPTDTFLVDITATDPDPKVAADLANNVAKSLKDQVSST
LYSSDASESSPINLSIVQSAQVPTTHSSPNIKMNIAIGIVGGLVLGLILAIVLDLLDHKIRQASDLQDILDVPVLGALTR
NDVYAGKAPVVISRPASREAEEIRRLRMNLTYVMPDKGEHSNLIVITSAGVSEGKTTTSVNLAAAYAEAGKKILLIDADL
RNPSVAKALSMNGTVGLSQLLTYQVKSTDAIQQYWKENFHVLPAGKRAPNPGILFNSKAMKSLLDQVSGIYDYVIIDTAP
LKVANDAAVFVKEGATMLFVSGLGHGEKKDVRAAAEELETLDVTVAGAVLNFSEEEKSDDNYYYYYSDGEDGKSRRKRRS
SSKKTSRKSKKS
>gnl|bykdb|A0A229W018 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium vansinderenii] (length=471 residues).
MTVSDLLRALKRHWLLEIILFVVVVGGMAGYTFTVTPMYTTQAQLMAKNSDGAMTTGAASGTASPLTGYAQLVQSDAVLE
PVVDNLGLHTTVTNLRNNVSAYVSDGSAFVNMTVTYTDPNDSVAILNELVKQLNKQITSDGSSGIQLSIIQKPVVPSAPS
SPNVKGNMVIGVVAALIVAAAGAVIREMSDNSVRTKADIQAIITAPILSSVPKSPTLAGRTPAVIVKPRGHAAEEFRRLA
TNLSFVRDNRGTRSNVLVVTSAMPGEGKTTISVNLAAAFAEKGESVLLIDADVRHPSVAKGLGISNGVGLIQMLTNQVDA
QTAVQKYWKPELQVLPVEDNEAAASVILSSSVMENMIDQAAKHYDHVIIDTAPIQVSNDASLFARNGATLLLVVSQTVGS
KKVLRDVARELKVSRAKISGVAFNRVAHEHSRKGNYYYYYEESEKQAKSGTKDVKAKSDGKRSARTTSSNK
>gnl|bykdb|A0A239CM55 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Streptosporangium subroseum] (length=474 residues).
MDLLYFARLARRNWLLILFSLVLAVSTSLIVTARMPTKYVATISMLVSGYDREGSLSTAIQAGMLSQQRVQSYANLLPSR
RVVSQITTGDDIRRVQENITAEAIPGTVLLRATVTDTDPARAARLANALGGAFTRLVDEIEQPLPTRKRKHAKKDGEKDG
HSSRKNDQPNVKVAVVDPADVPRDPISPRPLVNLALAVLTALLIAMASLVLRDRMDTTIKASEVLHEASKSSVLGIIGYE
RDARRHPLILRDRGRSSRSEAFRSLRTNLQFIGVDRQPRSLVVTSCLPGEGKSSTSANLAITLAQAGWRVLLVDGDLRRP
RIPNYLGIEGATGLTDVLIGRARLENAIQIWGESDLAVLPSGQIPPNPSELLGSNGMRTLLSGLTERYDIVIIDAPPVLP
VTDAVALAAICDGALLIARYGKTRREHVIRAVEVLTSINARLVGTVLNFAPAKSNRYYGCEYDAKAEVTPRVSV
>gnl|bykdb|A0A239GWK7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus pulveris] (length=469 residues).
MSLNQFLTVLRRRIRWVLSVFVLCLVAAVVLSAFLPRRYEATAELYVSVTTAESVDDLAQGARFTREQMASFASLALTPR
VLEPVAERFDVSSGAQGLERRVSVQASDTTVVIELTVADADPDRAADLANAVATRTIDVVEDLAPESPVGGDSAVRVTVV
RPATAPESAASPNTVLNVAAGTVLGLSLGILLALAREALDTRVRDADVLAQLTPLPMLGRVASWSERQGRVLVATAPHSP
AAESIRQLRTNLQFLRVARDPAGAGRAGAEVVSVTSALSGEGKSTVSANLAVALAQTGARVLLVDADLRRPTVADVLRIE
GGVGLTTVLAGDAGLADVVQEWGAAGLHVLPSGALPPNPTELLASPAMRWLVDQLRQAYDYVVVDTSPLLPVADASVLAG
LVDGTVVVANVTRVRRAQLRQALGNLEQVSARVFGVVLNQVRRDEEPYSYRQWDTARGTAPAAAAAAGS
>gnl|bykdb|A0A239WF29 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium granulosum] (length=494 residues).
MKFTNFVKLTRRRLVTILLCTLLGVAAGVGLLLTTPATYTASATAYVRVSVASSTNGSTDNYYSASQLASQKAKAFVTVF
TSQTVAQQVIHDLGLSMTPDALASNITASNEANSLTIKVTATADSADTARNIANSVISESAKQVKNLEGEKSPVQVVMMT
PADLSQVKKAPSPAKYVIAGLLAGILLGYVVAGIRQLTDRRVHTVHDVTDRVDKPILATIPASSTVAAISADSTDDFKAA
EAIRKLRTNLRYAMIDNRSKVILVTSSVQGEGKSSVAGNLAKVMALAGEDVILVDADLRRPGVQRSFDLEDGLGLPEVLI
GAAPLEQALRTTSTAGLSILPCTDTPPNPSELLGSQHMSELVSFLAQDHVVIIDAPPVLPVTDSVILSRLADNVIVVAHV
GRTTVDQVENTVSAIEDAGGLVSGIVLNRADSSKLSNLRYGGSAYGYGYSKYDSNYRASTDKTPRTDSTTSPEDSGETHD
MTDESQQQRKVPHV
>gnl|bykdb|A0A243Q8C5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia lacunae] (length=482 residues).
MDHLRFLVRRNWWIVALSGAVIGCLGLGYCLLQTPLYVSSAKLYVTSGTEADAQSAYQGSLASQQRVASYAELVDSDVII
REALDDSGLQMSVDDARESLSATSNPDTVLLSISAENSDPALATQLANGVAEAMTSYVTTLEQPNEASQPLAKLTVVSPA
VQPDEPFSPRTARNTVLAVLVGLVLGLLIAVLRERFDTRLRNGDEVQRSVSSAVLAEVPSENNLDGNPVIDFSVGSSRAA
EGYRRLRTNLAFVRVDEPPRCILVTSPGPGEGKTTTSMNLAAALAEDGNRVVLVDADLRRPSIARRLGLTGAVGLTSFLR
GDGVISDFVQAGPVHGLDVLVAGALPPNPAELLGSQRAKDGIEALQSSYDFVIVDTPPVLPVADAAILSQYTDGALVVVR
AGRTRSQDLTTAFSSLRTAQASILGIVLNDVSAHDSRYVYYSYEQQVVGRERATGKHVAPARDQASVEGDVPRVGTATGS
TT
>gnl|bykdb|A0A243RSJ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Streptosporangium minutum] (length=465 residues).
MKGGDSPVGLLHYVRLARRNWPLILLALIISVAAALVVTMNTPPKYVASTSMLVSGHDREGSLSTAYQAGVLSAQRVKSY
ANLLTSRRVVSQITGEEDVERLQSNITAEAIPDTVLLRATVTDTDAARAARLANALGATFTRLISQLERPTPKSRATIKV
TVVDQADVPKKPVSPRPLVNLALALVIGLSVGVGSLVLRDYLDTTIKTSEVLQDATKSSILGIIGYERAARRHPLIIRND
GRSSRSEAFRALRTNLQFIGVDRQPKSLVVTSCLPGEGKSSISANLAITLAQAGWRVILVDGDLRRPRIPSYLGIEGATG
LTDVLIDKTRLKDVIQTWGQPGLSVLPSGQIPPNPSELLGSEGMRAVLGELVDSYDMVIIDAPPLLPVTDAVALAALCDG
ALLVARYGKTRREHIARAAGMLSSINARVVGTVLNFVPAKTNRHYGYDYDYDTEAKAKVKTPVNA
>gnl|bykdb|A0A246E2W5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. AISO3] (length=507 residues).
MELRDYLRILRAHWIALSLCLILGVVVAFAWTLIQPKVYTADASGYVTPVKAEGQNDSSSEYVSDNLAKSKVKSYVDVGT
WRAVGEHAREELGLDVSPESLVRRVSVSNPLDTVVIKVDATGPTPEAARDLAGAWIRGMQIEIENIESGGTGVNPGITLV
TADSARLPTTPSSPNVRLALAIGGLVGLVVGIGYALLRFTLDRRIRSAEGVERETRLNVVGAIPDEKSFTAENRLIPFDG
ANTSSSRNVHLYAVSEAVRELRTNIQFMDVDNPPRILVVTSPLPGEGKSTTAANLAITLSASGQQVVLIDGDLRRPMVAT
IFHLIGDAGLTDILAGRATFDDVAQPVGRSGSLRVVAAGKIPPNPSEILGSQRMRDLMETLSRDAVVIVDAPPLIPVTDA
AVLTNRTDGAIIVTTVGRTTFDALKKAQQNLERAGGRALGVVLNRVPRKGSGAAYYGYQYTGAYYRTEDADTVPDLAPTP
ATAAVSRVVTVGGQVLPDGRRARRARR
>gnl|bykdb|A0A246E4S9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. AISO3] (length=456 residues).
MELHDYIRILRRNIVLIIATTLIGIAAGAASALLTPPRYDATTQLFVATQSSGDASNNELRQGTDFARQAVQSYVNIIPT
ALVLDPVIADLGLDESAAQLAERVSVSATQNTVVISITVSDPGPEGAARIANAIADSFTTVVSEQLERSTAERPSPVRIE
TVQPAQVPVDPAAPNMRLALALGALVGLAAGIAVAILRAVADTRIRTVEDVEKIVPAPLLGGIALDPESKKRPLIVAASA
RDPRAEAFRALRTNVQFLTTTGGPLAFVVTSANPSEGKSTTAANLAIAFAEAGSKVVLVDADLRRPKTAEYFGIEGGVGL
SDVLVSRASLLDVLQRWGQGTLFILPSGAVPPNPAELLGSTTMSKLLDELRTAFDVVIIDAPPVLAVTDAAVVGRAVDGV
ILVAAAGSTTRARLTSAVKNIETAGSRIAGTVVTMLPTAGADKTSYGVYAYVAKGD
>gnl|bykdb|A0A246RHJ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora wenchangensis] (length=485 residues).
MDVRTCLRLVRRHWWIVLVTLMLTVGSAALVTVRTAPRYVASVTFFVTAPNQGVSNAYQGELFLQQRVKSYADLLRSDRL
AQAVVADSGLGLTADDIQRRVATSTEPGTVLLRASVTDTDQTRAMRVTEALSAKFVELVKKIETTSDGKAGPTRIEVVGG
PRVSASPVSPQPNRNLALGVLVGLLLGVALAVLRGMVDVRLRDAAGLQRATGSPLLGDIPFDQGAKAAPLIVGEAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGVDGGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSTPPNPSELLGSKAMADLLLALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQAAAAARSLHSVSVRLLGCVLNMAKVARADAYQYEAYRIATTSPASVPADRATAAHRDDQGLHPAGDRTQEL
TRLPR
>gnl|bykdb|A0A248X5N3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum] (length=494 residues).
MAENMMEQQASGQAGGGAKIENDGLTLSGLLGILRKHIITIIVTFFVVLGAVIALTAVSPVQYSTTTQLFATYNDSSDGT
ANSSEQNNGSSYIMGQIKSYPALTTTQSVLQPVIDELGLHTTVGQLKGQISVTNPTDTAFVNISVTDSDPAQAATIANGV
AKSLSSVVENTLYASGSHSSVKLSIVQPATVPSAPSSPKWKLNILAAIVGGLILGVFAALLKDVLSKRIQDGDEVGEFID
APIIGRIAEEEVLNTTKPVVISEPGSPGAEDFRRIRTNLSFMAPVEDTNCRLIVVTSTGASEGKTTMSVNIAAALAENGA
KVLLIDADLRHPSVANKLDLDGAAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASALLNSPIMVELLNNALERY
DYVLVDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLREISDELTTLDLPVNGVIFNCARETKKSLEHSNYYYYYSN
RTVDHRKKHRFSLK
>gnl|bykdb|A0A251XRV8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMFVAQSSSGGVSDLQQGNNFLTQAVKSYSDVTTTRA
VLQPVIDEFGLDVTSRELAESVRASAPLDTTIIDITVKDQNRQDAATLADAIGASLTTVVGNLVPETIEGTPQVQITQLE
SAEIPDSPSSPNLPVNIIVGAIIGLLVGMGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIIV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A251XS70 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=517 residues).
MTLHEFTALLRRLWYVVVAATLVGGGVAFGLSQLATPVFTAQSRLYFSLSTGSTASDLNQGATYTQSQMLSFGELAESPA
VMEPVIAQLGLDRTPQQLAQSVTVTTPQNTVIMAINVTDPSPKQAAAIANATATSLRDTAEAYAPRGMEGATTVSVRVIQ
EAPEPQFQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTKAPLLGSLERERGVSGLAMALRPLSTAA
EGFRQLKANLRFVLLGNRASSIVVTSSIPGEGKSTVAANLAISLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLEVLTSGEIPPNPSELLASSRMEELLERAREAYDVVVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRGQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQAPARPGGSARRPSGADPPGTTTRGAAGSPAAPL
VSSRVGVRYWKTTTGEPASRATTTLIASADAAGTLKT
>gnl|bykdb|A0A251XZK8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. michiganensis] (length=462 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVISRLGLDQTPQELARAVTVTTPQNTVIMEISVTEPSPAQAADIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPEFQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAEAVAHLTTAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASSRMEDLVGLAKATYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQTGRAARAAGKAPVAG
>gnl|bykdb|A0A251YE20 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=462 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDQTPQELARAVTVTTPQNTVIMEISVTEPSPSEAAEIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPEFPSAPNGRTNTVAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTTAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASSRMEDLVAEARAAYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQAGRAGRGAGKAHAAG
>gnl|bykdb|A0A251YED9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFIQQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A0A251YLS3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=497 residues).
MIDSRGCGYPTYADTPRLSVFGEGFYIMALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSG
SVQDLQQGNNFITQAVKSYADVVTTRAVLQPVIDQFDLDMTSRELAETVRASAPLDTTIIDITVKNASRQDAATLADAIG
TSLTTVVGELVPETIEGTPQVQITQLEQAEIPESPSSPNLPVNIVVGAIIGLLVGVGISLLRETLDNRIRGERDVELVTT
KPILGGIAYDPKATERPLIVQDDPRSPRAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKV
VLIDADLRRPRLASYMGLEGAVGLTDILIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDV
VLIDAPPLLPVTDAAILSKNAGGAIVVVAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYT
EDEDGTKTKAPIEKIKA
>gnl|bykdb|A0A251YRA5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVSDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDEFGLDITSRELAESVTASAPLDTTIIDITVKDQNRQDAATLADAIGASLTTVVGNLVPETIEGTPQVQITQLE
EAEIPESPSSPNLPVNIIVGAIIGLLIGVGVSFLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A251YT31 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=465 residues).
MTLHEFTALLRRLWYVVVAATLAGGAAAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVIARLGLDTTPQQLARAVTVTTPQNTVIMEISVTEPSPSQAADIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPEFQSAPNGRTNTLAGLLLGLLAGLVGLVLVRLLDTRVRSAETVAHLTQAPLLGSLERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLALSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEEVVQPWGDGTLHVLTSGEIPPNPSELLASNRMEELVAQARAAYDVVVFDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQTGRAGRAGRAAGKAHAAG
>gnl|bykdb|A0A251YVY8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=462 residues).
MTLHEFTALLRRLWYVVVAATLVGGGIAFGLSQLATPVYTAQSRLYFSLSTGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDRTPQELARAVSVTTPQNTVIMEISVTEESPADAAEIANAVATSLRDTAEAYAPKGAEGSPTVSVRVIQ
EAPEPLSQSAPNGRTNTIAGLLLGLLAGLLGIALVRLLDTRVRSAETVAHLTPAPLLGALERERGVTGLAMALRPLSTAA
EGFRQLKANLRFVLLGDRASSIVVTSSIPGEGKSTVATNLALSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEEVVQPWGDGTLDVLTSGEIPPNPSELLASARMEELVARAREAYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRGQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQAGRAGRPARRGTPAR
>gnl|bykdb|A0A251Z2T9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=462 residues).
MTLHESTALLRRLWYVVVAATLVGGGVAYGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDATPQELARAVTVTTPQNTVIMEISVTEPSPAQAADIANAVAASLRDTAESYAPKGAEGSPTVSVRVIQ
EAPEPQSQSAPNARTNTLAGLLLGFLAGLLGLALVRLLDTRVRSAETVAHLTPAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVATNLALSLSEGGRRVLLVDADLRRPVVAQYLGLVGDAGLTTVLV
GQALLEEVVQPWGDGTLEVLTSGEIPPNPSELLASARMEELLARARATYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLTEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQTGRAARKARREPAAR
>gnl|bykdb|A0A251Z704 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMFVAPSSSGNVQELQQGNNFTQQAVKSYADVVTTRA
VLQPVIDQFGLDITSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A255DMT6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium sphagni] (length=484 residues).
MTLRNFLKLLRSRWITVCVTTVATVLLAVIVTLLTTPLYQASTRLFVSTPAGDTLTEIYEGTLTSQQRVASYTQLLMGES
LAQRTINKLGLDMSAKDLQKEVTASAKPDTILIDVAVRDESPVRARDIANTLSDEFVTMVRELETPSDGSKASARIVVEQ
RASVPDSPVVPEPARNIGIGLALGLVLGISLALLRDLLDNTVKDRSTLEEITGVGVVGTIPLDKERRKDPAISFDDDNSE
IAEAFRKLRTNLQFLGVDNPPRLIVVASATPSEGKSTTAINIALALAEAEHNVVLIDGDMRRPMLDTYLNVVGSAGFSTV
LSGAAPLADVLQETRFKGLTVLTSGAIPPNPSELLGSLAAKKILSELRAQFDYVIVDSSPLLAVTDAAILAANSDGVLLI
ARYGQAKREQISHAITNLENVGASLLGAVFTITPTRGVGPYSYGYGYGYGYGHKTDDKDKARQPSSPNAPTPEPAHPGSD
RPDE
>gnl|bykdb|A0A255EG83 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium NML 160184] (length=456 residues).
MELQQYARILRRYWRSSVASVLVCIAMAAAITLMQSPTYSASSQVFLSVDAGGTAGELSSGATYAERQVDSYVQVTKTST
VLQPVIDELRLPLTPSQLAGQITVSAPESTSIIKIQVHDAEPEQAALLANHIGASLVRTVEELSPSGADGTRLVSASVID
PAVIPGSPVAPRPSLNIALGALVGVLIGLGQAVLRSILDTRLRNKDDVAKITSAPVLASIGQIVASADRAVPQGEHWANA
EAYRRLRTNVGFVGLGGERRNSMVMTSSVAAEGKTETVVNLARVLAEAGESVLLIDADLRRPQVAARMRLDSELGMSDVL
TGRGSLEALTIPVTQFLSVLPAGTVPPNPSELLGSEAMAHLLARVERQYDYVLFDTPPLLPVTDAVVLSAQTGGAIVVAR
SGVVHRPQLTSSLDLLKSGDVALLGVVLNGVPVDKRAGGYYNSYYTSHEPRQVAAV
>gnl|bykdb|A0A255EM53 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium NML 150081] (length=456 residues).
MELQQYARIFRRYWRSAVASVLVCIAIAAGMTLLQSPTYSAAAQVFLTVEAGETAGELSSGATYAERQVDSYVQVTKTAT
VLQPVIDELGLPLTPSQLAGKLTVSAPDSTSIIKIQVNDANPEQAALLANHVSASLVRTVGQLSPAGADGTRLVSASVID
PAVVPGSPVAPRPALNIALGAVVGVLIGLGQAVLRSVLDTRLRNKDDVAKITPAPVLASIGQIVASADRALPDGEQWANA
EAYRRLRTNVGFVGLGGERRNSMVVTSSVAAEGKTETVVNLARVLAEAGESVLLIDADLRRPQVAARMRLDSELGMSDVL
TGRGSLEALTIPVTQFLSVLPAGTVPPNPSELLGSEAMAHLLARVERQYDYVLFDTPPLLPVTDAVVLSAQTGGAIVVAR
SGVVHRPQLTTSLDLLKSGDVTLLGVVLNGVPVDKRAGGYYSSYYTSHEQRPVAAV
>gnl|bykdb|A0A259SEX1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 13-71-7] (length=492 residues).
MDLREYLRVFRAHWLGMVLITLLGVAVAFGWTLLQPKVYTADASAIVQANTAGDAGDSNLSSAMLGNSLTSGRVKTYVAL
GQSRAVADGVIKDLGLGVSADQLVKQVTVTNTVDTTTLKVTADAATPEKARDVAEAWVRSMGAEVNRLETSDPAKKGAVF
LSPIDSARLPDSPSSPNTRLALALGGLVGLAIAVGYGLLRYTLDRRIRSVEQVERETGKPVVGTIPEEKTFTADNRLLPF
DGGTSSSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMI
DTVFGLPRGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMRELLKSIAREAIVIIDAPPLIPVTD
AAVLAHSADGAVIVGTVGKTTYEVLGKAIGNLERAGARALGLVLNRVPRRGSGAAYYGYQYHGEYYRGDDQELPTGAVRG
DKPRRRGDAEAA
>gnl|bykdb|A0A259VFQ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia polyisoprenivorans] (length=468 residues).
MLDAVRRGWWIVLACGIVVALCGFGYSMLQSPVYRATAAVYVTSGSEASAQTAYQGSLASQQRVASYAELASSDEVIDRA
ISQGNLGMSRDEVREALQTSAKPDTVMLNISADAGSSEKAAQIANAVADSLSGYVATLESPAAGGQPLAKVTPVTHAESK
TQAVSPKPVRDTLLAFLIGIVLGLIVLFVKNRFDRTVTSTADLEDIGSSLIFGSLPFSADLRDTSLVPFNKGASALAEAF
RMVRTNLAFANVDDPVRAILITSGGAAEGKTTTAVNLARCLAEAGKTVILVDADLRRPAVATALEINPHVGLTDYLGGEG
SIMEFVQPSGTERLSILAAGSVPPNPAELVGSRRAADGIAELRERFDFVIIDSPPVLPVTDAVVMSQWVDCVALVVRSGK
TLAPDLRAVTSQFEVAGVALLGFVLNGVRRGTSAYSGGYTYYSNDLGKPNSTASVEGSTPRGRLGARR
>gnl|bykdb|A0A260AZ98 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus sp. 06-221-2] (length=468 residues).
MRMTVRRYAAALRARWLVIVATTIVGTLIAVVFSLVSTPMYQSTTQFFVTTTAVSPSDVYQNNLASQQRVVSYTELLTGR
ELARRVVDQLGLPMSPDELTDRITATAKPNSVLLDASVVDSSPAQARDIANAIGELFPTLVGELEKPVDGGTASAAVTVA
ETAEASTTPVSPKKVRNVALGFVLGLLVGIAGALVRDRMDNTVKEPDELQALTDSVLIGSIPLDKKIRDTPPIDFGSSTA
PIAEAFRQLRMNLKFLSVDNPPRILLVTSCIAGEGKSTTAVNLALSLAESGNRVVLVDADLRRPHIADYLGIVGSVGVSS
VLAHDAGLDEVVQTTGHTDLWALGSGPAPPNPSELLGSSTAQSLLRDLGRAFDYVVVDSPPLLPVTDAATLATQCDGTIL
VTRYGDTRREELTRAAANLENVGASLLGVVMSMVPATGRGRDQYGYDFEPGRVPTPPTQSAPVRTNRH
>gnl|bykdb|A0A260DSD5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus sp. 06-1477-1B] (length=580 residues).
MRIAEARGRVPMLRATRRCRRRVTRKAERVDMQRVVRILRAYWKAIVALTVIGGLAGFAWSAAQPRVYTADASGYVATVA
SDGSTGAALAGDQLALSKVKSFVDMGYWRSVAEAAGTELGLAVSPEELVQRIRVSNPVDTVNVRVDATGSTPEAARDLAE
AWIKGMSQQVDQLETGGSGQGAVRLVAGDSARLPTAPSSPNVKLDVAIGAIAGAVLGVIFALVRRAFDRRIRRVSDVNDV
IDTSVIGVLPVDKELSSGRAVFSFDDIKDGRGSFAHKEAMREFRTNLQYVDVDRPARIVVVTSPLSGDGKSTTAANLAVS
IAATGKSVVLIDADLRRPVLGGMFGFSDDVGLSDVLAGRAQIEQVAHQVDEHAHLFVVAAGRTPPNPSEMVGSQRMQSLA
RTLAEDLVVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLARAAENIAKTRGRLLGIVLNRVPLRGADSGYYGS
QYAGYYGYGAPQGDRRSSWFARRLRRARASSTSGVEQVVGVRRSSNGLPPENVSGLRTLSQRRKSEAPAGEVSSEVSGAS
RGGGAPESVTAGRRGRSRQG
>gnl|bykdb|A0A260IVX0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus sp. 05-2256-B3] (length=468 residues).
MRMTVRRYAAALRARWLVIAATTIVGTLIAVVISLVSTPMYQSTTQFFVTTTAVSSSDVYQNNLASQQRVVSYTELLTGR
ELARRVVDQLGLPMSPDELTDRITATAKPNSVLLDASVVDSSPAQARDIANAIGELFPTLVGELEKPVDGGTASAAVTVA
ETAEASTTPVSPKKVRNVALGFVLGLLVGIAGALVRDRMDNTVKEPDELQALTDSVLIGSIPLDKKIRDTPPIDFGSSTA
PIAEAFRQLRMNLKFLSVDNPPRILLVTSCIAGEGKSTTAVNLALSLAESGNRVVLVDADLRRPHIADYLGIVGSVGVSS
VLAHDAGLDEVVQTTGHTDLWALGSGPAPPNPSELLGSSTAQSLLRDLGRAFDYVVVDSPPLLPVTDAATLATQCDGTIL
VTRYGYTRREELTRAAANLENVGASLLGVVMSMVPATGRGRDQYGYDFEPGRVPTPPTQSAPVRTNRH
>gnl|bykdb|A0A260PX50 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus sp. 02-925g] (length=466 residues).
MMIREYAAALRARWLTIVATTIVGTTAAVLFSLLSTPAYQATTRFFVSTTAVTASDVYQSNLASQQRVVSYAELLTGRTL
AQRVIDQLSLPIGADELSAQIEATSTPNSVLLDASVLDTSPLRARDIANALGEQFPALVSELETPADGGTASASVAVAEA
AETPTAPVTPKKLRNVILGMTIGLLVGIAGALVRDRLDNTVKKAGELQELTDSVLVGTIPYAKKVRDTAAIDFGRSTAPV
AEAYRELRMNLKFLAVDNPPRLLLITSSIAGEGKSVTAVNLALSLAEVGNRVVLVDADLRRPRISEYLDIVGSVGVSSVL
SHEATVDEVVQTTTFNNLWALGAGPAPPNPSELLGSTAAQSLLHELKRAFDYVVVDSPPVLPVTDAATLATQCDGTILVT
RYGFTRRDEVSRTAANLETIGAPLLGVVMSVVPTSRKSEYRYGYDFEPGRTPARAATPPTISTNRH
>gnl|bykdb|A0A260R8K0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rhodococcus sp. 15-649-2-2] (length=466 residues).
MLIREYAAALKARWLIIVATTIVGTTAAVLFSLLSTPAYQATTRFFVSTTAITASDVYQSNLASQQRVVSYAELLTGRTL
AQRVVDQLSLPIGADALSAQIEATSTPNSVLLDASVLDTSPLRARDIANALGEQFPALVSELETPADGGTASASVAVAEA
AETPTAPVTPKKLRNVILGMTIGLLVGIAGALVRDRLDNTVKKVGELQELTDSVLVGTIPYAKKVRDTAAIDFGRSTAPV
AEAYRELRMNLKFLAVDNPPRLLLITSSIAGEGKSVTAVNLALSLAEVGNRVVLVDADLRRPRISEYLDIVGSVGVSSVL
AHEATVDEVIQTTTFNNLWALGAGPAPPNPSELLGSAAAQSLLHELRRAFDYVVVDSPPVLPVTDAATLATQCDGTILVT
RYGFTRRDEVSRAAANLETIGAPLLGVVMSVVPTSKKSEYRYGYDFESGRTPARVPTPPTISTNRH
>gnl|bykdb|A0A261D338 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Williamsia sp. 1138] (length=496 residues).
MRTVQRPQDRSADTLRSALDTLKRGWILVLSITLFCGAIGLLVNLLQEPTYRSTATLYVTSGSDDNAQSALQGSQASQQR
VMSYAKLVDSDAVVSAALADGGGDLSASDARSALSASTTPDTVLLNISAEGTNREAVARLANSIAQSMVVYVQQLETPSG
GGSPLAKLTVVTPASSVDSPVAPQTARNTLLALVVGFILSVAVVFIRDRLNNRVRDEGELADVSAAPVLATVPSDDLLRE
QGLIDFSSGATLAAEAYRKLRTNLAFTTVDSPSRIIIVTSALAAEGKTTTAMNLAAALAETGKRVVLVDADLRRPQVYHR
TGGMGDVGFTNYLKGDGSLADLLQPSEVSGLQILASGPQPPNPAELLGSKKAGQGISNLSEMFDYVIIDSPPLLPVTDAA
VLAQWADGVVLVARANQSRVPDVSAAIEQLEAVQATLVGVVLTDVPTRGGAYKYGYYYTSSDVVKKPGFFSRFGKTKPHQ
HQNIEVALEPAPASKS
>gnl|bykdb|A0A261F1K2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoscardovia suis] (length=475 residues).
MTIGDLLKILRRRWIPALITFVVIVAAAIGYLATATRMYTATSQVFASYTSNSDDSENSQLSQMSTASTYLSKQIASYSS
LAESDAVLQPVIDQLHLSKTTQQLAGEISATNPTNTLILNISVTDTDPQLAAQIADAIAQSLSEQVAKSTGGDKSVISLQ
LIKKASVPAAPSKPKKSMVLIAAIVLGLVAGCGVALIAEMLDTKVHDSATVRQILGASRIGRVPESDQLKQFQPVIVSDP
ASPVAEDFRRLRTNLSFLGVPDDGHKGKLIVFTSSIPSEGKTTVACNAAAALAENGSSVMLIDADLRHPSVAKHFGMEGA
AGLSHVLSGQAHVRDVVQRYWKKNFFVFPAGARPANSGMLLGSETMSNLIDQARDVYDYVLIDTAPLAVASDALTFGNKA
GGVVMVCASNRVKRAELAAAHDQLESSHVNVLGYIMTFVNEKSHDGYGYGYGYGYGYGDEKGSGAKNASTAEHAA
>gnl|bykdb|A0A261FK83 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium tissieri] (length=531 residues).
MNGRTGAKGGLSLIDLSLCQKRIAVFGETKNEVSEGRSIRVEKNDGEEKDVISIDIIGAVRKHLAALIATFVVVVVAVCG
YTFMQTPQYSATAEVFASYKGTASDGSQTSDMTTRSYATSYINTQLQSYPQLVKTEAILQPVIDEMGLNTTVESLAGKIT
AQQPTDTFLVDITATDPDPKVAAELANNVAKSLKDQVSSTLYSSEATETSPINLSIVQSAQVPVKHSSPNIKMNIAIGIA
GGLVLGLLVAIALDLLDHKIRQASDLQDILDVPVLGTLSRNDVYAGKAPVVISRPASREAEDIRRLRMNLTYVMPDKGDR
SNLIVITSAGVSEGKTTTSVNLAAAYAEAGKKVLLIDADLRNPSVAKALSMNGTVGLSQLLTYQVKSTDAIQQYWKENFH
ILPAGKRAPNPGILFNSKAMKSLLDQVSDLYDYVIIDTAPLKVANDAAVFVKEGATMLFVSGLGHGEKNDVRTAAEELET
LNVTVAGAVLNFSEEEKSDDNYYYYYGDGEDGKSRRTRRNTKQSSKKTKKS
>gnl|bykdb|A0A261FRA0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium myosotis] (length=483 residues).
MTILDIVHVLKKHLITAVITLVVVTVAMACYTFTRTTQYMATAELLATYRTSAGSGETGSSGNAGELSSGANYINSQIRT
YPQLVKTESVLQPVIDDLGLNTTVSVLAQSVTASNPDGTMLVDLSVKNPDPKTASSIANAVAESLKKQVTSTLYTDEGDK
IVSPVNLTVVQQAYAPASPSSPNIPRNLMAGVACGIILGIVAALIKDLMDTRVRLDSDVTGIVESPVLGSLSRDEAYADK
TPVIIAKPASREAEEVRRLRTNLMFALPDGPQSNVIVVTSAGPSEGKTTLCVNLATAFAENGGKVLLIDTDVRNPSIADK
LGIDGNVGLTHLITNQVSSQDAIQRYWKQNLHVLPAGMQSMNPSILLNSRALKALIEQVAGAYDYVIVDTAPMQVANDAA
VFAKEGPELLLVAGIGVTEKNVLRQTTQELETLDIHAAGVAINYAEQDKSRKSGYYYYYGNTKSGYGSRHRDTGSKHRDA
EKR
>gnl|bykdb|A0A261FZA3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium hapali] (length=503 residues).
MVSTENNGLQQGQLQAESVDGRDGGVTLMDMLRIIRKHVIAAIVTFVVVFAAVCAYTLLVPPKYSATAQVFATYSDTAAN
SGDISSVNNASSYISNQIKSYPTLATTESVLQPVIDDLGLTMTVKQLAGQLTVTNPSQTAFVNITVENDSAQQAASIANA
VAKSLSSVVQTSLYASDQKSPVKLSVVQQAYEPTSPSSPKVALNMAIGIVAGVILGVFVALIKDLLSTHIQEAHDLQEII
DAPIMGRIPSDESLDKSVPVMVSAPSSPIAEEYRRIRTNLSFTQPVEGTKSRLVVISSVSPNEGKTTTSCNIAATLAENG
ASVLLIDADLRHPSVANKLSLEGNAGLTHVLSGQAAVKDVVQRYWKPNLHIMPAGPKPPNASSLLNSLTMKELIRQALTQ
YDYVLVDTSPMIVANDAAIFGAMGNGIVLVSGRGVTDKRELRDIAAQLDNLGVSVTGFVFNFARESKKTSSYGNYYYNDD
EDESSRKKGGKNRRKSSTARRSK
>gnl|bykdb|A0A261G0Y1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium hapali] (length=483 residues).
MNISDLLKILRKFWIVELVIVAVVTGATAWMVKSETPIYSSSTQVLVRAQAENTDLSSVNASLYAISNQMSTYTSLVKTE
AVLQPVIDNLGLKTTTGNLANSVSADTATGTLMTITANDTDPQTAADIANEVAKSLNELIVNKLYTDGGKLTTPIKFNVV
QQAYPVTTPISPNVKGDIFKGALAGVVLAVFVALTLGFMDQKIRQIADVESIVDSPVVGTVPRNSVFGGTAPVIVAQPGG
SAAEDVRRIAANLMFVVPEDVSHSNIIVVTSGSAGEGKSTLSVNLASAYAEKGDSVLLIDADLRHPTVAKYLGINGSVGL
THLITGRADSKTVIQRYWKRNFHVLPAGARTANPSLLLNSSTMRQALEQLAEHYDHIIIDTTPMDVANDAAIFAKNGALV
VLVVGENVATKKSLRGVVNEFKMIDASLTATVINFAEKEKHKGKNYYYYEDDKASGSKHAATDSATAVQTDGDAPSLVKG
TAA
>gnl|bykdb|A0A261G2E3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium aquikefiri] (length=489 residues).
MVSERNESESSVADGSTVESNQDSGLTIMDLLAAIRKHWAIAVSAFAVVLILVGAYTILATPQYTASSELYATYDNASAD
SESITDINTAGSYISTQIKSYPTLATTQAVLDPVISDLNLNMNVAELGKLITVSNPTNTMLIDISVETDSPAQSQQIANA
VAESLSKTVKSSLYSSKNSPVKLAVVQKATLPTSPSSPNIKLNLLIGVLLGSIVGILAALLRDMTDTRLNSIQDLRRITG
APLLGSIPTSDAVSKAKPVVSDDPNSMVAEEYRRIRGNLSFIAPVEGTHSRLLIVTSTLPSEGKTSTSTNLAAAFAENGS
RVLLIDADLRHPSISNKLEIDGSIGLSHVLSNQANVADAVQRYWKNDLHVMPAGPKPPNASLLLNSTLMEAMIQQALKQY
DYVIVDTTPLDIAADAGMFGRISKGIVLVSGRGVCDKKELAESVAQLKNVNVPIIGTIFNFAEQHKSRKGNYYYYDSEGK
KQERHAHAA
>gnl|bykdb|A0A261G556 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium eulemuris] (length=522 residues).
MAAWHVSQTNTEGGGSPSMTIAQQMMTGNVMNQPLKMDDQTEEGLTLLDLARMLRKHIATAIVVFVIVVVGVCAYTFLAP
KQYTAEAQMFATYSADTGDDSITTVNTAGSYISGQIESYPTLATTEAVLEPALDELGDDDLTAAGLTSMITVTNPSNTYL
LNVSAVSGDPQLAANAANAVANALSEVVATSLYDTEGTVSPVKLSVVQTATTPAEPSSPRVALYLSVGLMAGLILGVCAA
IVRDMLSRHIRDVEDLHSVVDDAMIMGVVPRDEALAQAAPIVVADSGSALAEEFRRLRTGLSFVTASEDQRSHLIVVSSV
SPHEGKTTISCNLAAVLAENGDNVLLIDADLRHPSVAKHLDLEGGVGLAHVLSKQASLEDVTQTYWKSNLSIIPAGPRLQ
NASVLLNGKTMRMVIEQAMEQYDYVIIDTSPMGVANDATVFGAHGNGVLLVTGRGITLKRGLRAAAEQLRNVNVPLLGFV
FNLADGGGYNGYYGDHNYAAYYGEEKSSHRSSQRRAKRSRKA
>gnl|bykdb|A0A261GBL8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium eulemuris] (length=505 residues).
MTQEEMEASEEQGVTLADLLMMIRKHVIMVVVVFVVVLAAVAAYTFTTPKKYSATAELLAMSGQGAVSDTASGNLSQFNT
ASSYINSQIETYPELAKTETVLDTVIDDLSLNMTVSEVAELITVSNPSGTLMVDITAETVDPELSQQLANAVADSLSDQV
STSLGTLDEDVNPVMLSVVQRAQVPQSASSPRVALYLAVGALAGLILGVCCAVVREMLNTKVEESSDVRSIVGASSLGTV
PQDELLEGSRPMVVAQPGGPLAEEFRRIHTNLSFLRADRANEQGQVLVFTSSSPAEGKTTTTINVAAALAEDGAKVLLID
ADLRHPSVAHHLDIEGHVGLAHVLSGQMMPKDVVQSYWKPNLHVLAAGKRPANPSILLNSETMAKLVSQAVTQYDYVIID
TAPLSVSNDASVFGRWANGVILVAGKGVCEKKDLAEAYDSLESAGVPVLGFVFNFADPKKKREGSYYYLLLRRGWRPRAR
QRQNTPPQDRQPVILKSSSKQIRMA
>gnl|bykdb|A0A267WLK2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudocatenulatum] (length=500 residues).
MAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTDTAFVNITAETGDAKQASDIANS
VAESLSNVVEKSLYASGKESPVKLSVVQRAAEPVAPSSPKVALYLAVGLVAGLILGVFAALIRDLMATRVEEASDLQDII
NAPIMGRIPTDESLQGNKPLIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPTVADRIGLEGGAGLAHVLSGQATVKDVVQRYWKPNLHIMPAGPKPPNASMLLNSKTMTELLDVALQT
YDYVIVDTSPMVVANDAAVFGAKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNFEKERKTSSNDYYYYYYYD
EAGKKSKHSHKNSSKKKSKH
>gnl|bykdb|A0A270AW52 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGAVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLAAAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYGYESTYHKSHDKYLQGTGKGGKKSRRAARAKKG
>gnl|bykdb|A0A285VW57 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Ornithinimicrobium pekingense] (length=523 residues).
MALDYVLSVFFPLREEGPVTVRDFLHALRQRWRIVVTTMLLVVAATAWVTLQTQPVYQSSSRVYLLANNQTDASNVYNMP
AAELETIIQVATSPIVLEPVREQIGIPPGEPLDVTASRAGDTPLLDVTVRANDPQVAANAAASVPQNLAAVARSFSPMLQ
SSGSSVTAEVVIPAAVPSRPVEPSVTRNLALGALAGLMLGGAFAVARQALDQRVRDTKDLQVVSDRPVLSTIPLRKGDDN
HSIYLEIDPFGPQAEAVRQLRTNMMFVDVTTGKHSFVISSTLPGEGKTTTAVNLALAMSDAGTKVLLIDADLRHPSVATN
LGLEGAVGLTTVLLGEAEVEDVTQRWGGTNLHVLTSGEVPPNPSELLGSAKMHALFDSLMETYDFILVDAPPVLPVTDAM
VIEKLTGGLLMVVASGETRKRHVHEALRVLSTTESHIAGFVLTKTPPKPLAYYSYYSGEDAATKPDGPRRQRRRPSARDR
RMAKSHPHAEAAANARLERLTTEDDRGSVELRSRPRTDRRASR
>gnl|bykdb|A0A286H2T6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter rathayi NCPPB 2980 = VKM Ac-1601] (length=488 residues).
MELRDVLRLLRDHWIPIVAAILLGTVVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQAIYTQQIAQTVAKSNLATYV
PIATSRDVAQIAIDSLGLDVSPAALISAITVQPDTVAPVMKVSATASTPEGAQKLADAWVSAIATKVQQVNQETGVGDTV
TLTVLQTAALPSAPAFPNLRLVLAVGALVGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVP
EADTTDYVKADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVT
DGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERSGARPDTAVE
AEPAPTSA
>gnl|bykdb|A0A290XKY6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia sp. 1D] (length=466 residues).
MKPSEVRSGVGESEWFRALWRGWYVVVICTLVGMILGLIGSLLATPVYQATSTLYVSSSANEASSASAYQGSLASEQRVE
SYTELAVSYVVLQEAIRSAGLSISPSEASSSLTATATPDTVLLSISARDRDPSRAEALANGVADALSRYVSQLETPAGAA
DPVVRLSVIGPASAPDSPVFPRTSRFLLIGIVLGFGAGAVGVILWSRFSDRIRSSEDITETIDVPVLGEIPSDSALHGGG
RVSFSAGWSPVAESYRKLRTNVEFAGFETESRVVLVTSPIMGEGKTTTAVNLAAALAEAGKRVLIVDADLRRPQVAERLA
VSASVGVSSWLRGDADLMDLILPTGTENLSVLAAAGPLPPNPSELLGSNKLAAGLEKLSETFDFVIIDSPPVLPVTDAIV
LARRVSSVLLVVRAGVSKRRAVISAIAELGIADVPVSGVVLTDAEREGGRGYEYYGGYVVPEKSNI
>gnl|bykdb|A0A2A2EI34 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium criceti] (length=494 residues).
MVDNTMEQQASGASAAGAQPDNDGMTLSGLFGIMRKHVITIIITFAVVLGAAIGLTMMSPVKYSTTAQLFATYNDSSEGS
ANSSEQNNGSSYIMSQIKSYPALTTTQSVLQPVIEDLGLHTSVGQLKGQVSVTNPTNTAFVNITVTDGDPARAADIANSV
AKSLSSVVENTLYASGSRSTVKLSIVQPATAPSAPSSPKWKLNILVGIVGGLILGVFAALLKDVLSKRIQDGDEIGEYID
APIIGRIPEEELLAGTKPAVVSEPGSPVAEDFRRVRTNLTFMAPVEGTNCRLIVVTSTGASEGKTTMSVNVAAALAENGA
KVLLIDADLRHPSVAKKLDLDGSAGLTHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASTLLNSPIMVELLNNAMEQY
DYVLVDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLRDISEELATLDLSTTGIIFNCARDSKKSLEHTNYYYYYSN
RSTDHRKKRRFSLK
>gnl|bykdb|A0A2A2EMB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium italicum] (length=492 residues).
MAENIIEQQTAGAVAAKQESDGMTLSGLFGIMRKHIITIIVTFAVVLGAAIGLTMMSPVKYSTTSQLFATYNDASDGAAN
SSEQNSGSSYIMSQIKSYPALTTTQSVLQPVIEDLKLPMSVGQLKGEISVTNPTNTAFVNITVTDGDPARAADIANAVAK
SLSSVVENTLYASGSRSSVKLSIVQPATAPSAPSSPKWKLNILIGIVGGLILGVFAALLKDVLSKRVQDDDEVGEYLDAP
IIGRIPEEELLKGTKPAVVSEPGSPVAEDFRRVRTNLTFMAPVDGTNCRLIVVTSTGASEGKTTMSVNVAAALAENGAKV
LLIDADLRHPSVAKKLDLDGSAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASTLLNSPIMEELLNNAMEQYDY
VLIDTAPMVVANDAVIFVRRGGSLIMVCRRDHTLKRDLRDISEELTTLDLSTTGVIFNCARDSKKSLEHTNYYYYYSSRS
TDHRKKRRFSLK
>gnl|bykdb|A0A2A2FUY1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria sp. WN036] (length=567 residues).
MEHLDAEREAPALDAQDLLRLVRTHWRAITLITLLCTLLALGWTLIQPKIYSATASGLVVATGEQDLASALAGNNLAQSK
AVSYESLATSRPVAESVIDELDLDATPEEVLPRITTDVPVDTPELRITADAEDPTEAADLANAWVVALAGQVQELESQGD
DDAINRVAVQPLSNASLPLAPSSPNLKLNLALGFVGGLGLGLLYAFARYKMDRRIKSVEEIRDGFGVSVLGVIPTDDRLS
DHRAIVETGISAGRGHHEFAEALRELRTNLSFVSVDNPPKMIVVTSSLPGEGKSSITANLAVAIASTGRNVVVVDGDLRR
PVITDLFGLVAGVGVTDVLTGQVQVEEVLQTYDTFPNLQVLGAGKTAPNPTELLSSKAMHTMLETLAEDALVLVDAPPLL
PVTDAALLTASADGALIVATAQRTTTDELGKALENLHQVRGNVLGVVLNRVPTTGADAGYYGYYGKSYYANSDEKAAPGT
GAQPVPAPVGKHQPWGTELRPEPAGAQPPATAPRAQQEPTAPSAEDAAPAPTNADQPDVPGSAEHETFGLEAWGRSGSST
GSTSTGH
>gnl|bykdb|A0A2A3X2J3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brevibacterium aurantiacum] (length=515 residues).
MSVQRYLTILRERWVAALSTVILVLAAVGGVTALQPPTYEASANVFVRTDPGSSVADRSAAADYARQQISTYADLVTTPI
VLDPAIDSLGLTTDAGELAKRVSATVPEDTLLISITAQASDARSSAELANAVAASLRSQVAELETASGPATVQLTVVTPA
AAPSSPASPNLVQNFVLGLLAALLAGLLAAVLRDLLDNRVRKSSDVEALTDAAVIGTVARMTAGDDHTLVSQYGTEDDQS
ESYRELRSNLRFLELGETSRSLLVTSSVKGEGKSVTSINLAAALARADCNVLLVDADLRDPSLHNYLGLEGGAGLSTVLI
GDSDLDNVVQPVELPNLTVLASGQVPPNPAELLDSDQMTAFLDEAAARYDVVILDSAPLLAATDAAALARRVSGTIFVAG
SGTVRRTQMSQALRKLQLVDRRLLGVVLNGMPKTDSTTYSQIYRDAYAAQAPQTEETAAPRRRLLRRARASEQRADESTV
ESDVRAAVDELTESLPGRSRSRHSASHGLWAAGDD
>gnl|bykdb|A0A2A3XQJ7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Glutamicibacter sp. BW78] (length=488 residues).
MTSKSITANNRPARMLIALKKRWYVVVATALLAGVMTFAYSATIPPVYQASASLFFSLRDGDSGADINQGLTYTQNQMLS
YAELATSSSVLDKAYSNVNGQVSMNELRRSINVTTPQNTVILEVKARASSRDLSARMANSVADSLLDVVSEVAPADSSGK
PTVVARVIEPAAPPRFQSAPNKSKNTVLGTFIGGILAFLGLFVSVLLDTRIRSVASLKSITDLPLLGTAERTPRSNDRRP
VALRFPRGMATEKYRQIRAALRFTSVSRELRTLVVTSSIPGEGKTLTSLNLSLTMAEGVERILLIDADLRRPRVADYLGL
EPSVGLTTVLVNGLLLSEAVQHFGDTRLDVLASGDVPPNPSELLDSRRMREVLAEAKKTYDIIIIDTAPVHSVSDASIIS
QEVDSTIIVIDSSKLRQAQLEQTRDILDAAGAHISGLVLNRVKPADRKDRYYETAHHDSSVNVSPKASPATHSHTRRQRQ
RAKASDNK
>gnl|bykdb|A0A2A3Y8D9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Glutamicibacter sp. BW77] (length=476 residues).
MELPEYLMALKRHWLLIVIVAVLGGGIGFGVGKMTPPTYSATSSVFVSASSGESTSELVQGSNFTQNLMQSYAQLATMPL
VLEPVMDELNLTGSVASLRNRVSVNTPLNTVLINIRASAGSPKQAADLANAVAAELAVQAKALAPKQASGLPAIEMKPVG
VAVIPKFQSAPNTKLLTATGLAGGLFVGVLYALLRSVIDTRVRSERDLTRLSEKPILGLVPKRDPRSTGISMRRTPHDLV
SESYRRLAANLQFVSPDNPVTSVVVTSALPAEGKSSLAMNLAIALSENRKKVLVIDADLRRPTVATVCGIDGQYGLTTVL
SGKAELSEAIVSWGPISVLPAGRMAPNPAELLSSNAMGDIIQESSVRFDYVIVDAAPLLPVSDTLALVRHVSSALLVARA
GKTKAKHLRNAMESLEGVKATLCGIVLNGVKVNIKAERYSYAARIPDRKSSKIGFTKRSRDTSQNLEIDEQSPAHQ
>gnl|bykdb|A0A2A3YKI1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium alimentarium] (length=534 residues).
MTIEDFLRLLLRNLFLLILGVALGAAAGFGFSFSKPEVYSASALGYVSASSQTDEAGNPIQQASGNMQFQYSKAQSYLPL
FNTRAVGQSIVDDLGLQSSPDTVAGSLQAKLDPNAPIFTVTAFAGSAQEASDIANAAVEATADEARTLESGGNEDAAVSV
QLATYQNAVLPGAPESPDRFKYLAAGAAAGLLIALAVAWLRDRNDSRIRTADDIAEAVDLPLLGTLPDVKELGRAKNGTL
PDPKTFGAREAIRKLRTNLRYVDVDAPPHSIVVTSSAPGEGKSIVAGNLARVMARAGQPTLLIDADLRRPMVADQFGVDG
AVGLSQLLAASVSLEDAVQPSSTQLLSLLPAGQVPPNPSELLGSRRMKELIEELSRSYFVIIDAPPVLAVTDAQLLARHA
DGAILVAVPGQTRSFGLTRSVEAIRGVSAKVYGVVMNRASSSRFTRLAYGDAEYGYASYGKYGYGAATGYDTATVVPDSD
DEVDVEQAGGPAEPLTSVGAAHVVTDSGSDANLEDTGELRSARGRRAAPNRDAE
>gnl|bykdb|A0A2A4EEF2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. SZ1] (length=473 residues).
MTLQDYIDALRRQWIVIVALTIIGAGAAFGYARTLPAEYSSTAAVMVIPQRGDSTNELVQGSSYVQSLVQTYAVLASSPL
VLSPVIEDLDLDETATQLAKRVSVVNTLNTVVIEISVTDNDRVRAQETAAAITDSLISAVADVSPSDAEGAPAVRLETIA
PAREPQAPIGPNTRLFALIGAAIGFGLSVAYALFRRVLGTRISERSDIASITDAPVIGEIVAWRRTYTILSTMLRSRDSR
SAESFRALAANLKYVAVDRDLQVVMMTSSAPHEGKSSVSIGLAAALAESNHDVLLIDADLRRSSVATALQLEGSVGVTSI
LVGDATFDEAVQHSEAVNIDIIAGGAAAPNPGQLITSHRLRELVAEARERYEYVIVDSAPALVVSDALWLADLSDGVLVV
ARSGRTRRKQISAVLSTLKSTKKDVVGIVLNAVKRNESSPYYAPDAPKRFLGRPVSRKAARTAKEIGGGAVDA
>gnl|bykdb|A0A2A5NP89 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. 'Ferrero'] (length=482 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLHLDVNADQLAKQVTATAPTSTTLISITVQDTDPVRATEIANATSQSLTNVVQDIEATDASGKATVKLTRVK
QADVPSTPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISPKPVVGGIAFDNKASERPLIVQVDPRSP
RAESFRTLRTNLQFLELDAGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDGAAGLTDV
LIGRAALEDVAQPWGRGNLVVLPAGQIPPNPSELLGSKAMENLIAALEQQFDYVLFDAPPLLPVTDAAILAKKVSGAIVA
VAAGKTHKGQLAAAVSSLDNVAAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLDEAETTRRDTGAPKKVRGKLGTVRRA
DR
>gnl|bykdb|A0A2A7N7U2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium duvalii] (length=492 residues).
MNLQDFVKLLRSRWLTVCVTLVAAVLGAVTISVLTTPLYQASTRLFVSTTAGSSLADAYQGNRFSQERVVSYAQLLMGQT
LAQRTVDKLGLNMSAAELQENVTASAKTDTVLIDVHVLDESPVRARDIANTLSDEFVAMVRELETPDSGARPDSRVVVEQ
RASIPGDPVVPKTLRNIAVGLALGIVFGIGLAVFRDLMDNTVKDSGTLEEITGTGVVGSIPLDKERRRQPAIAFDADNSG
IAEAFRKLRTNLQFLSVDNPPRVIVVTSSMPSEGKSTTAINIALALAEAEHNVVLVDGDLRRPTAHKYLDLVGAVGFSTV
LSGAATLDEALQKTRFAGLTVLTSGAVPPNPSELLGSQSARKLLHELRGRFDYVIVDSAPLLAVTDAAILAAGADGVLLM
ARFGHTRREQLIHAVGSLESVGAPLLGAVFTLMPTRGSLSYSYDYSYYGLPEPKRSSRGKTPVSDRSDPAKINATSDVDR
SGASYDKRKSAE
>gnl|bykdb|A0A2A9CNB3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionicimonas paludicola] (length=461 residues).
MELADYLTVLRKYWISILAVTLIGVLAAAGVSLLTTPTYTASTSVFLTVQSGDSAGELQQGSTYAENQVKSFAQVVTKPV
VLDAVIKELSLPTTSTALAAQVTASVPTGTAIIEVQVVGTNPELTCQIAAAIGKQLIAAVGELSPAGTGSSPSVKATIIA
PPVVPTSPTSPRVALNLALGALLGLLLGVGQAILRRQLDNTIVSEADATAATGRSVVGAVTFDPAASEHPLVFTDGAPSL
RAEAYRRLRTNLQFLFVQAKSRSLVVTSSVAGEGKTTTALNLAFALADAGERVLLIDADLRLPKVASYLNLEGAAGLTTV
LIGRAELRDVVQPASANLDVLPAGQLPPNPAELLGSDEMRSTLALASQAYGYVIIDCAPTLAVTDSALLAQMAGGALVVV
GSRGVHRPELVASLAALESVDSNIMGLVLNKLRFDSGSGYGYRHYRQQYPARNADPGPQAR
>gnl|bykdb|A0A2A9CNJ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionicimonas paludicola] (length=462 residues).
MTYTHCGWTMKGVVLEIQEFLRILLRRWPWLIIPPLMFAVAVGAYSISQPKVYAAKASSYFSFQGGRSASDLNQGANYTL
LQLASFASLATQPLVLDTVIRDLGLSTTSTDLAKQIQVTASTDTVILDIRVEAGTPEDAARIANEVNTVLGEKAKEISPE
SIDPNTGVRSPTITATVVSEALPPSDAAGPQTVRNTLIAFFTGVILGLLLAIARDKLDNRVLDADDLPEGLTTLGSVPAT
RRASEPAAWTTGDADAQLPVAFGRVHANLRFASVDTPIRSLLVTSAIPGEGKSTVSVGLALALAETGARTLLIDADLRRP
KIGQYLDLEASVGLADVLVGTVAFADIVQEWGVRGLKVLPAGTTPPNPKLLLDSHAMSSFLDEVMAAYDVVVIDSPPLLA
VVDPLTLTDKADAVLLVAGRGRLRKRQLRAAVDALSAAKANLVGVVMNRMPAPRDRGETYGY
>gnl|bykdb|A0A2A9CSQ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionicimonas paludicola] (length=486 residues).
MELKAYLDLFRHYWKSIVIAVILGAGAGAGASYLVTPVYGATAAIFLTVESGGSAGELQQGSLFARNQVASYAMLAQKPI
VLDPVIKSLGLSMDSQELATLVSASAPNDTAIIDLEVTSTDPNAAANIANAVADQLTIAVAELSPAGVNSTDAVKATVVE
RARVPESWKSPKVVQNILLGFLLGLLIGFSQALLRNRLDTRVVVPQDVPVVGKSGVISVINLDQDTQRHPVVFQTNPHSA
RAEAYRRLRTNLQFLKFTGHGRSMVVTSTVPGEGKTTTVLNLATAFADAGESVLVIDADLRRPSVHRLFDLDDSPGLTAV
IIGKASLTEAVRAVGNGNLHVLPGGQIPPNPSELLGSQSMRDILAEAVDRYDMVILDSPPLLPVTDAAVIARLVGGALMI
VGSSCVSRHQLETAMNSLRAVDANLLGSVINKLPEKVNGYGRASYRYNYRSYVTASKDSVLTMDNSVKREGHRAEPISPV
QVLSGD
>gnl|bykdb|A0A2A9CZH9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Serinibacter salmoneus] (length=551 residues).
MEFLDYVRVLRRHWLALVICSLAGVAISMAYTLVQTPVYSANASGYVSAGASDNVALESASESLARSRAESWVTIGTSRA
VAERVIAEEGLSVSPEELVQRVSVSQAELTPVIRVSAEASTPEDARDLADAWVYALSAEVAELEGGEADGASSLTLIPIE
AAALPTRPISPNVELGVVLGLLVGAVAGVLYALIRNQSDKKLRTIEALRRATNSSVLGAVPTGDVTSALTGREDRSNAPT
LEAFRRIRTNLRFMNVDDPPRVIVVTSALPGEGKSAVAANIAIAIAESGQRAIIVDADLRRPTVADRFGLVEGAGLTDVL
VHAAEIDDVIQIWPHSQNLAVLPAGSAPPNPSELLGSDVMHDLLMELKEHAFVIIDSPPLLPVTDAAVLTARVDGAVLVA
RAGVTTIDQVTAAAEDLEAANGRLLGTVLNAVSKKSTGYQGGYYGAYYGGYYGSTDGQGQSLTPAGTKRQRLGRDASAVG
DSASAGASPSSAEPSAAAPATQEPPVSPVAHAPASYPPASAPAASGDHAVQWKPVTPSGEAVSTTRTRRDR
>gnl|bykdb|A0A2A9E2B7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sanguibacter antarcticus] (length=525 residues).
MELQDYLAVLRKRWITIALVTALGIAVGAAATLLATPTYKARSQVFVSVMTGETSSDLLQGSSFTQKQVKSYTALVTSPR
VLIPVIDELGLDTTPEALANSVSADSPIDTVLINITATNDDAELASSIANATAESLSTEVSALESRADGVSPVQISSVRT
ATVPRFTATPNTRLNLALGLALGLAVGVGIAVVRHLLDTRIRDESDVKQVTSSSIIASIAFDPDAPSHPLIVQTHPHSQR
AEAFRRLRTNLQFLDVDGRPGTIVVTSSLPGEGKSTTAINLAMTLADAGSRVVLVDADLRRPSVARYMGLEGNVGLTTVL
IGRATVAEVVQPWGDGNLHVLPSGQVPPNPSELLGSTSMSTLLDSLAAEYDVVLVDAPPLLPVTDAAILSRLAGGALVVV
GADTLDRHQLAESMASLENVGARVLGLVLNRAVRTPSDAYAYYDYTPVDHDSTDAKKKNRGAKGEEKRSARPDQGKPSGT
AGSGDVPRRMADADHRSSVDSVLSAADGSQRTETSPRTRPSSDHA
>gnl|bykdb|A0A2A9EEP9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sanguibacter soli] (length=1075 residues).
MEIRTYLRIVRKSWIAISAITAFVLAAAVAVTLLMAPTYKATTQVFVSVQGSTSTSELLQGSNFAQNRVTSYTAMVDVPQ
VLDHVIEDLGLDTTVADLAENVSASSPLNTSLINIDAVDGNPQVAAQIADSVARRFSDVITEFERPAEGGASPVKLSVVR
AAVVPLGPDSPNLKLNLALGLLAGLALGLGFAVLREVLDTGVRSDDDVAEVGTASVVAHIPISLDADAPRLVVQDAPLSG
RAEAYRRLRTNLQFLELTANKRSIVVTSSLPGEGKSTTSANLALALADAGKSVVLVDADLRRPAIARYFGIEGAVGLTTV
LIGEAEIDDVLQPWGDGRMQILTAGEVPPNPSEMLGSESMSRLLEELAERFDVVLLDSPPLLPVTDAAVLGRSTGGVLLV
ASAGLVHKAQLKTALGSLEAVGARILGVALNRVQGTKDGGYYYGEYRQQHGDEPQTSGAARTTRPRSARRAPRTRSAGTS
ASRSTDDGKSDPARRKRRRRVLAGVGAAVVLVVGGAAAWGLSAALTVRDELSAAAEAVTRAKDAATAGNTDSAQALVTAG
REHAAAASAAMENPVLGIATHLPFVGDDVAVVGLVTDAVDEMTGTVVPGLLDALGVLEGDGLLKDGAVDLDALLAVRAPV
LDADARISALSAELAGVPRAGLLDQVAAPVDQLAEVLDGVRPDLRTAVKAVSVLPTMLGGEGERNYLLVVQNSAEARSLG
GIGGSFAVLNVKDGRLSVTAQGSSADVPSFDDPVIPLTEDEEATLGPLFAMFPQNPTMNPDFPRAAQAFQAMWEERQGLR
VDGVLATDPVALAALLEVTGPVVVPASGTELSAENAVQVLLSDTYADVEGNESQDLFFQQAAVAVFDAVTSVSDARALME
PLAGSAREGRLLMWSADEAEQGHLDGTVLGGNLTGARGTSPVVGVYLNDSLSSKMTYYLETETHLRTDACGADAPSLGLD
LTLRSTAPAGAAGLSDWVSGWSDGTQLYNVLVYAPTGGSIGKVTIDGEEIAEENRSRGVHDGLAVEVLAIELAPGETLDL
SVEMTAGTELTGAPILRQTPGPRALVADTTKRACV
>gnl|bykdb|A0A2A9EIV3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Georgenia soli] (length=500 residues).
MGDWRRLLTKRGTSVELNEYISILRKRWISVAIIALATLAATAAVTLLMTPKYSASNRMFFAVEAGDSVSDLAQGSTFTE
RQMTSYAEVATSPLVLEPVIEDLGLSVTTAGLADALTVTVPPETVILEITATDQNPELAAEIANAVAEELTVAVGDLSPA
RQDGTEAVRATVTSPAVAPTEPSSPNVTRNLALGLVLGLMLGVGVALLREMLDTKVRNERDINTVTETSVIGTVGFDPAG
VEQPVFMYDDPTGQRAEAVRRLRTNLQFVDLADRPGSIVVTSSVPGEGKSTTAINLAVALADSGARVVLVDADLRRPSIA
DYMGLEGRVGLTTVLIGRAEIGDVVHPWRDTSLDILPSGQIPPNPSELLGSRAMATLLGTLTQSYDMVLIDSPPLLPVTD
AAVLTKLAGGALVVAGADRIHKAQLAESLDNLENVDARVLGIVLNKVEQKGRDGYEYTYESYSAVDSSGQPVPRPDRRLA
PGSRTATWPGKPLAAHSRRS
>gnl|bykdb|A0A2A9GST2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacteriaceae bacterium ES.041] (length=483 residues).
MELRDYLGLARRRSLMIAAIALCGVSLAALATLLMQPQYQARTSILFAVQGAASASDLAQGSTYAEKQVQSYAEVAASPL
VLDPVIQRLQLNSTPAELARRVTTTVPQKTVIVEVTVTDPDAASAARIANAIGDQVAETVRELSPKRDGQDTVKATTISP
ALPPPSPSSPKVAQNLALGLLLGLALGFAAALVRERLDTRVRNEADVAAVTTASQVGSIPYVAGTPEHPLELGAHTDQRF
EAYRRLRTNVQFVAAPQGRTALVVTSSVPGEGKSVTVANLALAMADAGNRTLLIDADMRRPTVADNFGLVGTAGLSTILA
GQATLSDLVQPFSGHPDLYVLTSGVVPPNPTELLDSAQMRALLDEALAEYDVVLIDSPPLLPVSDGLVLGKLVGGALLVT
GIERVKKPQLAESLAALETVDVKVQGVVLNMVRRKERGDAYGYYAYGSEPGRQRSSSAATGRRAAPSGERPDDLVLTPRQ
ARE
>gnl|bykdb|A0A2A9K6H4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcaceae bacterium JKS001869] (length=463 residues).
MNIIDFLRVLRANRLVILGCAALGLALGLLYSLLQPTLYTATSTAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSDVTVTAMEDALAPAAPSSPDRV
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMRDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVVRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAAAGTTGDTSRR
>gnl|bykdb|A0A2A9K6M4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcaceae bacterium JKS001869] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGLLAARNADQSLIAGNGPAESRAQAYVALINSQAVR
ERVAQDTGQDDDDALSAALVPGSSMIKVTATSTDPETAAQLANSALQATADVAAEVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEVTGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTIASNLARALALAGERVLVVDADLRRPRQHDLFKVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLELASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRRDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKSRTRS
>gnl|bykdb|A0A2C7B062 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium freudenreichii] (length=555 residues).
MTLRDFLKLTRRRLGTILICTLLGAVAAAGLLLMTPTTYSAQATAYVRVAMPQTPNGANDSGSYAAAAQLASQKVKAFVS
IFTSQSVAESVIKELNLDSTPAELAGRVSASNAANSLTIVVTATGNSPEQARRIADATVTQSAAQVKSLEGANSPVQVVM
MAPASLSGITTTPSPVKYLAMGILAGLLLGYALAFIRQHFDTRLRTADDITDRFTDPVLAVLPESREIARTDAGSNEDFQ
SAESMRKLRTNLRYANVDHQAKVILVTSPLQGDGKSSVAASLAKVMAIAGDDVILVDTDLRRPSVAATFDLHGPLGLLQV
LVDSTKPENALRPTKTDGLSVLPSFDTPPNPSELLGSSRMAALIQELSEDHVVILDAPPILPVTDAVVLSSLADSVLVVV
SAGRTRVEQLEHAVDSIVRGEGKISGIVLNRASSTKLSRLRYGDAEYGYEYSYSHEYAADRPRPDAGGTIASSRPDTHPH
RDSDHRATPPDDRSDQQAAGQHTPEESSETRRMAVVNFAESEQWAHAGVESGHKHQPAHEQMGMRRLWRDSPKHP
>gnl|bykdb|A0A2C9SYC1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. shizuoka-1] (length=493 residues).
MLRTRWITIVVTALAAVLIAIGYSLLTTPLYEASTRLYVSTSAGSSAAELYQGNRLSQERVLSYTQLITGATLAQRTIDK
LGIDMDAPALQKRVKATAKLDTVLIDVSVLDESPVRARDIANAMSDEFVLLVRELETPKPGATPDARVVVEQRASVPSKP
VVPKTARNIAIGLGLGLLLGVALAALRDVLDNTIKSREMLEEITGVGIVGSVPLDKGRRNQPAISFESENSAIAEGFRKL
RTNLQFLAVDNPPRVIVVTSSMPNEGKSTTAINIALALAEAEHNVVLVDGDMRRPSLNRYLDLIGQTGFSTVLSGAASLS
EVLQETKFPRLTVLTSGATPPNPSELLGSQAAKHVLSELREKFDYVIVDSSPLLAVTDGAILAAHADGALLMARFGQTKR
EQVMHAVRNLSDVGATLLGSVFTMMPTRGGGASYSYTYSYYGAEAKKQERSSRSEATGKNAVATTIGQDSSAADAEATSE
AGQQQSGTPSRAD
>gnl|bykdb|A0A2D1I5I3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. WMMA2032] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLALGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRITTSAKPDTVLLNATITDTDQTRALKTTEALAAKFTELVRKVETPPDGKSPPIKIEVVSG
PRVTSSPVSPQPVRNLVLGGLLGLLAGAALAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGDAANSPR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGAAPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPAAPSVPTDRAGTRRGGQPAVGDRTQELTRL
SR
>gnl|bykdb|A0A2D3D401 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium choerinum] (length=494 residues).
MAENTTQQQAYGLANTNAKAGGDGMTLSALFGILRKHIITIIVTFAVVLGAAIGLTAMSPVKYSTTSQLFATYNDSSDGT
ANSSEQNSGSSYIMSQIKSYPALTTTQSVLQPVIEELGLHTTVGQLKGEISVTNPTNTAFVNITVTDGDPAQAADIANSV
AKSLSSVVENTLYASGSRSSVKLSIVQPATAPSSPSSPKWKLNILIGIVGGLILGVFAALLKDVLSKRVQDDDEVGEYLD
APIVGRIPEEEILKGTKPAVVSEPGSPVAEDFRRVRTNLTFMAPVDGTNCRLIVVTSTGASEGKTTMSVNVAAALAENGA
KVLLIDADLRHPSVAKKLDLDGSAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASTLLNSPIMEELLNNAMEQY
DYVLIDTAPMIVANDAVIFVRRGGSLIMVCRRDQTLKRDLRDISEELTTLDLSTTGVIFNCARDSKKSLEHTNYYYYYSS
RSTDHRKKRRFSLK
>gnl|bykdb|A0A2E0MPL1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pimelobacter sp.] (length=481 residues).
MFIRRVARALRRNTILILVCLAVALGGAYVLTEQQTPRHESTVRVVVSAAAAPADAAESDGEQSDGPGVGAGPISEERAA
TYAEVVTSQVLASRVASRLLGDPSYRGESDLDGDVLLDQVSAEAVPGSAVLEIRVTDRDPATAQVIAQTYAEELIATATD
IETGGLGTAEDPGFTVIDFASFDDEPVSPRPFDTLLLAAGAGLLLGLLLTGLREALMTSVRTGEEVTALIDAPVLATIAY
ESPASRRKLVTELDQHSPRVEGFRALRTGVQFADPDAPHKLIAVTSCQAEEGKSSTAVNLALTLSRAGVRTLLVDGDLRR
PQVADTFDIDGSAGVTTVLLGKVDLADAIWTHPDTGLAVLPSGVVPPNPAELLQTQAMSQLLERLRSDHEVVVVDCAPLN
PVTDAALLAARADGVLLVVRHARTTKDQLRSAVERLRQVGAAPMGVVMNAVPLRRRDSAAYGGYQRYDARDKPKKSSRKV
G
>gnl|bykdb|A0A2G3PHT3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Williamsia marianensis] (length=495 residues).
MTDEAKKGTSLGADSLRAAVEVAKKGWLVILACTLIFGLAGFSYSALQDPTYRSTAVLYVTSGAENTAQSAYQGSLASQQ
RVTSYTKLVDSDAVVDEALKTSGLSISMAEAKTGLSASSTADTVLLNVSAESHNAADAAALANAVATSMTAYVAELETPS
GGGSPLAKMTVVTPASEASSPVLPQTTRNTVFALALGLLLGVCFVFIRDRYNNKVRDEAEVAAVSGAPVLASVPSDDLLK
RQGLIDFGSGATLAAEAYRKLRTNLSFTSVDNPSRRIVVTSALAAEGKTTTAMNLAAALAETGKRVVLVDADLRRPQVYH
RTGGMGDIGLTNYLKGDGSMADLLQPSEVSGLQILASGPQPPNPAELLGSKKAGQGIENLSAMFDYVIIDSPPLLPVTDA
AVLAQWADGVVLVARANQSRIPDVAASIEQLEAVQAKLIGVVLTDVPTRGGAYKYGYYYSSTDVMKKPGFFSRFGKKDPK
HQDIEAVLESAPSHR
>gnl|bykdb|A0A2G5PT07 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. N5G01] (length=490 residues).
MRGSVTSAENTNVQQVVVEDDSEDGITLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGD
DAGISQQYTGGTYIAGQITSYTTLATTETVLEPVIKDLGLDTSVKSLAEQLTVTNPTDTAFVNISAEDGDAQQASDIANA
VAVSMQNVIQNDLYSAADKSPVKISIVQRARVPESPSSPNKPLYLAVGVVAGLVLGVFAALLKDMLNTKVEETSDVRSLV
GASSLGSVPQDNSLGEKRPVLVSQPNGPIAEEFRRIHTNIEFLQTDKVAGKGQLLVITSAQPSEGKTTMSINLAAALAEG
GARVLLVDADLRHPSVAHHLGLEGSAGLAHVLSGQMSPKDVVQNYWKPNLHILPAGKRPANAGVLLGSDTMRMMVKQALT
QYDYVIIDTAPLSVSNDGTVFGRWAKGLVLVTGRGVCEKKELKEISESLHTAEVPVLGFIFNYADPKKTHSNSNYYYYYE
DAPRKKSHKK
>gnl|bykdb|A0A2G5Q517 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. N4G05] (length=499 residues).
MAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFMVPPKYSATAQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTDTAFVNITAETGDAKQASDIANS
VAESLSNVVEKSLYASGKESPVKLSVVQRAAEPVAPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASDLQDII
NAPIMGRIPTDESLQSNKPLIVSNPAGRIAEEFRRIRTNLSFMSKVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVAERLSLEGGAGLAHVLSGQATVKDVVQRYWRPNLHIMPAGPKPPNASMLLNSKTMSELLDVALQT
YDYVIVDTSPMVVANDAAVFGAKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNFEKERKASSNDYYYYYYDE
NGKKSKHSHKNSRKKKSKH
>gnl|bykdb|A0A2G6XLC8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. CNZ299] (length=487 residues).
MDLLRHLRHVRRHWWVPLVTIMVALGVSAFLTVRAQPRYVASVTFFVTTPNSGISDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQRRVTTSTETGTVLLRASVTDTDQTRALRVTESLAAKFVELVQKVETTPEGKAPIKIEVVSGP
RVSANPVSPQPVRNLTLGGLIGLLLGVGLAILRGIADVRLRDSAGLQRATGSPLLGEIPFEASARTAPLIVGEAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVTSTPKASVPADRAASGRHVATTDGVNGVADHTQ
ELSRLPR
>gnl|bykdb|A0A2G7D493 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Verrucosispora sp. CNZ293] (length=488 residues).
MDLYRQLRLVRRHWWIVLVTLMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQAAVADSQLGLTAEEIQRRVSTSTETGTVLLRASVTDTDQTRALRVTEALSAKFVELVQKVEARPDGSPGPIKIEVVSG
PRVTPSPVSPQPVRNTAIGALLGLLAGVGLAILRGMADVRLRDAAGLQRVTGSPLLGEIPIDATARTAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGLDPGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKAEAYQYEAYRVVAAATGAQSVPTDRSRTGRHAERARAGEASDHT
QELTRLSR
>gnl|bykdb|A0A2I1IYZ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTAISELLATYRSSAAASGASSNAGELSSG
ANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTAVIDAPVLGS
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDT
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGVAMNYGETEKPQKGGYYYYGDESDDNGRKRQ
IQHKKSEKTKKD
>gnl|bykdb|A0A2I1PC09 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kytococcus schroeteri] (length=504 residues).
MTLDDILRLTRRHIITLVLSTLAGIALAAGWVAMQTPVYTATATGVVQASSGTGTVGESLSGNSLAITKSSSYVTYFSSQ
PVAERVIKKLNLDTDPAALSSRVSAKVEEETPNITVSAKGGSPQEAKQLADAVVTETAEYVKDLETKNLTDGPSYPGQQE
SSSDESSSKKDKEQRTPATSILPLASADLPSSPTEPQPARALVLGGLAGLALGYLIAWFRHRQDTRIRTQEDIEEASGGT
STLGLIPANEALSSPERAVRDSGEVDFATREALRQFRTNLRFVNVDHAPKSIVVTSARMGEGKSTISSNLSYLLAEGGER
VILVDADLRRPSVAGIFDIDASVGLTQVLAGTADLADAVQPTAHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHR
VILDAPPLLPVTDAALLTTAADGAVLVVAAGDTRKEHVERAAANLRNVNANLLGAVINRASVSRLNRILYGEGYGYGSYG
YGAGYGDGYGDDKKSRKRRKRRKK
>gnl|bykdb|A0A2I1XJP9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=478 residues).
MDQHQTMDATVPVEEDPDGFSLRDVLQLLRRRWKAITAFTLLGLAVAAVLTALQPLTYTASATAVVNPTVTDNPAAALSQ
DSVAKSRAVQFDELAGSALVAERAAAMVDFPVSTGQALSAVTTSVPTNTALIKVQAEWSDPAQAAQLADAWVQALQDQVG
ELDAADGRDPQVQIDRLLPATVPASPTSPNPPLNFVVGAVLGLAAGAALALALEALDRRIRGTDDLQRAGVTPIGAIPKS
TGLEKGQRVLEVAGRQDAGHFRIREAFNELRINLQYMNPDDPPRIITVTSASPNDGKSTVAANLAIALARAGVPVVLVDA
DLRRPTVATTFGLPAGAGLSDVVVGRASFVDVLHESADPQGLVILPAGQLPPNPTELLTSARFKEAIEALAETHMVIVDA
PPLLAVPDASVVATRLDGALLVLDAESTTRDELRHAVQALQRVHAPILGAVLNRVDFKDRSGRYAYYRSDYTSPASTA
>gnl|bykdb|A0A2I1XJV6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNILLGAVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLELASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLMGVVMNGVARSQRGGGYAYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRRARTRS
>gnl|bykdb|A0A2I1XXG4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=468 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEIAGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHELFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLQGTGAAGKGGKKSRRAARAKKG
>gnl|bykdb|A0A2I1XYT0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=455 residues).
MSIDRGNVMDLQHYLQTFRKYWRSILTVLSVCVGAALVFTFLQTPKYSSTSSALIAVDTAATPGELSSGALYAERQVSSF
VALADSALVLDPVIDELGLNVTPQTLRSRVSVSAPAGTSIVDVTVTDTNAGRAAEIANAITASLKNVTSDVVPTGPDGDE
IVTVTVVEPAAASSRPVSPRPVVNIALGLIAGVVIGLGQALVRRVLDSRIRTRDDLEEVTDAPVLASVVHHKGSDRPKDG
AAPTRGTAWASDESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSMNLAKVLAEAGARVLLVDADLRRPQVGARL
GLDDELGLSDVLTGRADLNDVLLSVDDLSVLPAGTVPPNPSELLGSEAMAELLALVEAHFEYVILDAPPLLPVTDAAVLS
HQAGGAVVVARAGVARQNQLTEALSILEGADASVYGVVLNDVPVSQIDGYSHYYR
>gnl|bykdb|A0A2J8GH16 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. AFG20] (length=525 residues).
MSVTSTPGEQAPAGLDLSDYLRLLRVYWKAIVAFTLLATLAAFGWTVLQPKIYASESSGIVVTPGSDNVSLSLAGDSLAK
AKVKNYESVAKSRLVADRVIASLDLKTTADALLGAISVKVPLDTAEIRVTAQSPDPGTAQRVADAWVNGLAAEVRAIETA
TRPDDATAWPGGPASTSASDPAPAVSILPLGKAVLPSTPVSPNVRLSLALGAFCGLGLGLAYAVVRCHLDRRIRNSTEIE
RLFGVPVIGTLPIDHRLDGKSTILEAGASAGHSEAHVGGAMGEALRELRTNLSFLDVDQPPRVIVVTSSVPGEGKSTVTA
NLAATLAAAGENVVVVDGDLRRPTLADVFNLVPGVGVTEVLAGTADLGDVLQPWSALPNLSVLGSGRIPPNPSELLGSLA
MKKMLSTLAQNATVLIDAPPLLPVTDAAVLSRVADGAIVVIQAGKTTQDQLGQSLGNLDRVRGRVLGTVLNYLPTRGTDA
YSYYGTYPSASAPAQAEAPLRGSDAVQSDSRGEDVPVPVAPQAKG
>gnl|bykdb|A0A2J8IA21 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. AFG7.2] (length=523 residues).
MSTTATPAESPAGLDLTDYLRMLRIYWKAIVAFALLATLTAGGWTILQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAKA
KVKNYESVAKSRLVADRVIASLELKTTADALLNTISVKVPLDTAEIRVTALSSDPAIAQRVAGAWVNGLAAQVEAIETAP
PAETGAQPGTAATADPGTPPTATAVRVLPLGKAVLPTSPTSPNVKLNLALGALVGLALGVAYALIRRHLDRRIRKAAEIE
RLFGVPVIGTLPVDHRLDEKSTVLDAGTAAQVHDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQAEGKSTVTANL
AVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELADVLQPWGALPNLSVLGSGRIPPNPSELLGSRAMK
NMLDALAEEAIVLIDAPPLLPVTDAAILSRAADGAIVVIRTGRTSQEQLAQSLGNLEKVNGRILGAVLNYLPTRGTDAYS
YYGTYTSAANAAPSAGLPHAGTRQDSEAEGLLDVVSGGRRAKD
>gnl|bykdb|A0A2J8IE59 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. AFG7.2] (length=566 residues).
MAEEKVFRIDPAAPGPSVAPAYPARQPAEGIGVLSNQDSGGSEVSAAGMGLRDYARVAMTYWKYITVVTLIITVIAAAWS
AVRPRIYAAEASAVVLAVGTDNVSSLLAGDNLAKARAKNYKSLAESRLVAGNVSEATGLNITGDALLGSITVTVPRDTAE
IRIKAESPDPATAQRVADAWIVELGKQVQDREIAAAAAAVANQPAVPETPGQPAPPVTPPLSLVSLDSATVPTDPVSPGL
GLTALFGAVVGLLLAYSSALLRDRLDRRVRTAGDVERLFSVPVIGALPVDLRLTGENKVLGGVPAAPTAGSRGESPAFAE
ALRELRTNLTFLDVDNPPRIIVVTSSVSGEGKSTIAANLASAISAGGEQVIVVDGDLRHPSVAKIFDVIPGIGITDILTG
KAEVDDVLQQRSDLPNLSILGSGRIPPNPSELLSSHAMKQLIDSLSEKGIVIIDAPPLLPVTDAVLLAKIADGAIVVVKA
GKTTKDQLTKSLGNVRKVHATVLGTLLNCVPAKEFDGYSYYTAEPDSEDSSSPEGTDNTPEAVEQPAPAESSRSSKDSLS
RSVTSF
>gnl|bykdb|A0A2J8IJ34 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. AFG7.2] (length=513 residues).
MPTENLPQDVIWDGLGLTVQGRRGYPYRAACFKRSRRVASLRNVIETWQTRLETMDLRDFIRVVRLRWLAIVAIIVIGLA
LASAYTFLQTPLYKAESQLFVSVKAGDSALDVSQGNAFAEKRVLSYVSLATSVRVLDAVARELDLSGGAEALVEKVTATT
PSQTVLIEIAATDPDPALAARIANSGAEQLIRAVNEVEDVDVVRLSVFQEAAVPDAPSSPRVRLNLALGIFLGLLVGFGY
VLLRQVLDTGIRTQADVGRAVKAGILGTFTFDASVKDEPVIVQGDVFSPRAEGFRQLRTNLRFTHVAGGAQTVVVSSSVP
GEGKTLIATNLAIMLAESGTRVLLVDADLRRPRVAEYLGLDGSVGLSGVLSHSVTLEDAIQKWGPDGALHVLPSGSTVSN
PSELLGSPNMEKLIARTETAYEVVVIDTPPLLPVTDPAILGAKASGVVLVVSADGRTTRGDVSQAVVNLEAVGAQLLGVV
VNQIDKAAVSKSHYAYARESGGFGKNPKTGGRM
>gnl|bykdb|A0A2J9IL43 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. FDAARGOS_333] (length=461 residues).
MNIVDVLRVLRNNRWVILACVALGTLLGVAYSLLQPVLYTATSTGLVVVQGEATLSGTETAQTRAKSYVPLINSRTVREK
VADTTGTDPAAAQLKGAVVPDSNLIQVTGTSSSPEEAARIANSALVATAEVANDLDPESNVRVTAMEDALPPGSPSSPDY
LRNALYGLGAGVVVGVAIAFLRRVLDVNVRTTKDAQEAAGTGLLGAVPREKSLDTGKDGAHNELAPRAAEAIRQLRTNLR
FVGVDNPPRSIAFTSSNPGEGKSTVLSNLALAIAASGRNVVLIDADLRRPRQATLFGVSNRVGLSEVLVGEAELDDAIRE
VGEHGLLFLPSGRTPPNPSEQLGSDRMRELIAELSKTHLVLIDAPPVLPVTDSTLLATAVDGTVLVVHHGKTRKDHLEVA
RDMLGTVNATVLGVVVNGVPSSGLGSDYYGGGYAATGDAYDKYYDAPNKAAKNTPEETISA
>gnl|bykdb|A0A2J9INQ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. FDAARGOS_333] (length=443 residues).
MDLQQYLQTFRKYWRSTLAVLLLCTGAAVAFTYVQTPKYSSTSSALIAVDTAASAGELSSGAIYAERQVSSFVALADSAL
VLEPVIDELGLDVTPQALRSRVSVSAPAGTSIVDVTVTDTNAGRASEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
PATESSRPVSPRPVLNIALGLIAGLVLGLGQALVRRLLDSRIRTRDDLEDITDAPVLASVVHHKGPSKATPGRGMARASG
ESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSTNLAKVLAEAGARVLLVDADLRRPQVGARLGLDDELGLSDVL
TGRADLNDVMLSVDDLSVLTAGTVPPNPSELLGSEAMAELLALLETHFEYVILDAPPLLPVTDAAILSHQAGGAVVVARS
GVARQNQLTEALSTLEAADASVYGIVLNDVPVSQIDGYFQYYG
>gnl|bykdb|A0A2K9B393 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHPKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2K9B7Z0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDISSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQVSSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQTAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGTKSKGEKKARK
>gnl|bykdb|A0A2K9B8Q4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQVSSDLYNNSSSSGSPIK
LTVVQKAQTPTSQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQTAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2K9BH83 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=477 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQVSSDLYNNSSSNGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGIIVGIGVALLKDILNTKVDSTDDVRELTHASSLGAVPQAAILDDNRPVVVS
QPSGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVDQALTQYDYVIIDTAPLSIASDATVFGR
MAGGLVLVTGKGVVEKKELESTATALQTAEVPILGFIFNFADPKKVHSENYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2K9BJ14 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=470 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSNGSPIK
LTVVQRAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNPKVDSTDDVRELTHASSLGTVPQASILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSSDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKS
>gnl|bykdb|A0A2K9BTQ3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSFPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGDKSKGEKKARK
>gnl|bykdb|A0A2M7T4M9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43] (length=458 residues).
MEEQLDLFQLARILIKRKIAVIVGILIGLIIAVSINIYIKPQYEASTQMLFSQGQEASQNQPIQESYQAVLLSERLAQTF
SQIISSRTLAERVIDRLKLRIAPEDLEKKVSADPVKDTQLIKLTITDTSPTRARMLANVYTYEFISMTEKAVHHSPLVNI
SIIEKAAVPSKPVQPKPVLNLILGLCMGFMLGFGFAFLLEMLDTTIKETEEVEKLIGITSLGNVPKISKPLLLDNDNDRS
SESFRSIRTNLQYLNFDQSIKTLIVTSPNMGEGKTTTALNLAVVFAQAGTKVLLVDCDLRRPMVGKLFNRDQSKGLSNIL
VGAAADAGSTLLSTDEEGLHIITSGPIPPNPADLLNSGRMDSLLADLKDQFDLVILDCPPVLGISDTLILASKADAVLAV
ASFGKTKKTDIVGTRDALGKVGARIVGFIMNGIPYDKRSGYYSYRSYAGHQAVSDVTR
>gnl|bykdb|A0A2M9BCA3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Compostimonas suwonensis] (length=475 residues).
MHLEGKAAGVELRDYIRILRKSWVLIVVLVLVGIGAAAAYSITQTPVYSSSAKVFVSTSGGSTVSELQQGNTFTQQRVKT
YADLVNTPIVLLPVIADLGLDMTSEQLSGWVSASAPLDTTLIEITVTETDPAQAAAIATAVSESLTNVVETIETSDSEAA
APPVRLTLVQHAAVPQRPVSPNVPLNIALGALIGLVLGVGVAVLRETLDTRIRNERDVELVTDTPILGGIVFDPKAQERP
LIVHADPRSPRAESFRTLRTNLQFLDVGRDERSFVVTSSIESEGKSTSAANLAIALADAGARVLLVDADLRRPKIADYMG
LEGVVGLTDVLISRAELQDVIQPWGRGKLFVLPAGKVPPNPSELLGSVAMVKLIEEFNRAFDVVLFDAPPLLPVTDAAIL
ARNVGGTIVVCAAGRTHKNQLKGAITALQNVDAPISGLVLTMLPTKGPDAYGYGRYGYGYGYGYGDQAEPAAMGV
>gnl|bykdb|A0A2M9C550 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Compostimonas suwonensis] (length=509 residues).
MDLQGYLRIFRAHWLGIVLLTVLGVATAAGWTLLQPKVYTADASGYVSSASNGDTSSALIGDNLARAKVTSYLDIGSWRS
VAEHAIDELGLRTTPEALVQRVEVSNPLDTVVIKVVASASSPEDARDLAEAWIRGMVVEINTLEGSSDGSGVVTLSVGDS
ARLPSSPSSPNTRLALALGGLIGLVIGVGYALLRHTLDRRIRSAEGVEKETGVPVVGTIPLERSFTDESRLIPFDDGNAQ
AGGRAPDVFAIAEAMRELRTNLQFMDVDNPPRVIVVTSPLPGDGKSTTSANLAITLAANDQRVVLIDGDLRRPTIASIFH
LVTGAGLTDVLAGRAELAEVLQPAGPSGNLLVLEAGQVPPNPSEVLGSERMRVLLETLSEQAIVIIDAPPLIPVTDATVL
ATRADGAFVVASAGKTTYEVLDKALQNLRRANARTLGVVLNRVPRSGSAAASYGYQYRGDYYRSASAKAAAGVPVAGVPV
AGAPAAAGMPASIPLDDDDQPRGRRARRV
>gnl|bykdb|A0A2M9CDB4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sediminihabitans luteus] (length=462 residues).
MTLNEYAATLVKHWLVIALCMLAGGALGYAYAKSQVPMYQSSASVMVVPEQGENTSELVQGSNYVQNLVASYAVLATSPY
VLGPVIDDLGLDDTPTSLANRVTVDTPLNTVVIQISALDADPDVAREIAGATAAQLAVAVPELSPELADDSPAVRVTTIA
EARQPVNPVSPNTRLLTMLGIVVGGLVGAAYAVARRLLARRITNRTTIESVAAAPVLGEVVVAPNGRTLPQELAAAPGSR
ASESVRTLLANLRFANVDKDHRVLLVTSGDASEGKSSISAALSIALAEDDSRVLLVDADLRRPSIDRLTGLEGSVGLTNL
LVGDVELGDVVQHWGSTNLDVLPTGALPPNPGSLLASTRMAAVIETLRRSYDYVIIDCAPLLPLSDPLWLTQRVDGVVVV
AREGRTKIARLRQTLADLERSGCDIVGVVLNGARAHGRSEYYVRPARTPSDRKMRRPTAKTG
>gnl|bykdb|A0A2M9HB57 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium primatium] (length=474 residues).
MNIFDLLNVLKKYLLLELAILVVVTGGVTWAVKSETPVYTASTQVFVRMQTQSTDLGSVNNDSQAIQRQMSTYTSLVKTE
SVLEPVIENLGLNMTTEELAANVAAAANGDTTLMTISANSSDPKEAAQIANEVATTLNNLIINNLYTDDGGKLTTPIKFS
VVQKAYAPSKPTSPNVKSGAFKGALAGFVLAVIVALALNFMDKKIRQIADIQMYTKAPVIGNLPKNQLLAGSAPVIVAQP
AGAIAEDIRRVAVNLSFVIPKDMTKGNLVVVSSGGPNEGKSTLAMNLAAAYAEKGEKVLLIDADLRKPSIGQYLGISDAV
GLTNLATGQVGADLAIQRYWKENFHVLPAGKKSPNPSLLLGSKTMLALLEQFAHDYDHVIVDTSPMDVANDAAIFAKEGA
KLVLVVGQNVATKKSLRGVAAELEMVNVPVMGVVVNYAEAEKRSKSKYYYYADAEGGKAGVGKGRRKEHGKNAK
>gnl|bykdb|A0A2M9HDE4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium simiarum] (length=473 residues).
MSISDLLQMLRRRIVTAIVAFAVVFVAGAAYTFLAPAKYTATSEVLASYNVSVADATQNSSAMNSGAAYLSTQIQTYPQL
AKTEAVLEPVISELGLNLTADDLANMVTVSNPTNTFMVDISVESKDAQQSSDIANAVAKSLSDYVTSSASASDTAPQKQK
SPVQLAVVNKASVPSQPSSPNIPLYMLVAIVLGVVAGIGAALLKDMLNTKVDSSDDVRSITHASSLGTIAQNSSLDESRP
VIVAQPAGREAEEFRRIRTNLSFLTTDENEHGRLIVITSTDPSEGKTTISSNIAVALAEEGKRVLLIDADLRHPSVAHKL
GIEGHVGLSHVLSGQATPKDVVQKYWKQNLHILPAGKRPANASILLNSHLMTELVNQALTQYDYVLIDTAPLSVSNDATV
FGRMAGGLVLVTGKGVVEKKELQNTMQSLKTAEVPILGFVFNFADPKKTHSKNYYYYYYEDDKKGHGRKKRKR
>gnl|bykdb|A0A2M9HJL0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium felsineum] (length=469 residues).
MTIADLLQILRKHIVAAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYTGQSGEAQSTNDMSSGTNYLNTQIKTYPELV
KTEAVLQPVIEDLGLDMTTADLAQVVTATNPTNTFMVDISAEVGDPQQAADIANSVSRNLAKQISSDLYNSTGKAPIKLT
VVQKAQVPTGQSSPNIPLYLAAGLVLGVIVAVGVALLKDILNTKVDTTEDVREALHASSLGTVPSSAMLDDSRPVVVAQP
AGSEAEEFRRIRTNLSFLTTTATEGHGRLLVITSTDPSEGKTTVSSNVAAALAEEGKSVLLIDADLRHPSVAHKFGIEGH
VGLSHVLSRQASPADVIQKYWKANLHILPAGKRPANASILLNSDIMRELVEQALTQYNYVIIDTAPLSVSSDAVVFGRMA
GGLVLVTGKGVVEKKELEGTATALKTAEVPVLGYIFNFADPKKIHSKNYYYYYYENGEKRNSRKGKKHK
>gnl|bykdb|A0A2M9HPB2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium scaligerum] (length=472 residues).
MTIADLLQILRKHFVSAIISFVVVFAAIAAVTFIMPPKYTATAEVLATYTGPSGQEQSTNDMSSGTNYLNTQIKTYPELV
KTESVLKPVIDDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYITDGGKSPIKL
SVVQKAQVPTSQSSPNVPLYLAAGLVLGVIVAVGVALLKDILNTKVDTTDDVREITHASSLGTVPSATILDDSRPVVVAQ
PAGSEAEEFRRIRTNLSFLTTTATNDRGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIEG
HVGLSHVLSRQASPADVIQKYWKQNLHIMPAGKRPANASILLNSDIMKEMVEQALTQYNYVIIDTAPLSVASDATVFGRM
AGGLVLVTGKGVVEKKELEGTAQALKTAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSRKENRSRKK
>gnl|bykdb|A0A2N0STP1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=501 residues).
MNKEERSIAVDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGAS
SNAVELSSGANYINSQIQTYPQLIKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNDPDPKQASSIANSV
AENLRKQVTSTIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNIAIGLVSGIVLGIVVALIKDLLDTRVRRDSDVTA
VIDAPVLGSLSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAEN
GSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVAE
AYDYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELSTLSIDPVGLVMNYGEMEKPQKGGYYYYGDE
SDENGKKRQIQHKKSEKTKKD
>gnl|bykdb|A0A2N0T384 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLIITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2N0TGF7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=501 residues).
MNKEERSIAVDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGAS
SNAGELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSV
AENLRKQVTSTIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTT
VIDAPVLGSLSRNEAYVGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSAGPSEGKTTLSVNLATAFAEN
DSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMRALIEQVAE
AYDYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLFRQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDE
SDDNGRKRQIQHKKSEKMKKD
>gnl|bykdb|A0A2N0TKZ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVTAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMNSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
HPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELKNTATALQTAEVPILGFIFNFDDPKKTHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2N3GRB2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium HGW-Actinobacteria-11] (length=486 residues).
MELSDYIRILRAHWIVILIATVVGAGAAFGWSALQPKVYSADTTGIVTSVGGDGTSGAALVGNQLAQSRVKSYLNLGSWR
AVAEHAIEELSLEESPEELVDRVSVTNPLDTTALMVTATGPTPEEAQALAEAWMRGMAAEIETLEGGTASTPAAVTLIVG
DSARLPTAPSSPNTRLTVIIGAFVGLAAGLIYAFIRHTVDRRVRHPRDIERETGVSVIGTLPLEKTMSDERQVIDFSLDA
QHGVSHHTIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVAVNLASSLAAAGEWAILIDCDLRRPVIADIFGMSP
DLGLTDILAGRAELQDVAHRPSRDMPLAVVGAGRVPPNPSELLGSHRMRDFLAEISKTAIVILDSPPVLPVTDAAVLAAG
ADGVLIVVSSGKTTFDMLQRAIANITRTTGRVLGVVLNKVPRKGAESAYYGREYYGAYERYGRDDDTMAEAVVTPEPGVR
RRGSGD
>gnl|bykdb|A0A2N3QE62 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum subsp. globosum] (length=483 residues).
MERIEEEEQKRRRIGFLDLLHILRKNIFLILISFIVVVAASIAHTALTTPQYTATVKLFATYSDDSGDANYTNINNVGSY
INNQVQSYPTLATTPAVLNPAITALGWNMTASEMASHLTVTNPATTAFVNISYMDNSAKDAAAAANAVGASLGEVVEHSL
YPGSNRSPIKLTIVQPAVVPGAPSSPNWKINIAFGVVAGLILGVLVSLLNVVLSKTIQDDEEVRDYVDAPTIGRIPEDEM
LNNESPAVISEPGTPLAEDFRRIRTNLSFIAPVGDTNCRMIAITSTGASEGKTTITCNVAAALAENGAKVLLIDADLRHP
SVAKKLGIDGSAGLAHVLSGQASVRDVVQRFWKSNLHIMPAGPKPPNASTLLNSPIMAELLSNALQQYDYVLVDTAPMVV
ANDAVTFVRQGGSLVMVCRRNQTQKRDLREISDELNTLDMQVSGIVVNCAKENKKALENSNYYYYSNQDIQRKKKSKRNL
LRK
>gnl|bykdb|A0A2N3QN49 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium thermophilum] (length=466 residues).
MTIADLLQAVRKHLGAAVATFVVVATAVAAYTFLTPPKYTATAQLFATYSSQGESQNSSEMNSGATYLSTQIKTYPQLVK
TEAVLDPVIKELGLGVTADELAEEVTATNPSNTFIVDVSVVDADAGQSARIANSVAKNLAKQVSSTLYTDESAKSPIQLT
LVQKARTPEAPSSPKVGLYLASGVVLGLILAVGVALLLDVINTRVEGSSDVRELTKASSLGSVQRSELLSKPRPVVISQP
SSKEAEEFRRIRTNISFLAPSEKNRGHLLVFTSTRPSEGKTTTATNTAAAIAEIGKSVLLIDADLRHPSVAKEIGIEGHV
GLSHILSAQATPRDVVQKYWKQNLHVLPAGKRPANASVLLNSEIMVDLVEQALTQYDYVIIDTAPLSVANDAAVFGRMAH
GIVLVVGRGVAEKKDLQDQATALKEANVPILGFILNYADAKKHSKKNGNYYYYYEDSKGGHSHSHR
>gnl|bykdb|A0A2N3QQ61 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum subsp. globosum] (length=489 residues).
MEQQASGQVGGGAKIGNDGLTLTGLFRILRKHVITIIITFFVVLGVVITMTAMSPVQYSTTTQLFATYNDSSEGASNSSE
QNSGSSYIMSQIKSYPVLTTTQSVLQPVIDDLGLHSSVAQLKDQISVTNPTNTAFVNISVSDEDPTQAADIANAVAKSLS
SVVENGLYASGSHSSVKLSIVQPAVSPTTPSSPKWNLNIAMGIIGGLILGILVALLKDVLSKRIQDEDEVDEYIDAPTIG
RIPEVDLLNDTKPVVINEPGSPVAEDFRRIRTNLSFMAPVEDTNCRLIVVTSTGASEGKTTISVNIAAALAENGAKVLLI
DADLRHPSVANKLDIDGSAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASTLLNSPIMVELLNNAIERYDYVLI
DTAPMIVANDAVIFVRRGGSLIMVCRRTQTLKRDLHEIADELATLDLSANGVVFNCARESKKSLEHSNYYYYYSDRNADH
RKKRRFSLK
>gnl|bykdb|A0A2N3QZ25 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum subsp. globosum] (length=492 residues).
MAEYLNDQQAGGSVSGSSPDSNRHTVAEYLGTIRKHIVTLIVTFVLVVVAACVFTAMSPVKYSTTTKLFATYDSSSSSLN
SAEQNSANSYIMSQIKSYPTLTTTQAVLQPVIEELHLNQTVNGLAGQITASNPTSTAFVNITVTSGNPKQAAEIANATAA
SLSNVVEKSLYTSGSQSAIKLSIVQPAQQPTVPSSPNWKFNVAAGVLAGLVVGVFMTLVKDKLSKTIQNEGEINEYIDAP
IIGRVVEDPLLEDSKPVVVNEPGSSLAEDFRRIRTSLAFMAPVEGTNCRLLVITSAGPSEGKTTTSVNVAAALAENGAKV
LLVDADLRHPSVANKLDIDGSAGLAHVLSGQASVKDVVQRYWRPNLHIMPAGPKPPNASTLLNSVIMTELLNNALQKYDY
VIIDTAPMVVANDAVIFVRRGGALVMVCRRDKALKNDLEDIRQELDTLDQSVSGVIFNCAKENKKIGTVYGNYYYLSEQD
EKKKKKNRFFKK
>gnl|bykdb|A0A2N3R436 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum subsp. globosum] (length=490 residues).
MADEYSEKQSTATASTAKQSSVTFSDLFGILRKHWITIVVTFVAVVGGVTLWTAMSPVTYSSTAQLFATYNDESDTTNSA
EQNSGSSYIMSQIKSYPALTTTQSVLQPVIEDLGLHISVTQLKGQISVTNPANTAFVNISATNSNPEQAANIANAVAKSL
SSVVENTLYSSGTHSSIKLSIVQPAISSSTPSAPNWKLNILIGIVGGLILGVFVALLKDVLAKQIQDDDEISEYIDAPII
GRIPEEDLLNGTKPAVVNEPGSPVAEDFRRVRTNLSFMAPVEDTNCRLIVVTSTGASEGKTTTSVNIAAALAENGAKVLL
IDADLRHPSVANKLDLDGAAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASALLNSPIMVELLNNAIERYDYVL
VDTAPMVVANDAVIFVRRGGALIMVCRRAQTLKRDLREISEELTTLDLSANGVIFNCARDSKKSLEHSNYYYYYSDHNKD
HRKKRRFSFK
>gnl|bykdb|A0A2N3S3T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantactinospora sp. CNZ320] (length=492 residues).
MDLHTYLRALRQRWWVVLATVMVALGLAGFVTVRATPQYASSVTFFVTSSGQGMTDAYQGSLFLQQRVKSYVDLLSSDRL
AQTVAAEERVGLTADEVRSRVSARVEADTVLLSATVTDSDQARALRLTEALAAQFVKLVHTIETPPGAKEPPIKIEVVGG
PRVNAEPVSPRPVRNLVLAGVFGLVLGAALSVLRGLTDTTFRDGETLQEATSAPLLGSIPYDGQARSNPLIVGTAAQTAR
AEAMRKLRTNLRFVDAQEPARVIAVTSAVQAEGKSTLACNLAITLAEAGWQVLLVDADLRRPRVAGYLGLGSGAGLTDVL
IGEVAVEDVLQPWGDKSLLVLPGGSVPPNPSELLGSKAMADLLLSLRELTDIVIIDTPPLLAFTDGVVVAVQADGALLVA
RQGKTPSAQTAAAAQALHSVSARVLGCVLNMSKENKIDVEQYRAYRKGAPVETVLAARGDGPPAADPVRFPPNDTVAAAS
ADNTEELDRVPR
>gnl|bykdb|A0A2N3YKR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tetrasphaera duodecadis] (length=533 residues).
MTLLEAVRIARRFWSTIAICVAAALAVAGAYAATQPRLYSASSEAYVQIGGGTGSVSEVSVGNNVASAKAAAYAPLTRSG
MVADRVIASLGLKTTPAQVAAAISYATEPESPRIQVFVTSGSPQEAKNIADAVVGATAEVASIVEGGRPGSAARTVRLIP
VTTAAVPTAPVSPDVEKLLALGLAGGLVLAYLVVMARLRLDTRIRRVDDVTGLTSHGVIGTIPRSRDLKQRLHSESLLSG
PVGEALRHLRTNLVYADPDHAPRTVIVTSPQPGEGKSTISALLARSLALRGERVVLVDGDLRRPMVATLFDVRSGLGLTQ
VLSGAVPLREALVATDTPGLTVLPAGRIPHNPSEVVGSERMRQLLDHLGQDHLVIVDAPPTLPVTDALVLAQRADGVLVV
SLMGRSRKEQLKRTLELAEGVHAKVLGVVVNGIPQGRSAGVYGYESYGYEQGTTSRAGMLRRVLSRARGTDPDGTSDPRP
AGSRPERAGGSASGDGPARAGAAPSAADPAPDATPGEPDLAPAWLTGSDPAVR
>gnl|bykdb|A0A2N3YZF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. CNZ309] (length=485 residues).
MDVYRQLRLVRRHWWIVLLTVMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSVVAENSVGLTAEEIQRRVSTSTETGTVLLRASVTDTDQNRALKVTELLSAKFVELVQKVETTQDGKAGPIRIEVVSG
PRVTPTPVSPQPVRNFAVGTLLGLLAGVGLAILRGVADVRLRDAAGLQRTTGSPLLGEIPFESTAKSQPLIVGEAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVADYLGLDAGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRSQVAQAARALNSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVAGAATPDLPADPAPVARHAERADVVSDRTQEL
TRLSR
>gnl|bykdb|A0A2N5IRG9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium imperatoris] (length=511 residues).
MVSAENNEQQNQSVADSAAAQAENGITIMDLLRIIRKHVISVAVTFVVVFAAVCAYTLLTPPKYTATSQVFATFSASDST
SSQGNFNDINNAGSYISNQIKSYPTLATTESVLQPVIDQLGLNSTVSQLAGQLTVTNPTDTAFVNISVEDTNPKEAADIA
NAVAKSMKTVVEDSLYSSGNKSPVTLSVVQQAQEPSGPSSPKITLNMAIGIVGGLILGIIVALLKDLFSTRIEEAFELQE
YIDAPIMGRIPEDDLLKGEVPVIIAKPSSPIAEEYRRVRTNLSFTAPVEGMSSRLIVMSSTGPSEGKTTSAVNTAVALAE
NGAKVLLVDADLRHPSVANRLGLEGNAGLTHVLSGQASVKDVVQRYWKPNLHIMPAGPKPPNASALLNSPVMKELLKQAL
AQYDYVLVDTSPLVVANDAYVFGAMGNGIVIVSGRDVTDKRDLRDIAAQLDTLNISVNGFIFNYAKDSKKDYSSKYNNYY
YYDDDSNSGNKNNRNKKRPKRSAPRRAAVKR
>gnl|bykdb|A0A2N5IVW1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium anseris] (length=492 residues).
MAENIIEQQAAGAVAAKQESDGMTLSGLFGIMRKHIITIIVTFAVVLGAAIGLTMMSPVKYSTTSQLFATYSDSSDGAAN
SSEQNSGSSYIMSQIKSYPALTTTQSVLQPAIEDLKLPMSVGQLKGEISVTNPTNTAFVNITVTDGDPARAADIANAVAK
SLSSVVENTLYASGSRSSVKLSIVQPATAPSAPSSPKWKLNILIGIVGGLILGVFAALLKDVLSKRVQDDDEVGEYLDAP
IIGRIPEEELLKGTKPAVVSEPGSPVAEDFRRVRTNLTFMAPVDGTNCRLIVVTSTGASEGKTTMSVNVAAALAENGAKV
LLIDADLRHPSVAKKLDLDGSAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASTLLNSPIMEELLNNAMEQYDY
VLIDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLRDISEELTTLDLSTTGVIFNCARDSKKSLEHTNYYYYYSSRS
TDHRKKRRFSLK
>gnl|bykdb|A0A2N5J0F3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium parmae] (length=519 residues).
MASETPEQDVKIVEQTPAVAVIGGRAETDNQDSGLTIVDMLRMVGKHWLTAVIVFIIVVGAAAGFTFTRTKQYTATAQMF
ASYNSVAADSSYNNVGVQSTAGTYIASQLTSYPNLVKTSAVLQPVVEEQGGGLTVNGLAGMVTATNPDGTYMLNVSVMSP
DPQQAADLANNVAKSLSDVVASELYSSGEKSIVKLSVVQKAQTPGSQSSPNVALNLIAGALIGLVLAFVAAVLRDLLSRR
VQDISDLQAIAQNATVVGIIPKDESLDDTKPIVVIKPDGSIAEEFRRIRTNLSFTTSKDGDKGRLIVVTSSMPSEGKTTV
SCNLAATLAENGAAVLLIDADLRHPSIAKRLDIEGNVGLAHVLSNQATVKDVVQRYWKPNLHIMPAGPRIQNASVLLNST
IMHNLVKQAVQQYDYVIIDTSPMSVANDAAVFGQQGNGVVLVSGKGVTFKRALRGTVTELDELDVPILGFVFNLADQQKN
GGYGTYYYYGSYYHYGEYGYGDDDGKKKGRKKAGKRARK
>gnl|bykdb|A0A2N5J8X7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium margollesii] (length=474 residues).
MSISDLLQMIRRRIITAIIAFAVVCGAVVAYTFLAPAKYTATSEVYASYNVSVADATQNSSAMNSGAAYLSTQIQTYPLL
VKTEAVLDPVISDLGLNYTADQLAGMITVSNPTNSFMVDISVESKDPQQSSDIANAVAKSLSEYVSSSASGDSNAQQPQQ
KSPVQLSVVKKASVPSQQSSPNIPMFLAAAVVLGIVAGIGVALLKDMLNTKVDSSDDVRSITHASSLGTIPQNATLDESR
PVIVAQPAGREAEEFRRIRTNLSFLTTDENEHGRLIVITSTDPSEGKTTISSNIAVALAEEGKRVLLIDADLRHPSVAHK
LGIEGHVGLSHVLSGQATPKDVVQKYWKQNLHILPAGKRPANASILLNSHLMTELVNQALTQYDYVLIDTAPLSVANDAT
VFGRMAGGLVLVTGKGVVEKKELQNTMQSLKTAEVPILGFVFNFADPKKTHSKNYYYYYYEDDKKGHGKKKRRR
>gnl|bykdb|A0A2N6R2X5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus lylae] (length=518 residues).
MAETSAPQDERSNFSPRDLLRVLRDHWLIVVGCVALGVLLASLWTLTQPRTYQSHASAVVTAGVNENLGIALTADNLAKS
KATQYQELATSRAVAEGAVKQAGLDISPEAASGAVTATVPPDTAEVRLSVVQDSPDAARALADAWVSSLAEEVSNIENQT
LPGVEQSEESSAQSIVKVLPLVQATQPQTPHTPNVRMALALGALVGLVVGLGVAALRSLNDRRIRGVKVLEETFGLTVLG
TIPAMAGLGRRAQRNRTQSKDSNAEVESRSALLELTGHTGRDDFHVVEAFKELRTNLQFLRPDNPPRIIVVTSAAPAEGK
STVAANAAITLAQSDVPTVLVDADLRRPTVAGSFHVEGSVGLTNAVVGNAQVDDVLQPVSEVENLTVLASGPVPPNPSEI
LGSDRLEAILRSLAQDHMVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGRTTRDELAKSLGNLEKVNGDVLGTVLNRVPT
RGKEAGYYGYYGKSYYSSSATPDQDFDVTSRNAGSTRE
>gnl|bykdb|A0A2N6RS04 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=463 residues).
MNVIDFLRVLRANRLVILGCAALGLAMGLLYSLLQPTLYTATSTAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IAAEGLDTVGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVTVTAMEDALAPAAPSSPDRV
RHLLYGLGAGLVLGLVVAFLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGSLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMRDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVVRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAADAAAGTAGDASRR
>gnl|bykdb|A0A2N6RS10 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEAAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHELFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLAAEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRRDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYAYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKARTRS
>gnl|bykdb|A0A2N6TV90 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTAMAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKACK
>gnl|bykdb|A0A2N6TZM8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. UMB0905] (length=520 residues).
MTIEDFLRLLLRNAVLLVLVTVLGAAAGYGYSHTKPELYSASALGYVSASTSVDEEGNAIQQASGNMQFQYEKAQSYLPL
FRTRAVGQAIVDDLGLQASPDAIAGSLQVTLDPNAPIITVTATAGSPEEASQIANAAVEATAAEARQLETGGQENAPVSV
QLTTYQTAITPGAPVSPDRKKFLLAGAAAGLLLGLALAWLRQRNDSRLRTADDVAKVVDAPLLGVLPDAKELHRAKDGTL
PELRTFGSREAIRKLRTNLRYIDVDNPPRSIVVTSSAPGEGKSVVSAHLARVMARAGQPTILVDADLRRPMVAGQFGLDG
AVGLAQVLAGAVRLEDALEETETERLHVLPAGQIPPNPSELLGSRRMHDLIADLAREHFVIIDAPPVLAVTDAQLLGRQA
DGALMVAVSGRTRTFALARAVESLRTVGGTVYGVVLNRASTRRLTRLAYGDAEYGYGSYGRYGYGSAAGYEEAAVVPDAP
DVDVEAAGGPAEPIAAPAAPARRRRGRREAPVQPETQETR
>gnl|bykdb|A0A2N6TZR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium sp. UMB0905] (length=553 residues).
MPSSNEWKTVELQNYLAILRDRWISALVTFLLVLGAVVGFTLMQTPTYQATNRLFVQTQAGSSVTDLNSGVTFARQQITS
YADLATTPLVLEPVIEDQGLDSTPQQLAGMISTTVPPETLILEITVTDEDPQQAATIADATAESLRERVSELESNGEDAS
VELTVITPATVPTSPASPSLTRNLAIGVVLGLMAAVAMAIVRDLLDNRVRRAEDLERTFERPVIAKIPYSRDTKHLPLIA
SQHPQSVQAEAYRDLRTNLQFMGLAEGKRSVLLTSSLPAEGKTSSAINLAHVVAQSGGKVLLIDADLRRPSLHHYMGLEG
NAGLTTVLIGEADLEDVIQPMATDGLDVLASGPIPPNPSEILGSEAMEQLLAQATAEYDYVIVDAPPLLAVTDSVVLSRL
VGGALVVARSEHVRRHQLQQALEKLEAVDAKILGIVLNRVPTSGRSSYRYNYSYTTDGSAVRQSVAKEAPSAPAKSLEQE
APAARGDSTGRHTAPAARAADPQPEPEQDLWSLPGVSPVEPASGKRRADVDLAGYSSQKRSWPGAASRGQVDH
>gnl|bykdb|A0A2N7T841 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Verrucosispora sp. ts21] (length=485 residues).
MDLLRQLRLVRQHWWIVLVTVMVALGVTALITVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSAAADRQVGLTAEEIQRRVSTSTENGTVLLRASVTDTDQARALRVTEALSANFVELVQKVETKPDGSAGPIKIEVVSG
PRVTPSPVSPQPVRNTVIGALLGLLAGVGLAVLRGMADVRLRDAAALRRVTGSPLLGEIPLDGSARVAPLIVGDAATSAR
AEAIRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGHYLGVDSGVGLTDVL
VGDVHVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKTDAYQYEAYRVVTDAASTSAARSSAGRHAERRGAAEPVDHTQEL
TRLSR
>gnl|bykdb|A0A2N8LPQ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. ENV421] (length=503 residues).
MNLQQFAKLLRTRWMTIAVSIMVAVLCAVAFNLLTTPLYQASTRLFVSTTAGASVTEIYQGNLFSQQRVKSYAELVTGTT
LAQRTVDKLHLDMSADALKKKVTAAAEADTVLIDVDVLDASPVRARDIANTLSDEFVALIRELETPEKGGTPNARVVVEQ
RASIPERPVIPKTTRNIALGLALGALLGVGLAVLRDLLDNTVKSQDALESIVGTGVVGYIPLDKDLRKSAAIAFDADNSG
TAEAFRKLRTNLQFLAVDNPPRLIVITSSSPSEGKSTTSINVALALAEAEHNVLLIDGDMRRPTLARYLDVVGSVGFSTV
LSGAAPVADVLQKTRFPRLTVLTAGPNPPNPSELLASQAAKNLLAELRSQFDYVIIDSSPLLAVTDGAILAANADGALVV
ARSGQTKREHLSHAVGSLTDVGATILGAVFTMVPTRGGQASSYNYYNYGYGYGGQPSNQVSDEDSGGSAKRGDSAKAGVA
KSRAASAISSAGLSGRQARRSAR
>gnl|bykdb|A0A2P7ADF2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gulosibacter molinativorax] (length=487 residues).
MAELTVADFVLLLRRHWKFLLTIVLLGGIAGVGYSALQTPVYTATSSGFIETSSETGIVAQDEPERIEAYLTLITSNAVA
EKIASNPDLNVPAEDVRGSISASLVGTSALISVTANSDSPQGAEALANGALVALGEVIDEIEKGSASGTSSVLSVTPFEN
AVAPSTPSSPNWGQNILIGLGAGLVLGLALMMLRQLLDIKVRSAEDVTEAMDGAGLLARIPKMAKAKNSKGLPKLDTLGA
ESFRHLRTSLRFSSVDEELRSVVVTSSNQGEGKTTVAVSLARMMAESGVRTLIIDADLRRPAVARSLGIDGSVGLSSVLS
GQVALNDALRATKQDNLFVLPAGPIPPNPSEIIGSASMRDLVDSLSKEVFVIVDAPPVLPVTDAAIVSGIVDGVVFVVKA
GSTAKPELRQARLLLNRAQARLLGVVLNGVTKTDGDGGYYYSKKNRGYYMNAEQASVGEPEVKRTRTSETASRPKQAAET
RSGRRGK
>gnl|bykdb|A0A2P8ATT4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. MH33] (length=483 residues).
MDVLGYLRLVRRHWWIVLVTVMVALGAAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVAEAPLGLTADQVQRRITTSTEAGTVLLKATVTDTDQTRALKTTETLSAKFIELVQKVETPPDGKATIKLEVVSGP
RVTSSPVSPQPVRNLVIGGLLGLLLGAGLAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGEAANSRRA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRSQVAAAAHALHSVSVRLLGCVLNMAKVAKADAYQYEAYRVVVPAAGPSVPADRAGAARRGEPATVGDHTQELTR
LSR
>gnl|bykdb|A0A2P8GSE2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Labedella gwakjiensis] (length=473 residues).
MNIHEYIGSIRKNWLVVAVLALLGAGAGYGYAQTMPDMYRSTASAYASTVMGETTSELVQGSTYVQGLVQSYATMAKTPI
VLQPVIDKLDLDMSTKDLERSISVDTPLNTVIIDVTVVSSDPIRAQQITSEVTRSLATAVADISSRGNEATSPVELTIIS
PATAPSAPFSPDTRMIVAIGGAIGLLLGLAWAVLRELIDTRIRSQKDIEAVTDSPILAEIGRGARDKGLAQTIRTTPNGP
TAEAFRGLCMSLAFADVDKPVSAVVVTSAMPAEGKSSVSLGLALSLAESMGRVLLVDADLRKPSIADHTGLDGSVGLTSV
LLGSATIDEAVQSWGTSNLDILVAGTIPPNPNQLLASDTMRATLTELKKRYDFVVIDTSPLIPVTDPLWLVHETDGAIVV
ARNMKTRRPELSKAMATLGSVGARVLGVVANDVKKHERLTYYTETEKDSAVAIPGVRRLGTGGASNEAAQHSS
>gnl|bykdb|A0A2R4FCN3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantactinospora sp. BB1] (length=492 residues).
MDLHTYLRALRQRWWVVLATVMVALGLAGFVTVRATPQYASSVTFFVTSSGQGMTDAYQGSLFLQQRVKSYVDLLSSDRL
AQTVAAEERVGLTADEVRSRVSARVEADTVLLSATVTDTDQARALRLTEALAAHFVKLVHSIETPPGAKEPPIKIEVVGG
PRVNAEPVSPRPVRNLVLAGVFGLVLGAALSVLRGLTDTTFRDGETLQEATSAPLLGSIPYDGHARSNPLIVGTAAQTAR
AEAMRKLRTNLRFVDAQEPARVIAVTSAVQAEGKSTLACNLAITLAEAGWQVLLVDADLRRPRVAGYLGIGSGAGLTDVL
IGEVAVEDVLQPWGDKSLLVLPGGSVPPNPSELLGSKAMADLLLSLRELTDIVIIDTPPLLAFTDGVVVAVQADGALLVA
RQGKTPSAQTAAAAQALHSVSARVLGCVLNMSKENKIDVEQYRAYRKGAPVERLLATRGEASPAADPVRVPPTDAVATTS
ADNTEELDRVPR
>gnl|bykdb|A0A2R4G4T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=477 residues).
MRGNMTISDVLRAIKKHWIVEIVLFCVVAGVVAGLTFTATPVYTANTEILAQYNSSSSTGDSSTTNQQQYSNGNSPVSLY
PDLVKSDEILQSVIDNLGLHNTTTGLRSRVSAVVNDSSSIVYIYATDSNPKQTVRIVKEVVKQLKKKASSMAGTGFNVSF
ATIQAPVEPTVASSPNVKANLAIGVVAGLIIAMLGAVLREMFDKGINDASDVQSIVRDPVLASVPKAHTVSNGVPAVITK
PRGRAAEEVRRLTTNISFVTPKDLNQPNVIIVTSTNPREGKTTVSVNMAAAFAEKGKSVLLIDADVRHPSVAPALGMNSG
VGLVSLLAGEVSAKEAIQPYWKSYLQVLPAEEQKTPSGIILGSDAMRQLIDQAAERYDYVIVDTAPMTVANDAAVFAEKG
GVLLLVVGQGVAQKKSLREVVKEFRISKTAIRGVVLNMVSVNNAGRSSYYYYEDHEDAGSSSKRKSKSGISRSKSKH
>gnl|bykdb|A0A2R9UAE0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. 71-36] (length=551 residues).
MDMQRVARILRAYWKAIVALTLAGGLAGFGWSALQPRVYTADASGYVASVSSDGSTSSALAGGTLALSRVKSFIDMGYWK
SVAETARDELGLTDSPESLVQRIRVSNPVDTVNVRVDATGPTPEAARDLAQAWLQGMTVQVDQLESTGGGHGAVKLVAGD
SARLPTAPSSPNEKLAIAVGALAGAVAGVLFALVRRAFDRRVRSAHDISDSVDVSVVGILPVDKELAAGRAVFSFDDIRD
GRGSFAHKEAMRELRTNLQYVDVDRPPRVMVVTSPLPGDGKSTTAANLAVSIAATGQSVILIDADLRRPVLGATFGFSDD
VGLSDVLAGRARIEQVAHQVDENGRLFVVAAGRTPPNPSEMVGSQRMQQLARTLADDMVVIIDSPPTLAVADAAVIANWA
DGAVLVVTAGRTTDDMLQRAVGNIAKTRGRLLGVVLNRVPLRGADSNYYGSQYGGYYGYGAPSSGVDRPRWWRRPWRRAT
VEKKDAGEQAPGPRRRSAELPPSNVRGLRTLASGRKGSPVPGDSGGEGEVSVAEPAADVPDDRTSRRRQRG
>gnl|bykdb|A0A2S3Z6L3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium zongtaii] (length=480 residues).
MELKDYLRIFHKSWILILALTLVGVAAAAGAAIATTPTYVASTQLYVSVKSSGDAGSGELVAGTSFARQAVTSYVDVVNS
AIVLDEVITDLDLDISAAQLAGMVAASSPLNTVLIDVSVTNDDPVLAAKIANAVGQNFSQIVVDQLEKPDGEAVSPVKIE
TIQPALVPGSPASPNVPLNIVLGLLVGLALGIGFAVLRSVLDTRIHSLHDIDLVTDAPMLGGITNDPDARLRPLVVHSDP
KNPRAESFRSLRTNLQFVNIEGGPRSFVVTSSIPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVAEYMGIEGGVGL
TDVLIGRAELADVMQKWGKNKLFVLPSGRVPPNPSELLGSAAMANLLAVLTEEFDVVLIDAPPLLLVTDAAVLSKLCGGA
IMVVASGRTKRNELSSALKALERAGSRLVGMVITMLPTKGPDSYGYGQYSYGTALEEEKSVEVRDVPGRRSFGKTRRRTA
>gnl|bykdb|A0A2S5UM02 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. AY1H1] (length=487 residues).
MELRDYLRILHKNWIIILICTLAGVAGGAGVSLLQTPKYSSTAELYVSVRSSDGAVVQELNQGTSFARQAVQSYTTVVNK
EIVTSRVIAELGLNMTPAELASKITATNELNTVVIEIAVTDEDPVQAASIANSVATNFIDVIVNELEKPDGASPSLVKIE
PVQSAQPSGTAVSPRVPMNVGFGALIGLLVGLGIAFLRQFVDTKVRSTHDIAQITDRPIIGTITFDPDAGKRPLIVHEEP
KSPKAESYRALRTNLRFMDIENTRHSFVVTSSLPSEGKSTTSANIAIALAEQGAKVVLVDGDLRKPKVATTMGVDGSVGL
TDLLSGRAEPKDVLQRWGRGRLYVLPAGRIPPNPSELLGSHTMQQVHDQLLAEHDYVIIDAPPLLLVTDGAVLSELAHGT
LLVVASGQTPRSALAGAVAQLEGIGSEVSGIVVTKVPTKGPDSYAYGSYGAYGAYYGTDEAGNPTTEYRKIGTGQMPIIS
AKSRRNN
>gnl|bykdb|A0A2S5UWU5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. AY1F1] (length=487 residues).
MELRDYLRILHKNWIIILICTLAGVAGGAGVSLLMTPKYEATAELYVSVRSSDGGQAQELNQGTTFARQAVQSYTTVVDK
EIVTTRVIEELGLDVTPEQLAEQVTATNELNTVVIAISVVNGDPTLAANIANSVATNFIDVIVNELEKPAGASPSLVKIE
PVQSAQIPSSPIAPRVPLNVILGALVGLALGIGIAVLRQVVDTKVRSTHDIAQITDRPVIGTIAFDADAGRRPLIVHEEP
KNPKAESYRALRTNLRFMDIENTRHSFVVTSSLPSEGKSTTSANIAIALAEQGAKVVLVDGDLRKPKVATTMGVDGSVGL
TDLLSGRAEPKDVLQRWGRGRLYVLPAGRIPPNPSELLGSHTMQQVHDQLLAEHDYVIIDAPPLLLVTDGAVLSELAHGT
LLVVASGQTPRSALAGAVAQLEGIGSEVSGIVVTKVPTKGPDSYAYGSYGAYGAYYGTDEAGNPTTEYRKVGTGQMPIIS
AKRRQKD
>gnl|bykdb|A0A2S5V715 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSSNVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDQFGLDVTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGESLKTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A0A2S5VJV3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=472 residues).
MELRDYIRILQKSWVLIAVLLFIGIGAAAGYSIVQTPKYSSSAKVFVSTSGGSTVSDLQQGNTFTQQRVKTYADLATTPI
VLLPVINELGLKLSSTELANTITASAPLDTTLIEISVTNVDAALSAEIATAVSENLAKAVNNIETASTTPGAESPVKLTL
VQHAEVPQMPVSPNVPLNIALGALLGLALGVGLAVLKEVLDNRIRNERDIELLSDAPILGGIVFDPKATERPLIVHDDPR
SPRAESFRTLRTNLQFLDVNRENRSFVITSSIQGEGKSTTVANLAITLADAGARVLLIDADLRRPRLHEYLGLEGAVGLT
DLLIGRAEPSDVIQPWGKGDLFVLPAGKIPPNPSELLGSEALVTLLAEFNRAFDIVLFDSAPLLPVTDGAILARLVGGTI
VVCAAGKTHKGQLKGALANLANVDTPVSGIVITMLPTKGPDAYGYGRYGYSYGYGDTGVPTESSPKVVASRP
>gnl|bykdb|A0A2S5VSE7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=538 residues).
MDPHDYWTALRRRWITIVALGLVGGGAAYGYASTLSPSYRSTSSVFVSSTQGQTTTELVQGSTFSQNLVQSYAQLATTPA
VLEPVIARLGLDVTPTALARSVTVDTPLNTVIIDVSVTDSSAEQAARLSDAVSDSLADVAGDLAPESAGGDPSIALTTVA
EAQVPRNPVSPNTRLIALTGILAGLALGVVYALGRQILDTRIRTERDVERVTDAPVIGSVERRDRADGVTLLAAPHSAAA
EGYRRIRTNLEFADVDTPIRSIAVTSALPGEGKTTTAVNLALALGEHSDRVLLVDADLRRPTVADQTGLEGAVGLTTVLV
GGASIEDAVQPWASGVHVLTSGSVPPNPNQLLGSAAMASLMADLTARYEFVVLDSPPILPAADALTLAHLTDGALLVTRV
RTTRRAQLAEAADALDGVNARTLGVVLTRVAPSRHTTYYGPVSTDGALVTTATPIASGASATAPAPADPTDGVHASPAPD
EIAAGTTTPQGATTPEDAATTAVDPATEASSETAVPAPRSARVEDQPALPRRTRTRSR
>gnl|bykdb|A0A2S5W290 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola sp. Z020] (length=474 residues).
MHIRNYLRVLQRSWILIAGIILVSVAASATYAIVQTPLYQASTKVYVSTSSSATTAELQQGNTFTQQAVKTYADLVSTPI
VLDPVIAQYGLAATSDELAKSVTATAPLDTTIIEITVTSDSAADAATIANAVATSFSTNVPALVPEAADGTPQVKISSVK
AATAPLKPTSPNVPLNIALGLIVGLLVGLGLAFLREALDNRIRSQRDTELITTAPVLGAIFFDPRAAERPLVVHAEPKSP
QAESYRSLRTNLQFLEFADLPHTIVITSSVAAEGKSSVSSNLAIALADANSSVIVIDADLRRPRLASYLGLEGAVGLTDV
LIGRVELADALQQWGEREMYVLPAGSIPPNPSELLGGPAMKKLLATLESEFDTVIIDAPPLLPVTDAAILAKATRGAIVV
ASAGKVHKAQLRSAIDILDNVGATVLGLVLTMLPTRGADAYGYGHYSYAYAEDETSSASAEPVQPVNDAPVAKT
>gnl|bykdb|A0A2S5W2F7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola sp. Z020] (length=523 residues).
MELSAYLRILRNHWIGIIVFIALGAGVASGWSIVQPRVYTADASGILTTGVSTDLGSALVGDNYAKSRVKSYLNVAKSRA
VANYAIDKLGLTSSPESLISSITVVNPEDTAVLQISAQGSTPTKARDLAETWVDGMTEQVNALENASAGAATGTAAAGPS
IVTLQTLDSAVLPTSPTSPNTRLAILIGLLFGLGLGIAYAVVRHTLDRRIRSVTAVEKEFGLPVVGTVPFDRNFTDTNRL
VEQSSTSNYVGRRTDDDAVSEAMRELRTNLQFMNVDNPPRIIVVTSSLAGDGKSTITANLATTIAASGQRVVVVDGDLRR
PTVAKSFDLLPGVGLTDVLVGRAEIEDVLQPWGDSGRLAVMGAGVIPPNPSELLGSMAMQSLLNELARDAIVLIDAPPLI
PVTDAAILTARTDGALIVASVGKTSIDALGKSLQNIAKVNGRALGVILNRVPRKGSSSGYYGYQYKGDYYSSEANAEGTA
APHVVPEYADVPREKARRAVRAERVVTEPEVAEAPVAPTTPLR
>gnl|bykdb|A0A2S5W2I0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola sp. Z020] (length=473 residues).
MTLEGYFRVIRKGWVFIVVFALLGIGAGAALAIAATPQYRTTTTMYVSVAVSDTPTAGDLTSGNNYAQAKVKSYVSIITS
ASVLDTVIAELNLDTTSKRLASQLSAESPTGTVIIELTATDSDPQTAANLANATAQSFSEAVVNDLEKPAGGGDSLVKVQ
VVDPALVPTSPSSPNVPLNIVLGLLVGLVFGLGAAFLRTALDTRVHGAHDVSSVTDAPLLGGISFDPESNKHPLLVHSDP
RNPRAEAFRALRTNLRFVSAGSDNHCFVVTSSIAGEGKSTTAANLSLALAETGVRVVIIDGDLRKPKLADYMGLEGAVGL
TDVLIGSVPLVDVLQRWGNRELYVLPAGRVPPNPSELLGSDAMQNLLSALNDQVDYVIIDAPPLLPVTDGAIISSMTAGA
IVVAGSGKVKRTELARALNSLTSIDSKVVGVVLTMLPNKGPDSYHNEKYGYYGAGPVDEEAETAPARRRRGRK
>gnl|bykdb|A0A2S5W320 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola sp. Z020] (length=488 residues).
MELRDYLRVLRKGWIIILALVLSGVAIGSVVSLLTTPMYVASSKVFVSVQSAGTVSELSQGSSFTQNQVKSYTDVVTTPI
VLQPVIAELNLPVSAQELASHVTASTTTGTVVVDIAVSDVSGQRAADIANAIASSFEKTVSSIVPVDAAGSSPVKITVLQ
QALVPAAPSSPNTRVNILISALIGLILGVAIAVLRQTLDTKVRNERDVEAVTTAPILGGIAFDPKTVERPLVVQDDPRSP
RAESFRTLRTNLQFLVALDRPKSYVITSSIPGEGKSTSSANLAIVTASAGTKTIIIDADLRKPKLAEYLGLEGGAGLTDV
LVGRVEMADVVQRWGTHDLYVLPAGRIPPNPSELLGSNAMIALIEQLEAEFDLVLFDAPPLLPVTDAAILAKHTGGALVM
VGAGRVHRGQLKGAISALTNVGSGIAGVVMTMLPTKGPDSYGYGRYGYGYGYGYGYGEEFDEPGSNDRKRRRTKGEVVEP
AKELTPSQ
>gnl|bykdb|A0A2S5W4G9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola sp. Z020] (length=528 residues).
MTIMDPHDYWKALRKRWIVIAILGVIGGGVAYTYAESLPDSFTATSEIFVSSTQGQTTSEVLQGSTYTQNLVQSYSQLAT
TPAVLTPVIAELGLDLTPSQLAKTITATTPLNTVLIQITVTNGDPQLAASIANSVGTSLSTTAIGLSPKNATDVASISMS
IVTPAQAPVNPIAPNRRLIEISGVAVGLAAGVLYAIGRAVFDTRLRTNRDIERITDVPVIGNVERRRRRDPQASGITMRM
APHSLIAEDYRRVRTNLEFADVDNAIRSIVVTSAMPGEGKTTMSINIALAMAERSMRVLLIDADLRRPSVATYAQIEGAA
GLTSVLVGSADLGDVIQHWAPNVDILTSGTIPPNPNQLLGSTSMARLLRTVIADYDFVIVDTPPLLPASDALTLTHMTDG
AVVVSLYNSTTRQKLSDALAALAGVRARTIGVVLNQTKPKARDEYYSSDVTKMGTTAPAASADGHAGTGTDTDADVNTEA
DTSIEANIVDHSDTDTVPVTVAGDSAAERIEEALSTRPSATSELRPVP
>gnl|bykdb|A0A2S5WZL9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. RFBG4] (length=486 residues).
MELRDYLRILHKNWIAMLICTLAGVAAGAGVSLVMTPTYSATAELYVSVRSSDGTEAQALNQGTTFARQAVQSYTTVVNK
EIVTSRVVEELGLDLTPAQLASKITASNALNTVVIEISVEDEDPQLAATLANAVSANFIEVVVDELEKPEGAAPSLVKIQ
PVQSAQVPHAPVSPRVPLNIVIGAVIGIALGVGVAALRQLIDTKVRSTHDIAQITDRPVIGTIAYDPDAGRRPLIVHEEP
KSPKAESYRALRTNLRFMDIENTRHSFVITSSLPSEGKSTTSANIAIALAEQGAKVVLVDGDLRKPKVATTMGVDGSVGL
TDLLSGRAEPKDVLQRWGRGRLYVLPAGRIPPNPSELLGSHTMQQVHDQLLAEHDYVIIDAPPLLLVTDGAVLSELAHGT
LLVVASGQTPRSALAGAVAQLEGIGSEVSGIVVTKVPTKGPDSYAYGSYGAYGAYYGTDESGNPTTEYRKIGTGQMPIVA
RKGTRK
>gnl|bykdb|A0A2S5XAY1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudoclavibacter sp. RFBA6] (length=487 residues).
MELRDYLRILHKNWIIILICTLAGIAAGAGASLLMTPKYESVSEVYVSVRSSDTSVTAELAQGTTFARQAVQSYTTVVNK
EIVTSRVVEELGLDRTPGQLAEQITATNQLNTVVIEIAVIDEDPVLAASIANSVASNFIDVIVNELEKPEGASQSLVKIE
PVQSANVPSSPVSPRVPINIAIAAIVGLALGIGVAFLRQLIDTKIRSTHDITQITDRPIVGTIAFDPDAGKRPLIVHEEP
KSPKAESYRALRTNLRFMDIENTRHSFVVTSSLPSEGKSTTSANIAIALAEQGAKVVLVDGDLRKPKVATTMGVDGSVGL
TDLLSGRAEPKDVLQRWGRGRLYVLPAGRIPPNPSELLGSHTMQQVHDQLLAEHDYVIIDAPPLLLVTDGAVLSELAHGT
LLVVASGQTPRSALTGAVAQLEGIGSEVSGIVVTKVPTKGPDSYAYGSYGGYGAYYGTDGDGNPTTEYRKIGTGQMPIIV
SRKNRQS
>gnl|bykdb|A0A2S5XFS5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1C5] (length=510 residues).
MSEFGRTRRRRPPRDPYQRRKSDSVELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATTGTDD
SQAIYTQQIAQSVAKSSLATYVPIATSRDVAQIAIDSLGLDVSPATLISAITVQADTVAPVMKVSATASTPEGAQKLADA
WVAAIATKVQQVNQETGVGDTVSLTVLQAAALPSSPAFPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLF
DLPVVGTLPVDKRLSETNRIVPEADTTDYIKADGKHALAEALRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLA
VTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDI
LLHEIAREAIVIVDAPPLLPVTDGAILTARTDGALVVISAGRTTTDELGKAIQNIERVSGHTLGVILNRVPARGQVGRGY
GYYYTSYYGSERSGARPDTAVEPEPASTSA
>gnl|bykdb|A0A2S5XT69 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1F3] (length=510 residues).
MSEFGRTRLRRPPRDPYQRRKSDSVELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATTGADD
SQAIYTQQIAQSVAKSSLATYVPIATSRDVAQIAIDSLGLDVSPATLISAIAVQADTVAPVMKVSATASTPEGAQKLADA
WVAAIATKVQQVNQETGVGDTVSLTVLQTAALPSSPAFPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLF
DLPVVGTLPVDKRLSETNRIVPEADTTDYIKADGKHALAEALRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLA
VTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDI
LLHEIAREAIVIVDAPPLLPVTDGAILTARTDGALVVISAGRTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGY
GYYYTSYYGSERSGARPDTAVEPEPASTSA
>gnl|bykdb|A0A2S5XYU9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter rathayi] (length=488 residues).
MELRDVLRLLRDHWIPIVAAILLGTVVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQAIYTQQIAQTVAKSNLATYV
PIATSRDVAQIAIDSLGLDVSPATLISAITVQPDTVAPVMKVSATASTPEGAQKLADAWVSAIATKVQQVNQETGVGDTV
TLTVLQTAALPSAPAFPNLRLVLAVGALVGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVP
EADTTDYVKADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVT
DGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERSGARPDTAVE
AEPAPTSA
>gnl|bykdb|A0A2S5YDZ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. AY1B1] (length=486 residues).
MELRDVLRLLRDHWIPIVAAILLGTLVAFGWSLTQKPRYVADSQGLVSVATTGADDGQAIYTQQIAQSVAKSSLATYVPI
ATSRDVAQIAIDSLGLDVSPATLISAITVQADTVAPVMKVSATASTPEGAQKLADAWVAAIATKVQQVNQETGVGDTVSL
TVLQTAALPSSPAFPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVPEA
DTTDYIKADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVAK
SFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTDG
AILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERSGARPDTAVEAE
PASTSA
>gnl|bykdb|A0A2S7NEL0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. EPG1] (length=495 residues).
MSLLDVVKLLRLRWMTVCLTAVAAVLVAVAMSLLTTPLYQATTRLFVSTTAGSSLTDAYQGNRFSQERVVSYAQLLMGET
LAQRTVDKLGLDMTAKELQANVTATAKIDTVLITVDVLDSSPVRARDIANTLSDEFVVMVRELETPASGAEPDSRVVVEQ
RASVPSEPVVPKTTRNILIGAALGIILGIALAVVRDLLDNTVKDRESLEAITRTGMVGSIPLDKERRRQAAISFDADNSG
IAEAFRKLRTNLQYLSVDNPPRCIVVTSSMPSEGKSTTAINIALALAEAEHNVVLVDGDMRRPTLHKYLDLVGTVGFSTV
LSGAATLGDALQKTRFPGLTVLTSGAIPPNPSELLGSQSARKLLTELRSKFDFVVLDSTPLLAVTDAAILAAGADGVLLI
ARFGQTKRDQLTHAVSTLESVGAPLLGAVFTLMPTRRGSSYSYNYSYYGVEPQKEQNGKTQPALGPPPRASVEIATPQAE
DPAEPEGGRRRKGAD
>gnl|bykdb|A0A2S8KQU3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium austroafricanum] (length=502 residues).
MQLQDFVKLLRGSWLIVTVATALGVLGAVVLTLLTTPLYQASTRLFVSTTSGSSLADRYQGNRLSQERVISYAQLITGET
LAQRTIDKLGLEMAASELQANIHANAIPDTVLINVQVRDPSPVRARDIANTLSDEFVALVRELETPENGGIPDARVVVEQ
RASIPDHPVVPSTLRNIAMGLAFGLLGGVGLATVRDLLDNTVKSREVLEEIAGVGLVGSIPLDKDRRKHAAISFDSDNST
TAEAFRKLRTNLKFLAVDNPPRVIVFTSSNPGEGKSTTAINTALALAEADHNVVLIDGDMRRPTLAKYLDLVGPVGFSTV
LSGGANLPDALQKTRFPGLSVLTSGAIPPNPSELLGSQSSRRLLSELREQFDYVIVDSTPLLAVTDAAVLAAGADAVLIM
AHFGKVKREQLAHAVGSLERVGAPLLGAVFTMTPTRGRSSYSYSYSYSYYGPEGAQRLAAKEPAAPKEDVPHTAPRRHSA
AVGEVNPDVVEQSSGRRRRGEP
>gnl|bykdb|A0A2S8KZ97 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. ITM-2016-00316] (length=489 residues).
MKLQDFAKLLRSRWLIVCATLAASIVLAIIVTAMTTPLYKASTRLFVSTESGSSLAEAYQGNRFSQERVKSYAELIEGQT
VAQRTIDKLGLDITAGELQEKVTASAKLDTVLINVSVLDESPVRARDIANSLSDEFVVMIRELETPEPGATPDARVVVEQ
RASIPERPVTPDTTRNIGLGVILGLALGIGLAVLRDMLDNTVKDRATLEAVTGSGVVGNIPLDKERRKNPAISFDSDRSA
ISEAFRKLRTNLQFLAVDNPPRAIVITSSMPAEGKSTTAINIALALAEAEHNVVIVDGDLRRPSLHKYLDLVGTVGVSTV
LSGGASLSESLQKTRFPGLTALTSGAIPPNPSELLGSQAAKNLLAELRAEFDYVIVDSTPLLAVTDAAILAAAADGVLMM
ARFGKTKRDELSHAVGSLEGVGAPMLGTVFTMLPTRGGSAYGYGYSYYGGDNTQSPLQQDRTSTPAETPSPQNSAQGVAA
QAQKHEVPE
>gnl|bykdb|A0A2S8UC18 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. MYb43] (length=450 residues).
MGESRVSLRAIASSLRKFWWVIVLCGVVGAAGSFVNASLQTPLYQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRVTGTADDAKASAELADAVADQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLIGVLDTRMRNEETLTEAGGDPVLGVVSQSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A2S9A622 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. MYb64] (length=492 residues).
MDLREYLRVFRAHWLGMVLITLLGVAVAFGWTLLQPKVYTADASAIVQANTAGDAGDSNLSSAMLGNSLTSGRVKTYVAL
GQSRAVADGVIKDLGLDVSADQLVKQVTVTNTVDTTTLKVTADAATPEKARDVAEAWVRSMGAEVNRLETSDPAKKGAVF
LSPIDSARLPDSPSSPNTRLALALGGLVGLAIAVGYGLLRYTLDRRIRSVEQVERETGKPVVGTIPEEKTFTADNRLLPF
DGGTSSSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMI
DTVFGLPRGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMRELLKSIAREAIVIIDAPPLIPVTD
AAVLAHSADGAVIVGTIGKTTFEVLGKAIGNLERAGARALGLVLNRVPKRGSGAAYYGYQYHGEYYRGDDQELPTGAVRG
DKPRRRGDAEAA
>gnl|bykdb|A0A2S9AA20 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. MYb72] (length=482 residues).
MRTRRVRSATSSHGEATLAGTGGARMKADATGWSLASAWSAIRKFWYVIIGMAIIGGAVGYGISATTTPQYQSTATLYFA
MNQGTTGTDLNQGSTYTQSQMLSFAQLATSSRVLAPVIDELGLDITPKELVRSIAITIPQDTTILSVQVTSTGAQRATDI
ANAISEELSSAVKTIVAKGVDQKPTIIPSVIDEAVVPQFQSLPNKSKDAGLAAVLGLVLGILVAFIATIADTRVRNEAAL
ARVTDLPYLGSITRTKRGTDAGLIVVREPRSHIAEDFRRVQASLAFANIDGQSRRLLITSASPAEGKSTFSANLALTLAD
LGENTLLIDADLRRPRIGEIFGLDAAVGLTSVVLGSAELSEAVIPWREGGPDLLLSGEVPPNSASVLTSHAFAEVLGAAS
EGHDVVVIDSPPALTVADTNLVAPLVDGVVIVVDASKTSRPQLAATIRTLEGSGAPIIGIVLNKVRLPRSRTTYYAQEKS
SS
>gnl|bykdb|A0A2S9BKI0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. MYb45] (length=493 residues).
MRGDEELELRDYARILRAHWIVIVAATLVGAALAFGWSSLQPRVYSADTTGIVTAVGGDGTSGSALVGNQLAQSRVKSYL
NLGSWRAVAEHAIDELDIDASPDVLVNRVTVTNPVDTTALKVTATGPTPESAQALAQAWLDGMAIEIEKLEGGTAETPAA
ISLIVGDSARLPSTPSSPNTRLNVIIGALAGLALGLVYAFVRHTVDRRVRHPRDIERETGVSVIGTLPLEKSIAGERQVI
DFSLESQHGVSHHLIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVSVNLASSLAAAGQWAILIDCDLRRPVIAD
IFGMSHDVGLTDVLAGRAELQDVAHRPSRDIPLAVVGAGRIPPNPSELLGSQRMRDFLAEISKSAIVILDSPPVLPVTDA
AVLAANADGVLIVVSSGKTTFDMLQRAIDNITRTTGRVLGVVLNRVPRKGAESAYYGREYYGAYERYAKDGADSESTEPD
AAPGVRRRGTAQV
>gnl|bykdb|A0A2S9BL32 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. MYb45] (length=450 residues).
MGESRVSLRVIASSLRKFWWLIVLSAVLGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELDLDTTARALARDIEVSIPQSTVTLRVTGIADDAEASADLANAVADQLIVAVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAVAILIGVLDTRVRNEETLTQAGGDPVLGVVSKSPLLVTRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTVPPNPAELLTSSRMAQLLDFAAAEYDYVVIDSPPTLSVADANLFATQTD
GVILVVDATKTRRAALTKSIRSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A2T0RDM1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudosporangium ferrugineum] (length=531 residues).
MDLRDYLRAVRKRWWLVAGAIAVSVGVAIAVTLLTPPRYAASVTFFVSTRGTEVTQAFQGGQFAQQRVKSYVDVLTSNRL
AQAVAVSEPPGLTAEEIQDEITAQVVPDTVLVQATVTDTDRARALRLAQRLAVQFPELISKLETPPGSKTPTVGVQIIAE
PKLAEAPVSPQPVRNIGLAVALGLIIGVGAAALRESLDSTIRTPDTLHEAASAPVLSTIPFDRKAEKSPLITEGSAQSTR
AEAMRQLRTNLQFVNVDRPLRSLVVSSALPGEGKSTTVCNLGIAFAEAGKRVIIIDADLRRPRIAEYLGLEGAVGLTNVL
AGQANVRDVVQPWGKSGLWVLPSGYIPPNPSELLGSGNMADLLTALGTAFDVIIIDTPPLLPVTDAAVMSTIADGCLLVS
RHAKTTVSQAQTASAALASVSAKLHGCVLNMVPAKSAGSYAYYSYTTTTDESAPAEPVVPPRPRVEKPAAGPLPLSPFRP
DQVQAAAPRTEPRSARRARLADTPTTDLSVYRKTPEGRYEGTAPVPGVRRQ
>gnl|bykdb|A0A2T0TUL3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus tzadiensis] (length=486 residues).
MGSAVVVGAVRRRWRWVVAAVCVCLLGAVLHTQVAAKSYRATAEVFFTLQYGDSASDLVQGATYTRNQVASFARLATTPA
VLGPVVDDLGLDVPVSELAGRVQAAAPVDTVLVEITVTESSATGSARVANAVAASLADVVEDLAPEDAEGRPTIAAATVT
PAEEPPGQASPDPLLDLAVGLAAGLLLGLALAWGRDVLDSRVRDADALREVTPLPVVGTLGVLPRGLGRRPVVAADPHHP
QAESFRQLRTNVQFLQVPDASPGDRAASAHVVLTTSSLPGEGKSTVAVNLACALAETGARVLLVDADLRRPTVATALDVE
GVVGLTTVLAGHAALDDVVQEWGTSGLAVLPSGQIPPNPAELLGSPAMGHLLEQVRARYDHVVIDTAPVLAVTDGVVLSR
AVDGTLVIANASRVRRAQLAESLHALSQVGSRVLGVVLNQVHRSEDSYSYQRVPDAGGADPRAGGTPDGPARTPVPLPPV
PAGRRG
>gnl|bykdb|A0A2T0V3B1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Glaciihabitans tibetensis] (length=492 residues).
MELRDYVRILRKRWLAIVAAVLLGVAVAAAATLVSTPRYEANTLVYVQVQSSGSIGDLAQGSSFVQSQVASFAEVVSTPR
VLDAAIKTLNLSESADALAADVIASAPLETVNIRITVTRDSPGEAAQIANAVTASFRQVVGEITESSGANPTSQVSVSVL
RDASEPTAPISPDTRLNLILGMLVGLALGLTFAILREVLDTRIRGERDVAAITSAPIVGGIGFDPRAVQKPLIVQEDPHS
VRAEAFRTLRTNLQFLDVESGARSFVITSSIPSEGKTTTAANLAIALADSGAQVVLIDGDLRRPKIASYMGLEGAVGLTD
VLISRVELADALQAWGRGNLVVLPAGAIPPNPSELLGSKAMSSIIRTLESEFDVVIIDLPPLLPVTDAALVSKLTSGALV
VVAAGRTHKGEFAGAIAALENVGASVAGVIMTMMPTKGPDAYGYGGYGYGYGYSSQTPESSTVVPDGPEQPRKRLSPEWG
NAEMPGADVKPV
>gnl|bykdb|A0A2T0YF73 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nesterenkonia sandarakina] (length=457 residues).
MELHEYLRIARRGWLIIVLATLAGIGAAATFSMLQSPQYEAGTRVYVSTDSASTVAELGQGTTYTQQIVQSFVQVTATPR
VLQPVIDELGLEQTPTELSESVAISTDVNTVLMQITATDEDPAVAAEIANAVTDSLIEVVGEITPGSSGEDSAVTVEVLQ
QAVAPETPVAPRIPLNLTLGLLAGLVLGVGIAVLREVLDTRIRGEHDIAAVTDTPLLGGISYDPEAPKRPLVVQVDPKSP
RAESFRTLRTNLQFLEVGETKRSFVVTSSHQGEGKSTTVANLAITMQEAGQRVLVIDADLRRPRVADYFGLEGAVGLTNV
LIGRVDLEDVVQYWGPHDLAVLPAGDIPPNPSELLGSPSMDALLRFVKEQFDVVLIDAPPLTVTDAAILATRATGAIIVV
AAGRTHRHQLSRSVVALEHVGAKLFGVIPTMLPTKGPDAYGYGLYNYAYTYEEDRRA
>gnl|bykdb|A0A2T0YQH3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nesterenkonia sandarakina] (length=452 residues).
MELHQYVRVLKRGWLTLVLSVLVALAAAAALVALLPVTYEAETRIYVSVDDAESYDLSQRSIYSQELVRSFVELAQSSAV
LGPVVEDLDLEETPRELADRISVAAQTGTVILEVTVADDDPEQAAAIATSMTAALDDVVQGLTTSTAGSGNVTLTTVEEP
FTPEGPSFPQPVNILGLGLLAGLAIGIVLLALREVLDTKVRSEEDIAELTDQAVLGGVQYDRGLQKGQLIAHTDVGSPLT
ESFSTLGTNLQFLAVGQCARSFVISSAIEGEGKSSIAVNLAISLRDAGYRVLLVDADLRRPRVAPMLGLEGAVGLTDVLS
GRVDLPDVVQLWGPDELEVLPAGTVPPNPIELLGSEAMAELVAALQREYEIIIFDAPPLLPVSDARVLGALCSGVLLVVA
VGKVQKPQLKKAIEALRLVDVKLLGLVPTMLPPKAIVGYSSAYRQSVGVEAR
>gnl|bykdb|A0A2T3C430 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter woluwensis] (length=622 residues).
MWLSTIAPTTHSGAFPVSGFPLSNDGGPPGSDWLARTSCPSTFPPTRRTTNHSLPAHHFAASSGRFSPLACDTNVNLKLL
SNTLDPRARMFRMPGLCTGAGTLSSPHHQGDMYMELTDYWRILRAHWVSVLGITVLGVLVAFGWSLLQPKVYSADASGIV
SIGVNKDIGTAMAGESYSKSRAKSYLDVAKSRTVAERVITDLKLKDIAPEQLISRISAQNPLDTATLKFTAEANTPEGAR
DLAEAWVKAVGQQVAQIENAGGTSKEKSIVVFQSLDSAQLPTSPTSPNTKLALIIGLAAGFIVAILYAFLRNVFDRRVRS
AVQVEAETGLSVIGTVPFNKDFDSTHRIVASHGGNDLDNTSQQDHAVAEAIRELRTNLQFMDVDNPPRIIVVSSALPGEG
KTTVVANLAQTIAASGQRVVVVDGDLRRPTVAKTFGLLTTIGLTDVLIGRANLNEVLQPWGESGNLYVLGAGSVPPNPSE
LLGSNVMQKMLQDIAKHAIVLIDAPPLLPVTDAAILTAQTDGALVVTRSGKSTYDELKRALQNLERVKGRPLGIIINGVP
RKSASGAGYGYQYYTYYNRKDAGDKSPRASHVPATESTPVSETEPVELEPQRHMRRRDRSRA
>gnl|bykdb|A0A2T3G840 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium callitrichos] (length=495 residues).
MNEPEEGQQDGLTVMDLLMAVRKHLITAIVTLVIVVAAVAGYTFTRTPQYTATSELLATYRTSASSNNSGAGTELNSGAS
YLTSQIQTYPQLVKTESVLQPVIDDLGLNTTVTDLATTVTASNPTDTMLVDISVQNDNPKDASNIANAVAKSLKEQVTST
LYSDEGDKIVSPVNLTIVQQAYAPASPSSPNINLYLAVGVLSGIILGIVAALIKDLMDTRVRQDSDVTAIVDAPVLGGLT
RNDAYDDKATVIIAHPASREAEEVRRLRTNVAFVLPDEKFSNVIVVTSAGPAEGKTTTSVNLATAFAENGSKVLLIDADV
RNPSVSKKLDIEGTVGLTHLITNRVSSQDAIQRYWKPNFHVLPAGKQNLNPSILLNSRAMKALIVQVAGAYDYVIIDTAP
MQVANDAAVFAKDGPELLLVAGVGVTEKKQLKQTEQELETLNIKAAGVAMNYVEAEKPQKSGYYYYGDDADGKGKKGQHG
EDKKSKILKNDDNKA
>gnl|bykdb|A0A2T3GJ40 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium callitrichos] (length=499 residues).
MNETEQVQDVITIDVLGALRKHWITAVVTLVVVFAAAAAYTFTRTPMYTATSELLATYRSSSGAAAGSAGNELNSGASYI
NSQIQTYPQLVKTESVLQPVIDDLGLKSSVKELAATVTASNPSDTMLVDISVDNADPKSASTIANAVAESLKKQVTSTLY
SDEGDKIVSPVNLTVVQQAYVPASPSSPNVRMNLAVGVLVGVVLGLVAAVVKDSLDTRIRHESDIAALIDAPILGSIRRN
DLYHGKTPAVISKPASREAEEIRRLRTNLSFILPEAPRSNVIVVTSAGPSEGKTTICVNMATAFAESGAKVLLVDADVRN
PSVSKQLDLEGTVGLTHLITNEVSSQEAIQKYWKQNFHVLPAGAQRINPSILLNSRAMKSFIDQVSDAYDYVIVDTAPMR
VSNDAVVFAKEGPQLMFVVGLGVAEKRLLRKTMQELDTLDVHPIGVAVDYAENDNMQKTGYYYYGDSYQDPSSTSSDAAS
GSGAANGRPGERNKHKARS
>gnl|bykdb|A0A2T3V950 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. RP3T] (length=484 residues).
MNVVGYLRLVRRHWWIVLVTVMLAVAAAAVLTVRAAPRYQASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRINTSTTTGTVLLRATFTDTDQNRALKTTETLSAKFVELVRKVETPPDGKAPPIKIEMVSG
PRVTSSPVSPRPARNLALGGLLGLLAGAALAVLRGMADVRMRDAVALQRVTGSPLLGEIPFEAGAKAAPLIVGDAATSVR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNIAIALAEAGWRVLLIDADLRRPKAADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRGQVAAAARALSSVSVRLLGCVLNMAKVGKADAYQYETYKVVVPPAAPAVPADRVGATQRGAQTVVGDRTQELT
RLSR
>gnl|bykdb|A0A2T4UC78 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Conexibacter sp. Seoho-28] (length=504 residues).
MNDASTSITLPALYAVVRRNAAIILFTIGLAVGTSVALSAATDPVYEARSAVAFNDNSADLQALGIPASPDFQPDKAAAA
QAERITRPDVIAEVRRTLRVDLSVQEIQDSVSTQVDPASNLVSIIVEAPTADLAARLANGLAAAVRDDATDRVKARYREG
GRAAQRRANRLKGDRNLARRAVFEDQAARLLALASFATPVDVVRTAEVPEGPSSPKPVRNGVLAALLGAILGAGLVFLRQ
TFDRRLREVDEVREQIDLPIAGFLTTRALGHVAFPGSGDKKPKEQDTEAFRILRTNVGFLDPAGPPKVVLVTSPLPEEGK
STTASGLAWAEAVASRATLLVDCDLRRPTVAKRLGLPASPGLTEFLAGEAEPADILHTVDAGDGSKLVVITAGGHTSNHA
EMLVSERFREFLAQVSDVYDRIVLDSAPLLPVSDTIGLLPQVDAVLLCLRLGQTTRDDATAARNALDRFPDATVGMVLTA
ADKSQRPYYAGSYAYTSLPASERA
>gnl|bykdb|A0A2T4UY28 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter caricis DSM 15933] (length=509 residues).
MQQSQGSPSPTVVRRSESVKEPATLELRDVLRLLRDHWLPIVAAILLGTLVAFGWSLTQKPRYVADSKGLVTVAVPDSGD
GSQDLYGEQIAEALAKSRLTTYVPIASSRDVAEIAIANLGLDISPSALIGAITVTSETAAPVLSVTAEASTADGAQKLAD
AWVSAVATRIQQINAETGSGDSVSLKVIQDAALPSSPDFPNLRLVLAVGALAGLVLGLVYAFVRNTLDRRIRTAEMVERL
FDLPVVGTLPVDKRLSETNRIIPEADTTDYVKADGKHALAESLRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANL
AVTLAASGQRTVVVDGDLRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMD
ILLHEIAREAIVIVDAPPLLPVTDGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRG
YGYYYTSYYGSEKTGARPESASEPTPSAV
>gnl|bykdb|A0A2T5N7W6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sphaerisporangium cinnabarinum] (length=505 residues).
MTLREYVTAVLRHWIVVAVCAVLGAVAGFGYARSEPKVYQSSASVMVVPEQGENAAELVQGSNYVQNLVASYAVLAQSPY
VLEPVIEDLGLDTTPARLARSVSVNTPLNTVVIEIAVSDTSPDRAREIADGISDQLALAVPELSPQLADRSSAVRITTIA
PARQPVNPIAPNTRLLMMVGLAAGLAVGVTYAVLRELLARRVVSSSSIQSMLGVPFLGEVVKVPSRTSLPAVVAAGPGSR
PSESVRTLVANVRFADVDHGRRVLMVSSGDAGEGKSSIAISLALSLAEDGSSVLLVDADLRRPSIARVTGLEGSVGLTNL
LVGDVAQEDIVLPWTRPNLFVLPSGVLPANPGVLLSSERLVAVIGDLRTHYDYVVIDTAPILPLSDPLWLSRAVDGVLVV
ARARKTRISRLRQTVDKFERGEADVIGIVLNDVKPRGRSAYYVNDSRVGVPGAFTREPGSPDVRAAAATGEAAATGDASS
AGDASPAGGAAETRAVEDADRRTRP
>gnl|bykdb|A0A2T5W3Y2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. CF204] (length=466 residues).
MDFKELLRTLRRRWKTIVAITLIAMAGSLFLSLRTDPLYQSTAKVYVSADTSTLQDQYAANVYVQQRVASYAQLASHRVL
LARVADAAGLDMTASDLAGRVHAIVEPETAILDITVTDTDPERARKIGDVQAAELVKFVQELETPSTSEHSPILLTVTDP
ATYNGTPVSPQTMLNFMIATLIGLTMGVGLAIARELLDQTVKSATDVEKAADVPLMAAIGFDSTVEKSPLVLDISSFSPR
AEAFRLLRTNLQFLDLDHPPRAIVITSSVSGEGKTTASTNLALALAQAGRRVLLVDGDLRRPRVAQLMGMDGSIGLTTVL
VGRTKLEESIQKHKESGVHVLASGPTPPNPSEILQANATLDLLGRLRDAYDIVIIDAPPLLPVADAALLATAADGAIIIT
RHGKTTRDQLEGAAHRLAAVGARTFGVVLNMAPKRFGEMNYYYYYAEEAEPSKGSGSSKRAGSRKA
>gnl|bykdb|A0A2T5WJZ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. YR782] (length=541 residues).
MNLQEFAKLLRTRWITVCVTTLVAVLGAVAYTFATTPQYQASTRLFVSTSSGSSLNDLYQGNRFSQERVLSYTELLMGET
LAQRTIDKLNLDMSAEDLKEKIKASAKPDTVLIDVAVLDPSPVRARDIANALSDEFVLQVSELETPPKGGVQADARVVVE
QRASIPSAPVVPNPPRNIALGLAAGLLLGVGLAVLRDRLDNTVKDRETLEEITEVGLVGGIPMDKERRKEPAISFESDNS
GIAEAFRKLRTNLQFLAVDNPPRVIVVTSSSPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPSVDRYLNLVGSVGFST
VLSGGASLAEVLQETKFPRLTVLTSGASPPNPSELLGSLAAKNVLSELREQFDYVIVDSSPLLAVTDGAILAANSDGALV
MSRSGQTKREHLAHAIGILRDVGATVLGAVFTMTPTRRGGSYSYSYSYYGEDRREPSTQSAAPADAAALGKESNTEVPEG
SPVNGTKVTEPEPQASADFDSTAAESATSAEVSGPATNAVTPSAKGARSSTKSVRPSTNGS
>gnl|bykdb|A0A2T5ZWX4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. CF167] (length=477 residues).
MSVAHGTDSKGWVLDFKQFLVVLRRRWLTVVLLIVIALGVAAGITFTRTPMYESKAQVLLTVDVTNASDSYSTYFTVTQR
ATTYAKVAKSTELAEQVIDQLGLKITPEKFADRVGAEVVEATSLIEIKIKDENPRDAQKIASVFTEQYTDYVQNLERLTG
GENTVQLKQTDQPTYNPDKVSPTTLLNFIVAGMIGLLLGIGLAVARELLDRTIRTADHVAELTEAPVLASIGFDGDIRSA
PLLTDLGGFAARTEAFRLLRTNLQFIDLDHQPRCLVISSAVPGEGKTMTSTNLAVALAQTGRNTLIIDADLRRPRVATTL
GLDPAIGLTTALVGKTEIHDAIQVHEASGLHVLASGAKPPNPTEILQSKITHDLIRRLRSSYDMVIIDAPPLLPVADASV
LAKLADGVIVVVRHAKTTKDQVNEAINRLNQVGARLYGVVVNMVAKRAVGSYYYYYYEETAPSGRGKGGSSGGRRRA
>gnl|bykdb|A0A2T7V028 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. TPD3018] (length=737 residues).
MLSSQPRLKAPGAASILPVAASGDRLPILRQYLRIALRWRYVIIGAVVSCILLGTVVTLLMTPKYTATATIEISREADKV
TNIPGVDREASVADQEFYQTQYGLLQSRSLSERVARQLRLVDDPKFYQMFGATSNDPAFQLVNGRYPVSGQAIRQRAAGE
ILLKRLNVDPTRLSRLVDLHFTSPNPDFSARIANSWAENFIETNLERKIQATSYGRNLLQRQLADYKQRLDASQRQLVGY
ASAEQIINLPSQTASDNRTTSERSIVADDLAALNTALSQATADRIQAEARYEQAGRAGASTEALRNVAINNLRQRRAELA
AEYQQLMVRFEPGYPAAQALKSQIDQLDRSIGREEGRVSGSLQADYREAQQRQNALQAKVNQLKASYLDLRRRSIQYNIY
QQEVDTNRALYDGLLQRFKEIGVAGGVGVNNVAIVDPADVPQKPSSPRLLLNIAASILAGLVIGAALALALEQIDEAIAD
PAEVERRLGLPLLGSVPKVEDQTPKEALKDRKSELVDAYLAIQTNLAFTTEHGVPRSFAVTSTRPAEGKSTTALALATTL
ARGGRRVILIDGDMRSPSVHHLGGVDHDRGLSNFLSGDDNIGALTFSMKDLGFTAMSAGPIPPNAAELLTGNRLSLLIER
LLESYDHVLIDSPPVMGLADAPLIAGRVEGVIYAVEAHGIRATMVQIALGRLSSANAHVLGGVLTKFEARKVHSGYGYGY
GYEYGYSYGRDRSAAKA
>gnl|bykdb|A0A2T7VFI1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. TPD3018] (length=750 residues).
MASIPVPYDGAHFDGARHDPAYGHRRAMVAPVDRPAPQAGVVDLIQAYRRHLTLFLLVAGGIMALVAAYTWLQTPRYTAT
ATLVIAPHPAEIGSERTSALSDPAADSSVDTQVELLKSRTLAGLVVDRLDLADPARFAHLVATPSMRDAVPGLARTPQPV
PASASTRRDAAIDRLVQGIDVHRTAQTFALSVSFEHPDRRLARDIVNSYAETFVAQSGAVKREGSDAVAALLRGQLDKAR
REVEAADGALGRYKVAHNLMSVQGGTIAEQQLSSLDGQVALARAGEAEASARLQTARQQLAHGSTGDDLGEALGSPVIQQ
LRSQRAVVSAQVADLGGKYGPKYPPLAAAQRQVADIDSQIQGEIRRTISNLEAQRDVAARRTASLNGSAAGARSQVVSNN
VASVALGGLQLRSDTAHQSYAQLLTRLNEIGAQGASTRSDARVASLAALPTHPTSPNRPINLLVGALLAVAVGLAAVFMR
QGTDRGIRTLEDVEGRLQMPYLAGLPTLGSAVRHVGGSDPISALVDHSGSAYAEGYRNLAASVLQSAAAGTVRTIALTSA
LPNEGKTTAAIGLARIVAMSGVSVVLVDADMRRPSIANALGLRPAIGLQQVLEGEAALDEALLPDIDSPLTILPMLRAGL
GGSAALGNGSFDGLIEDLKARFDVVIFDASPVLPVVDGRLVAKKADATVLLVRWRKTPDAAVEMAIHLLQTLGVKMTGVA
LSRVDLHALARSGYGDPAQFMGSYTAYYAN
>gnl|bykdb|A0A2T7X0Z6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. TPD7012] (length=494 residues).
MSIGDYVRILRAHWIVIVVVTALCGGVAFGWSAMQPRVYSADTTGIVTAVGGDGTSGSALVGNQLAQSRVKSYLNLGSWR
AVAEHAIDELDLDTSPDVLVNHVTVTNPVDTTALQVTATGPTPKSAQQLAEAWMRGMAIEVEKLEGGTETTSAAVELIVG
DSARLPAAPSSPNTRLNIVTGAVLGLALGLLYVLLRYLVDRRVRHPRDIERETGVSVIGTLPLEKSMSDERQVIDFSLES
QHGVSHHTIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVSVNLASSLAAAGQWAILIDCDLRRPVIADIFGMSK
DVGLTDVLAGRADLQDVAHRPSRDVPLAVVGAGRIPPNPSELLGSHRMRDFLAEISKSAIVILDSPPVLPVTDAAVLAAG
ADGVLIVVSSGKTTFDMLQRAIENITRTTGRVLGVVLNRVPRKGAESAYYGREYYGDYRGYGRDAEPDVDKQIPVEPGPR
RRGAGAGARASATK
>gnl|bykdb|A0A2T7X614 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. TPD7012] (length=485 residues).
MELRDYVRILRAHWIVIIVATIIGAAAAFGWSAIQPRVYSADTTGIVTAVGGDGTSGSALVGNQLAQSRVKSYLNLGSWR
AVAEHAIDELDLDTSPDVLVNHVTVTNPVDTTALKVTATGSTPESAQALAQAWLDGMAIEIEKLEGGTTTSPAAISLMVG
DSARLPSAPSSPNTRLNLIIGALVGLALGLVYAFVRHTVDRRVRHPRDIERETGVSVIGTLPLEKSMSDERQVIDFSLES
QHGVSHHTIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVSVNLASSLAAAGQWAILIDCDLRRPVIADIFGMSK
DVGLTDVLAGRADLQDVAHRPSRDVPLAVVGAGRIPPNPSELLGSHRMRDFLAEISKSAIVILDSPPVLPVTDAAVLAAG
ADGVLIVVSSGKTTFDMLQRAIENITRTTGRVLGVVLNRVPRKGAESAYYGREYYGAYERYAQKEEDTEAETPEPGVRRR
GAAQV
>gnl|bykdb|A0A2U0BRJ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAGELSSG
ANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTTVIDAPVLGS
LSRNEAYVGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSAGPSEGKTTLSVNLATAFAENDSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMRALIEQVAEAYDYVIIDT
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLFRQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDESDDNGRKRQ
IQHKKSEKMKKD
>gnl|bykdb|A0A2U1EFT5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Promicromonospora sukumoe] (length=560 residues).
MELAEYANVLRRRWAVIVCTALVGALAAFGYAWSTPPSYTATAKVYVSLNTGESTSDLLQGSTYVKNLIESYAALTDMPV
VLDPVAADLGPGITGRDLAPAVSADSPLNTSIIEIKVDDGDPERAAVIANAVAQQLSTTVVDLSPETPTGEQAIAVTTVS
AAEVPRYPSAPRTRLLVAAGGAGGLAISVALVLLWAVVDTRIRSSQDLEVVSEGTALLGSIPLVKRKAARVPATHEPLST
RAEAYRRVQTNLSFVDATTPARVLVVTSSVPGEGKSTTAINLASTFAESGSRVLLIDSDMRRPSIATVLGLEDAAGLTTT
LVGRSAMTDLVQRYGPGPLDVLPLGPIPPNPHQLIASDATRDLIAAARAAYDIVILDAPPLLPVSDAAVLSTMADGVVVV
VGARRVRRQQLTQAMRSLAGVDARVLGFILAFAPRSGPGGSYYGYSTNRRRKLRFLPGRRHHDTLDLPPITGTISAVPGA
GKVPSGIPGPGIAPILGKASGPSSVPRGGVVPGPEGIPGPDTIHGPGGIPGPGARLTPGPPPRPIPPVVADLGTADERAG
>gnl|bykdb|A0A2U1ES11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Promicromonospora sukumoe] (length=585 residues).
MTAVTLAGIMLAGLFALTRTPAYTTSSQVFVSFHGAESTSELATGTSYVQRRVVSYSNLVRSPQVLDPVIVELGLDTTAG
ELGTRVQAAPVTDTVLIDITATDADPTVAARIANTVAESLAERVDELETPQQTVDSPVQLQMVREAAPPGSASYPNIPVM
IFVGFLLGAALGIALAVLREIADTRVRSEQDVRAVTDSAVIGAITMDDEAEKNPLVVQTSPYHTRSEAFRRLRTNLQFLD
LDGGPQAFVVTSSLPDEGKTTSAINLAITLADADSRVLLIDADLRRPSVAGYLGIEGSVGLTTLLIQRATIDDVIQPWGS
AGLFVMPSGVVPPNPAELVGSKAMARLVHEMSEQFDYVIIDTPPLLPVTDAALIARMTSGVLMVAGAGQIRREQLRQSLT
NLSTVSARVLGIVLNKVGRSADTYGASYGYEYQPRTEDTGGKSGRKGRGAGRKKSTRVAHVAQPAQVMRPARPAPVQEPT
AGARAADPAPAERTAEPLSVVQPAQPVGPRPAGPPAEHTSVTADGAPTNGIPPRRSTVPRIPRIAPMWAPVRSDDAGSGV
APTSKLQAVQVSDGPLSTQNGPGNH
>gnl|bykdb|A0A2U1ZYD2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Miniimonas sp. PCH200] (length=523 residues).
MTSTSTPGGPTRPLAAPHPGGAPMVLSDHLRIVRRRWMLIASMVLLGTLGAGVATSLVEPEYSSTAQVYVSVQTQDGSTS
SLQQGSSFTQNQAAAFADLASSPLVLDPVVSALGLGVTPQSLSGRITATAKANTPLINVTARAADPVRAAELSNAVVASM
TEVIPELQRPLDSAVSPVKLTITRSGQVPVVASSPDAVTNLAIGAFVGLAVGLGLAVLRSMLDTRIHGKEDLARLTRSPV
LGVVGFDAGLRGGPLVMATDPHGRSAEAIRQVRTNLQFVNPDARPRQIVVTSAVPGEGKSTTAANLALALAEAGGRVLLI
DADLRRPSIASMFGLEGAAGLTTLLIGQAEVDDVVQTWGTSSLDVITSGAIPPNPSELLGSGPMTDLLAKLAERYETVVL
DAAPLLPVTDGAVLTKLTDGALFVVGAHEARQAQVTSALESLATVDGTVLGVVLNGADVRRSATYEYYDYTTEEQPAPRR
PGILGRARAARAARADREAAADREAGAARASTATSSGPSPDAA
>gnl|bykdb|A0A2U2MQ51 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium catulorum] (length=486 residues).
MNIFDLLNVLRKYLLLELAILVAVTGGITWAVKSETPVYTASTQVFVRLQTQSTDLGSVNSDSQAIQRQMSTYTSLVKTE
SVLQPVIDNLGLDMTTEELAANVAAAANGDTTLMTISANSSDPKEAAQIANEVATTLNNLIINNLYTDDGGKLTTPIKFS
VVQKAYAPATPTSPNVKSGAFKGALAGFVLAVVVALALNFMDKKIRQVSDIQAYVKAPVIGNLPKNQLLAGSAPAIVAQP
AGVIAEDIRRVAVNLSFVIPKDMVGGNLVVVSSGGPNEGKSTLAVNLAAAYAEKGEKVLLVDADLRKPSIGRYLGVNDAV
GLTNLATGQVEADTAIQRYWKEGFHVLPSGAKSPNPSLLLGSKTMLALLERFSIEYDHVIVDTSPMDVANDAAIFAKEGA
RLVLVVGQNVATKKSLRGVAAELDMVDVPVMGVVVNYAEAGKRSKSKYYYYAADASQTGDADGDAGASGSKAGKPGKGHT
HRKDAE
>gnl|bykdb|A0A2U2N5R0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium callitrichidarum] (length=483 residues).
MTILDIFNVLKKHLITAVITLVVVVAAMAGYTFTRTTQYTATAELLATYRTSAGSGETGSSGNAGELSSGANYINSQIQT
YPQLVKTESVLQPVIDDLGLNATVSDLAQGVTASNPDGTMLVDISVKNPDPKMASNIANAVAESLKKQVTSTLYTDEGDK
IVSPVNLTVVQQAYTPASPSSPNIPRNLAAGVACGIILGIVAALIKDLLDTRVRLDTDVTNIVEAPVLGTLSRDEAYAGK
TPVIIAKPASREAEEVRRLRTNLTFALPDGPQSNVIVVTSAGPSEGKTTLCVNLATAFAENDGKVLLIDADVRNPSVSDK
LGIEGNVGLTHLITNQVSSQDAIQRYWKQNLHVLPAGTQTMNPSILLNSRAMKALIDQVSSAYDYVIVDTAPMQVANDAA
VFAKEGPELLLVAGLGITEKNMLRQTAQELETLDIHAAGVAINYADQDKSHKSGYYYYYGEGKSERGKKHGGKGAKQRDA
EDR
>gnl|bykdb|A0A2U2RJU3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium endophyticum] (length=510 residues).
MRAGRRSRVGGTLGDVRDERAVQTVPKGSARAPRQVVIGKRARRMTAPAQTVVPHAVRAEERTHGDHHLVRELRTRWRFI
ALVTLVALLLGVAASLLLPKQYDAETQLLVSVSSADDAVALSQGSDFSEQRVQTYMSVATSRPVMEKVIEDLGLHTTPNE
LAEKVTAEAVPETVLLTITARDTDPDLAAEIANSTAENLMAEIGSLEKGDGENSTPVRTVVVENAIAPTTASSPSVLRNG
LLAMIGGCALAIMYVYLRSILDTKVRSADALAEGTPQIPMLARIPRDPGRASDPAVISGHGAFTTSEAYRMLRTRLRYAN
IDGSVSSIMVTSVAEGEGKSSVASLLAAALADSGVNVLLIDADLRRPSIAEKFGLEGDAGLTAVLTRQASFRDVVQESPT
TGVQVMTAGVESPNPAELLESQTMRDLLSELSEEYDLVIIDTPPVMATADTLSVAAVADEVLLVVRTDGKVTRRAVLRAV
DSLTFVGARLLGTVATFSKVDRSQASSYYY
>gnl|bykdb|A0A2U2RVH5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMNSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPSGQSSPNIPLYLATGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLIITSTDPSEGKTTVSSNVAVALAEEGKGVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2V1K647 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinomycetaceae bacterium sk1b4] (length=449 residues).
MVLRDYFNVLRKNWLIIIVSTLLLLGGAAAWTFTRTPQYEATTQLFVSVRSGDSSAGELTQGSAYAQQAVASYMEIADSA
IVLDTVREELDLTESRRELAKRISADSPQGTVLINIRATDPDPQQAALISDTTSAVLAEVITDQLEGVSSESPARVQIDI
VQPADVPDAPITPRVWLNLVLGLVGGLALGITIALFRNILDTKVRTPEDVTTLTDLPVIGRIGRNPESSSDPLVAFTDPM
SPLSEPYRALRTNLRYMMVDGSLNRVVITSATSGDGKSTIAANLAIVMADAGARTLLIDGDLRKPNVAQLFGIEGGVGLS
DLLIGSVTQEEVIQQWGPRDVYLLPAGRIPPNPSELLSSEAMKQLLTEVFAAYDYVIIDAPPALSVTDPAILSRLTAGAL
VVVSAGRTRKGDLTEALGSIARINGHVLGIIMNRIPKIGTGTYYGSVSE
>gnl|bykdb|A0A2V1M0F1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria rosea] (length=597 residues).
MPMFVSLAHGREDVASMSMYSPHVQTSRRTMHPLDSDREALALDGRDLLRSLRTHWRAITLITLLCTLLALGWTLIQPKI
YSATASGLVVATGEQDLASALAGNNLAQSKAVSYESLATSRPVAESVIDELDLDATPEEVLPRITTDVPVDTPELRITAD
AEDPTEAADLANAWVVALAGQVQELESQGDEDAINRVAVQPLSNASLPLAPSSPNLKLNLALGFVGGLGLGLLYAFARYK
MDRRIKSVEEIRDGFGVSVLGVIPTDDRLSDHRAIVETGISAGRGHHEFAEALRELRTNLSFVSVDNPPRMIVVTSSLPG
EGKSSITANLAVAIASTGRNVVVVDGDLRRPVMTDLFGLVAGVGVTDVLTGQVQVEEVLQTYDTFPNLQVLGAGKTAPNP
TELLSSKAMHTMLETLAEDALVLVDAPPLLPVTDAALLTASADGALIVATAQKTTTDELSKALENLHQVRGNVLGVVLNR
VPTTGADAGYYGYYGKSYYANSDEKAAPKTGAQPVVPAPVGKHQPWGTELRPEPAEAQPPATPRAQQEPTAPSAEDAAPA
PTRSEQPDVPGSAEQESFGLEAWGRSGSSTGSTSSGH
>gnl|bykdb|A0A2V3DWA2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter psychrochitiniphilus] (length=533 residues).
MVSGGLGGGNISPCSYNSGRRSPRTDHAHPPKHRHHHRPPEGFWRGSTMASIMTAGTARSARIMPTLAKRWYVVLVAVAV
AALAAFALSFTVTPVYTSSTTLFFSLRSAGSATDINQGSAYTQNQMLSFAQLASSSLVLDQVLKDLGPAATKENIRRSMS
VSAPQNTAILDISVGTTNRELSAKTANSIAKYLTAAVTKVSPDESTKQGGIVVNVIEPAVPAQFQSSPDKRKNALLGGMF
GGALSILAIALTVMLDTRVRSTAVLKSMSDRPLLGTVEQNRASNDSRPVALRAPNGSATERFRQIKVGLRFAAASHQMKA
IAITSAIPSEGKTLTGLNLAIIMAENKDRVLLIDADLRRPSVAGSLGFEGAVGLTTVLVGDVSFDDAVQHLGSTSLDVLA
AGAIPPNPAELLGSEPMRLLLEEAKAKYDVVLVDTAPVLAVADVAVIAQLVDSIVWVVDSRKLHQAQLDQASEALDATGA
HVAGIILNRVKPLRLHDVYYTEGKGEPAHLEKTRVPHSVVSDSSRAHISQGTD
>gnl|bykdb|A0A2V3DYM2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter psychrochitiniphilus] (length=495 residues).
MELRDYIRMLRRNWISVIALGLVGLLAGGTFSVLSKPVYTAETQLFVATQNSGSVQDLQTGNMFVQARVSSYVATAKTPT
VLQPVIDSLGLEISPKQLAKSIKTTSDVKTVLITISVDDRSPVQAAAVAHAIASSLITTVDNLEKPTDGGSSPVKLSVVT
PATAPSAPSSPNLPVNIVLGLFLGLALGIVAALLRTSLDTRIRGEADLIRITDVPVLGGIAFDHDAIQNPLLSEENSHSH
RSESFRHLRTNLQFAQVNISSNTLLVTSSLPGEGKSTTATNLALAMAEAGKSVVLVDADLRRPMVAKYLGLEGAAGLTTA
LVGEAHLNDLLQPWGEHKLQVLTSGQVPPNPSELLGSENMSSLIQSLESDFDAVVIDAPPLLPVTDAAVLAQRVGGVIMV
VGCHTVKSTEVEKALNTLKLVDADVLGIVLNRVPIKGPDAYAYSYYGYSSRSESETGPLVISENRIRTADSVELHDEDEF
DRILRGPISRASRRG
>gnl|bykdb|A0A2V5FP96 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter stackebrandtii] (length=524 residues).
MRDYVRVFRQHWLGVVALTLIGILCSAGWLLFQQPVYSATSVGYVSVPGGDNMGSALAGDNLAKSKATSYASFASSRPVA
ESVIGALKLDIAPDELLTQVTVTAAKDTAQIKIEASADTAQQAQALANAWVVSLAEQVKILESAPNPADPNAVPLDSIIK
VVPLGDAPLPSAPSSPNKKMTLVIGALAGLIAGVAYALIRNHLDRRIRSVEMVEKATGASVVGTIPVDERLRGSRHVVES
GVIDHSSTEGYAMSEALRELRTNLHYMNVDNPPRVIVITSSVPGEGKSTIAANLAVTIAATGQRVILIDGDLRRPVVAEF
FGLAGGGGLTDILSGQATLNDVLQVYRPVPTLAVLGAGRIPPNPSELLGSMAMKRLLERLSEDAVVLIDAPPLLPVTDAA
ILARSTDGALVVAGAGKTSIDELVKAVASLEKVSAPLLGAVLNRVPTTGSQAAGYGYYGKGYYYHQDAAKGKKAARPKPA
RPARAAAERVESYTDEGLDREAAFDELLNPNTGEAPTRRVTRSR
>gnl|bykdb|A0A2V5ITQ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter psychrolactophilus] (length=544 residues).
MVLEDEQQGTTDKSLDVRDYVRVFRQHWLGVVALVLIGILCSAGWILLQKPSYSANSIGYVSIPGGDNMGSALAGDNLAK
SKATSYASFASSRPVAESVITSLKLGTTPDQLLQQISVSSAKDTPEIKISAAAGTPQEAQALANAWVIALAEQVKVLEST
SAAVDGSIPAAESIIKIVPLGDAPLPTSPTSPNKKMALILGALAGMVLGVAYALVRNHLDRRIRSVEMVEKAIGTAVVGT
IPVDERLRNGQHVVENGVIDHASTEGYALSEALRELRTNLHYMNVDKPPRVIVITSSIPSEGKSTIAANLAVTIAATGQK
VVLIDGDLRRPVVSDYFGLASGGGLTDILSGQATLDDVLQVYGPVPSLAVLGAGRIPPNPSELLGSLAMKRLLDKMAEQA
VILIDAPPLLPVTDAAILARSTDGALVVAGAGKTTIDELEKAVATLAKVNAPLLGAVLNRVPTTGGQAAGYGYYGKSYYY
RQNSGKKAAKGRGAKQSAPAQAVSEASSALPDTYTGDALSAEQQFEQLIHPPKQEASRRMRQNR
>gnl|bykdb|A0A2W0CPC4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_030] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNADQLATMVSATAPTSTTLISISVNDTDPVQAADIANATSQSLTNVVEDIEATDEKGSSSVKLTRVK
QADVPSSPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMEVETNAGLTDV
LIGRAELEDVAQPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIERLEGEFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGKTHKGQFAAAVSALESVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLEEDENTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W0CXJ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_046] (length=469 residues).
MTLAQFFAVVRRRRWWIVLTVGIGIGSGVVVSALQVPQFRAESSVFVSVGGATVTDLTQGGTFSEARVASYVQLAQSPRV
LSAAAHRAGVRGDVAVLRSKVQAEAVSDTVILSISATDTDQAKAASLANAVAHELVEAVAGIERTDDHGRPLVELSVFQQ
AQEPSRPISPRPAVNAVLGVIGGLGSGIAIALVLETVDTKLRSVEALRQIGKRSVLAEIPVDPQAATSPLIDVDNRYSER
AEQFRQLRTHLTFTNVDGGSQAIVVTSALPGEGKSSTAVNLSLMLAQSGHRVVLVDADLRRPSTGDYLGLESGVGLSTVL
THQVELADALQRHGADELHVLASGRVPPNPSELLESRTMEVLIADLHQHFDYVIIDAPPVLPVTDPTVLATRVNGVLFVA
SVDGRVTSHAVQSALGRLDAVGARVVGTVANRVRLGRKTAQYYGYQPTAPRSERPRRSRKAVRARMAEQ
>gnl|bykdb|A0A2W0D8S5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_046] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNADQLATMVSATAPTDTTLISIAVNDIDPVRAADIANAASQSLTNVVEDIEATDAEGTSTVKLTRVK
QADVPSTPVSPNVPVNVALGLLVGLALGVAIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDTNAGLTDV
LIGRAELEDVAQPWGRGKLVVLPAGQIPPNPSELLGSRAMQELIERLEKEFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGKTHKGQFAAAVSALENVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLEADENTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W0DAU9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_030] (length=468 residues).
MSLAQFLAVIRRRHWLLTMLTLLGVTGGVTLSLLATPLYRAEAQMFVSVDGGSTASDLSQGGSFSESRVASYAKLSTSTA
ILRAAAREAGVEAAPSELERAVRTTTNADTVIMSIAATQPDPEKAAALADAIAAQTIELVGDLEKTDALGESLVKLSVYQ
KAEVPTAPASPRVPVDIAVGALIGLALGIGSALLRETMDTKVRSVDQVASASGKSVLAEIPVSDDIATIALTSSGGQFSS
TAEAYRQLRTHLTFTNLDGDCQVIVVTSSLAGEGKSTTASNLALMLAQNGHRTLLVDADLRRPSVADILGIEGSVGLSTV
LAHQVELDDAIQVVGEGGLRVLTSGQVPPNPSELLSSRQMQLVVQTASVSFDYVIIDAPPALPVTDPAVLGASASGVLFV
ASVDGRVKMGDIGRAVSKVDAVGARVLGVVANRVRVGHRPESYSYYATARPQSESPRRARRAAVEGRR
>gnl|bykdb|A0A2W0ECB7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_011] (length=452 residues).
MNYLVVIRALVSGWWIIAGATLLGAGLSLVVTSITPPTYQASTSYYVSVAGDTSASAGEIAQGSNAAQQKIKSYMQLATS
PRVLQGVVDELELDTTPAALASRITTSVDAGTVIIKIAVQDESPKVAATIAEQVGKRLAGVVQQIEPRGADQAPSVRLEE
VTPASEPTSPISPRKAADLTLGLVGGLAAGAALALLRAAVDTRIRSDEDLDVDVPVVGDIAFDADAARRPLIVRDEVNTP
RSEAFRSLRTNIQFLRTSGAPTIAVTSARPSEGKTTTTANLGIALSKSGMRTVIIDADLRRPNVASVMSVEGAVGLTDLL
VGRVELEDALQDWGLEGLAVLPAGTIPPNPSELIGSEAMARVLAELASRFDVVLVDTPPVLAVTDAALVSTLVSTTLLVT
AANQTKRSDVRLAVEALARVGQQVAGIVLTKTKHKASRSAYYRSDYTNPRTT
>gnl|bykdb|A0A2W1NK02 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_042] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLISISVEGTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRQTLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRSGKKLGVLRR
AGR
>gnl|bykdb|A0A2W1PJ22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_042] (length=454 residues).
MNYLAVIRALLSGWWIIAGATLLGAGASLVVTSVTPPTYEASTSYYVSVAGDTSATAGEIAQGSTAAQQKIKSYMQLATS
PRVLQGVIDELDLDTTPAALASQVTTSVDAGTVIIKIAVQDGSAKAAATIAEQIGKSLATVVQEIEPAGADQAPSVRLEE
VTPASRPLSPIAPRKAADLALGLLGGLAAGAALALLRAAVDTRVRSSEDLDGDVPVVGDIAFDPDAARHPLIIRDEVNSA
RSEAFRSLRTNIQFLRTSGAPTIAVTSARPSEGKTTTTANLAIALSKSGMRTVIIDADLRRPNVAAVMSLEGAVGLTDLL
VGRVELDDVLQDWGLDGLSVLPAGTIPPNPSELIGSEAMARVLAELASSYDVVLVDTPPVLAVTDSALVSTLVSTTLLVT
AANQTKRSDVRLAIEALARVGQQVAGIVLTKTKHKASRSAYYRSEYKSARPSDR
>gnl|bykdb|A0A2W1PR53 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_006] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVESTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRETLDNRIRTEIDVEKISDKPVVGGIAYDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGSGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIELLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVLTKMPVKGPGAYGYGRYGYGYSYGQDEDDNTVTTSTRPPKRTGKKLSVLRR
AGR
>gnl|bykdb|A0A2W1Q3Z9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_006] (length=454 residues).
MNYLAVIRALLSGWWIIAGATLLGAGASLVVTSITPPTYEASTSYYVSVAGQTSATAGEIAQGSTAAQQKIKSYMQLAAS
PRVLQGVIDQLDLDVTPAALASQVTTSVDAGTVIIRISVQDGSAKAAATIAEQIGKSLATVVQEIEPAGADQAPSVRLEE
VTPASRPLSPIAPRKAADLALGLLGGLAAGAALALLRAAVDTRIRSGEDLDGDVPVVGDIAFDADAARHPLIIRDEVNSA
RSEAFRSLRTNIQFLRTSGAPTIAVTSARPSEGKTTTTANLAIALSKSGMRTVIIDADLRRPNVAAVMSLEGAVGLTDLL
VGRVELEDVLQDWGVDGLAVLPAGTIPPNPSELIGSEAMARVLGELASRFDVVLVDTPPVLAVTDSALVSTLVSTTLLVT
AANQTRRSDVRLAIEALARVGQQVDGIVLTKTKHKASRSAYYRSEYKSARPSDR
>gnl|bykdb|A0A2W1QM99 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_005] (length=454 residues).
MNYLAVIRALLSGWWIIAGATLLGAGASLVVTSVTPPTYEASTSYYVSVAGNTSATAGEIAQGSTAAQQKIKSYMQLATS
PRVLQGVIDELDLDTTPAALGSRVTTSVDAGTVIIRITVQDGSAKAAATIAEKIGKSLATVVQQIEPAGADQAPSVRLEE
VTPASRPLSPVAPRKAADLALGLLGGLAAGAALALLRAAVDTRVRSGEDLDGDVPVVGDIAFDADAARHPLIIRDEVNSA
RSEAFRSLRTNIQFLRTSGAPTIAVTSARPSEGKTTTTANLGIALSKSGMRTVIIDADLRRPNVAAVMSLEGAVGLTDLL
VGRVELDDVLQDWGLDGLSVLPAGTIPPNPSELIGSEAMARVLAELAADYDVVLVDTPPVLAVTDSALVSTLVSTTLLVT
AANQTKRSDVRLAIEALARVGQQVAGIVLTKTKHKASRSAYYRSEYKSARPSDR
>gnl|bykdb|A0A2W1QMG4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_005] (length=480 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVESTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRETLDNRVRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGSGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVEGNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGPIPPNPSELLGSRAMQDLIERLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPISGFVITKMPLKGPGAYGYGRYGYGYGYGQDEDAAATVNPPKRVGKKLGVLRRAGR
>gnl|bykdb|A0A2W1QTM3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_032] (length=480 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNADQLATMVSATAPTSTTLISISVNDTDPVQAANIANATSQSLTNVVEDIEATDADGKSSVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVETNAGLTDV
LIGRAELEDVAQPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIERLEGEFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGKTHKGQFAAAVSALESVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGIEDEDTPKVKPPKRGGKKLGALSRAER
>gnl|bykdb|A0A2W1QU49 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_015] (length=527 residues).
MARGRRRTGLGPGPSPTSLRPRVGQRSTSRDRGFPRRSPCRSRSALQENPLTASQVLRIFRRSWLLIVAAVLLGTAVGTA
SALVTDPSYRSDTRLFVAIQPTAPSTTDLVQGNSAAQQKVTSYVAVVTSARVLQPVIDELRLDTNVSTLARSISANSPLN
SVLLDVSVRADSPDEARRIAGAVAKSLTTVVTEQLEKPTAGGASLVKIESIQPPTLPQGADSPNLPRRVIAGAALGLLAG
VAAAALRHSLDTRVRTQSDIEAITDAPVLGAIGHDADADRRPLIVHADPRNPRAESFRSLRTNVQFLDLDQAKRSFTVTS
AVPAEGKSTTAANLAIAMAENGARVVLVDADLRRPRVAEILGIDGSAGLTDVLIGKAELDDVTVPWGLGGLNVLPAGRIP
PNPSELLGSASMQALMHELELLYDTVIVDAPPLLPVTDAAVLSRLTSGSILITALGRSTRHQLRAAFEKMSSAGARTFGI
VMTMVRNESSSVGAYGTYDSYYGDAQRIDESVSPAAAPSGRRVASAE
>gnl|bykdb|A0A2W1QVP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_026] (length=480 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLGLDMNADQLATMVSATAPTSTTLISISVEGTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRETLDNRVRTELDVEKISDKPVVGGIAYDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGSGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVEGNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGPIPPNPSELLGSRAMQDLIERLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVITKMPLKGPGAYGYGRYGYGYGYGQDEDAAATVNPPKRVGKKLSVLRRAGR
>gnl|bykdb|A0A2W1QW41 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_015] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNADQLATMVSATAPTDTTLISIAVNDIDPVRAADIANAASQSLTNVVENIEATDADGTSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDTNAGLTDV
LIGRAELEDVAQPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIERLEGEFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGKTHKGQFAAAVSALENVGAPIAGYVITMMPVRGPGAYGYGRYGYGYGYGLEEDASTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W1RBH1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_031] (length=454 residues).
MNYLAVIRALLSGWWIIAGATLLGAGASLVVTSVTPPTYEASTSYYVSVAGDTSATAGEIAQGSTAAQQKIKSYMQLATS
PRVLQGVVDELDLDVTPAALASQVTTSVDAGTVIIKIAVQDGSAKAAATIAEQIGKSLATVVQEIEPAGADQAPSVRLEE
VTPASRPLSPIAPRKTADLALGLLGGLAAGAALALLRAAVDTRVRSSEDLDGDVPVVGDIAFDADAGRHPLIIRDEVNSA
RSEAFRSLRTNIQFLRTSGAPTIAVTSARPSEGKTTTTANLGIALSKSGMRTVIIDADLRRPNVAAVMSLEGAVGLTDLL
VGRVELDDVLQDWGLDGLSVLPAGTIPPNPSELIGSEAMARVLAELAANYDVVLVDTPPVLAVTDSALVSTLVSTTLLVT
AANQTKRSDVRLAIEALARVGQQVAGIVLTKTKHKASRSAYYRSEYKSARPSDR
>gnl|bykdb|A0A2W1RMT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_031] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVESTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRETLDNRIRTEIDVEKISDKPVVGGIAYDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGSGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIELLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPISGFVITKMPVKGPGAYGYGRYGYGYSYGQDEDDNTVTTSTRPPKRTGKKLSVLRR
AGR
>gnl|bykdb|A0A2W1SEK0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_021] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNADQLATMVSATAPTDTTLISIAVNDIDPVRAADIANAASQSLTNVVENIEATDADGTSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDTNAGLTDV
LIGRAELEDVAQPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIERLEGEFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGKTHKGQFAAAVSALENVGAPIAGYVITMMPVRGPGAYGYGRYGYGYGYGLEADENTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W1SP47 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_016] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVEGTDPVQAANIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRQTLDNRIRTELDVEKISDKPVVGGIAYDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVEGNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPISGFVITKMPVKGPGAYGYGRYGYGYSYGHDEDDNTVTTSTRPPKRTGKKLGVLRR
AGR
>gnl|bykdb|A0A2W1TGD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_054] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLISISVEGTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRQTLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSGAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRSGKKLGVLRR
AGR
>gnl|bykdb|A0A2W1TGI6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_054] (length=469 residues).
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGDSVTDLSQANTFSAARVKSYEALAVTPQ
VLGQAAKQLGLPGGGGLSRVVTAESKRDTVLISISATDGSPSQAAAIANAVTAQLVKVVEQVENEGAATTGLVHLSVFQP
ATAPSTPFSPRLAVNIAIGVLAGLALGIAQAVLREVLDTRLRSFEALRRLTQASVLGEFALDDSVVKEPLVSFGNRYSTR
AEAFRQLRTHLTYTNLDGDAQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
TRQVALDDAVQQVGADTPLHVLAAGRVPPNPSELLSSSRMVELVRELESRFEYVIVDAPPMLPVTDPAVLGTICSGVLLV
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRRSSRARRTPEDH
>gnl|bykdb|A0A2W1TJJ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_032] (length=494 residues).
MSHVHLWSVMVGMLASHPTEGGSMTLAQFIDVVRRYVWWVVLLVVLGAACGVAAAVLQPPQYRAQAKVFVSVGGATVSDL
NQGGTFSEARVTSYAQLATSPRVLRAAARRAGLTSSVRDLAGSVSAVADADTVILTITATRNRPRAAALLANAVAQETID
AVTEVERAGRGASPLVHLALFQRAEPPNDPSSPRLAVAVVLGVLAGLVAGIGTALLRGSVDTKIRSVDALRRAAPTTVLA
EIPVDDDMTRSPLIDLGNRYSERAEAFRQLRTHLTFTNVDGGQQSIVVTSAVPGEGKSSTAVNLALVMAQNGLDVLLVDA
DLRRPTTADQLGIESRVGLSTVLAHQVELEDAVQTVGEHGLRVLASGRVPPNPSELLASRQMELLMATVREQYEHVVIDA
PPLLPVTDPAVLAAMATGVVLVGSVDGRVTNGQMAQAVATLDTVGARVLGVVANRVPVRGRPASYGGYRPSVPMSESPRR
SRRSRPDDDRGAGS
>gnl|bykdb|A0A2W1TJR2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_032] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNAEQLATMVSASAPTSTTLISISVNDTDPVRAADIANATSQSLTNVVEDIEATDAEGTSSVKLTRVK
QADVPSAPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDTNAGLTDV
LIGRAELEDVAQPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIERLEKEFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGKTHKGQFAAAVSALENVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLEADEDTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W1TRU9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_008] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNAEQLATMVSASAPTSTTLISISVNDTDPVRAADIANATSQSLTNVVEDIEATDAEGTSSVKLTRVK
QADVPSAPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDTNAGLTDV
LIGRAELEDVAQPWGRGKLVVLPAGQIPPNPSELLGSRAMQELIERLEKEFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGKTHKGQFAAAVSALENVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLEADENTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W1TY42 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_039] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLIAISVEGTDPVQAANIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSTPVSPNVPVNVALGLLVGLALGIGIAVLRQTLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRAGKKLGVLRR
AGR
>gnl|bykdb|A0A2W1U2M0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_016] (length=454 residues).
MNYLAVIRALLSGWWIIAGATLLGAGASLVVTNVTPPTYEASTSYYVSVAGDTSATAGEIAQGSNAAQQKIKSYMQLATS
PRVLQGVVDELELDTTPAALASRITTSVDAGTVIIKIAVQDGSPKVAATIAEQVGKRLAGVVQQIEPRGADQAPSVRLEE
VTPASEPTSPISPRKAADLTLGLVGGLAAGAALALLRAAVDTRVRSGEDLDGDVPVVGDIAFDADAARHPLIIRDEVNSA
RSEAFRSLRTNIQFLRTNGAPTIAVTSARPSEGKTTTTANLGIALSKSGMRTVIIDADLRRPNVASVMSIEGAVGLTDLL
VGRVELDDVLQDWGLDGLSVLPAGTIPPNPSELIGSEAMARVLTELAASYDVVLVDTPPVLAVTDSALVSTLVSTTLLVT
AANQTKRSDVRLAIEALARVGEQAAGIVLTKTKHKASRSAYYRSEYKSARPSDR
>gnl|bykdb|A0A2W1U4A1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCJR17_020] (length=480 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLVKKPVYAASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLISISVEGTDPVQAANIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSTPVSPNVPVNVALGLLVGLALGIGIAVLRETLDNRVRTELDVEKISDKPVIGGIAYDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVEGNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGPIPPNPSELLGSRAMQDLIERLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIIA
VASGHTHKGQLAAAIASLENVGAPISGFVITKMPVKGPGAYGYGRYGYGYGYGQDDGATASVTPPKQPGKKLGVLRRAGR
>gnl|bykdb|A0A2W1UD60 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_039] (length=472 residues).
MEAQEYVRILRKSWLLITATALLGILSGGALAAAATPAYTAATRLYVSVRAQEGAASTDLNQGTSFARQAISTYVDVVNS
PIVLDRAGRELEPRMTAAELAPLVSASSPANTVLLEVSVTDTSAKRAAAIANAVGESFARVVSEDLEKPSVGPSLIAVKT
IAPATVPSAPSAPRIPLMLAIGLAVGLVTGVGIAVLRTNLDTRVRTAEQIEAVARRPYLGGIFVDPDAQKRPLIVHADPR
SPRSEAFRRLRTSLQFVGLGDAGRSFVVTSSGPGEGKSYVAANLAIALAETGASVVLVDADLRRPRVADYLGIEGNAGLT
DLLIGRAEIADVLQPWGEQALSVLPSGRIPPNPSEMLGSAAMRATVEHLERNFDYVVIDAPPVLLVADAAVLSAVAGILF
VAAAGKVRKADVVAALRALDAVKAVTFGVVGQMLPMRGAGGGSYGKYAYYDGDTPVIEPVPEERRSRRGLTT
>gnl|bykdb|A0A2W1V3X9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_040] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLISISVEGTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRQTLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRSGKKLGVLRR
AGR
>gnl|bykdb|A0A2W1V7N1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCJR17_020] (length=476 residues).
MKGRVRMTLAQFIDVLRHRWLSIAAVLVLATGIAAAVSAVQPPQYRATSEVFVSVAGGASVADLSQGNTFSAARVKSYEA
LAVTPQVLGQAAKQLGLPPGSGLGRVVTATSKRDTVLISISATDSSPTQAAAIANAVTDQLVKVVDRVERSASAASDLVH
LSVFQRATAPSAPFAPRLAVNLAIGILAGLALGVSQAVLREVLDTRLRSFEALRRLTDASVLGEFAVDETIAKQPLVSVD
NRYSTRAEAFRQLRTHLTYTNLDGDAQSIVITSATPGEGKSSTAVNLALMLAQNGSKVILVDADLRRPTTGTYLGIESRV
GLSTVLTRQVDLDDAIQEVGSDNPLHVLAAGRVPPNPSELLSSSRMVALIRDLESRYEYVIVDAPPMLPVTDPAVLGAVC
SGVLLVVSVNGQTKRADFTAAERTVQQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPLSESPRRASRARLSSKDPL
>gnl|bykdb|A0A2W1VLC9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_007] (length=483 residues).
MELRDYISVLRKGWALILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVTTPI
VLLPVISSLKLDMTSDELAKLVSADAPTNTTLIAITVNDTNARQSADIANAVSQSLTNVVQNIEATDAEGTSTVKLTRVK
QADVPSAPVSPNVPVNVVLGLLVGLALGVALAVLRETLDNRVRSEADVEKISDKPIVGGIAFDSKAAERPLIVQVDPRSP
RAESFRTLRTNLQFVDIGTGARTFVMTSSVQSEGKSTTVANLAIALDSAGFKVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRASLDDVAARWGRGNMVVLPAGPIPPNPSELLGSRAMQDLITTLEAQFDYVLFDAPPLLPVTDAAILAKKASGAIVV
VASGKTHKGQLAGAVQSLENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGIDEDDKNAKPKPPRAAAKRKRVGALRR
AGR
>gnl|bykdb|A0A2W1VQ01 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_040] (length=469 residues).
MTLAQFIDVLRHRWISIAAVLLLATGLAAAFSAVQAPQYRATSEVFVSVAGGDSVTDLSQANTFSAARVKSYEALAVTPQ
VLGQAAKQLGLPGGGGLSRVVTAESKRDTVLISISATDGSPSQAAAIANAVTAQLVKVVEQVENEGAATTGLVHLSVFQP
ATAPSTPFSPRLAVNIAIGVLAGLALGIAQAVLREVLDTRLRSFEALRRLTQASVLGEFALDDSVVKEPLVSFGNRYSTR
AEAFRQLRTHLTYTNLDGDAQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVVLVDADLRRPTTGTYLGIESRVGLSTVL
TRQVALDDAVQQVGADTPLHVLAAGRVPPNPSELLSSSRMVELVRELESRFEYVIVDAPPMLPVTDPAVLGTICSGVLLV
VSVDGRTRRADFTAAERTVTQVGARLLGLVVNRLPVQRRAKTYYNYEPSAPVSESPRRSSRARRTPEDH
>gnl|bykdb|A0A2W1VSB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_007] (length=482 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVQTPI
VLLPVISSLGLDMNADQLATMVSATAPTSTTLISITVQGTDPVQATEIANATSQSLTNVVQDIEATDANGTSTVKLTRVK
QADVPLKPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISEKPVVGGIAFDSKASERPLIVQADPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFKVILIDADLRRPRVGEYMEVDSAAGLTDV
LIGRATLEDVAQPWGRGNLVVLPAGQIPPNPSELLGSKAMQDLITALEQQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGLDEAEPTQPTTKAPKKARGKLGTLRRA
DR
>gnl|bykdb|A0A2W1W5T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_007] (length=478 residues).
MTFTDTARMMRRSWLLIICAVLIGIGLGALSVRLQDPVYRADTELFVAIQPTSPDPAELVQGNSAAQQKVASYIEVARSA
RVLQPVIDELGLRTDVSRLARHVSASSPLNSVLLDISVRDEDPAAARRIAMAVAESFTKVVTEQLEKPTTGGASLVKIEM
IEPPVTPTSPESPNVVRRTLLGGATGLVIGLGLALLRFSLDTRVRSVDDVESVADVPVIGAIGFDPTADERPLIVHMDPR
NPRAESFRSLRTNVRFLDLDETRRSFTITSALPSEGKSTTAANLAIAMAESGARVMLVDADLRRPRVAEVLGLDGAAGLT
DVLIGRAELEDVVIPWGAGGLHVLPAGRIPPNPSELLGSASMRALTTQLIADYDFVVIDAPPLLPVTDAAILSRITGGAV
VISAVGRATRKQLRTALDALTSIGARTFGVVLTKVPNKKGTYGYSTYSRYYGDDLSVDETATPKRPGRRAADIDPTQQ
>gnl|bykdb|A0A2W1WC71 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_002] (length=517 residues).
MLPSHTMRIRDMGCSCSVGFECNTTPCDILTAKTRQPGRQHMTLVQFLDVVRRRWLTITIAVVVGVATAFGVTHFQTPEY
RSTAGVFVSVSGSDTIADLSQSNNFSAARVTSYAALATTPEVLRAAATAAGLHGEDAEIADAVDVSTEPDTVIIDIGATA
TNPDRAAAIANAVAAELIDAVARVERGNGTAVIRLSVVEEAIPAEEPFTPRVPVNIALGLLAGLTLGIAGALLREVLDTR
LRSIEVLHRMIDTSVLGEFPIDDTVRDHPLLDGTNRYTPRAEAFRQLRTQLTFTNLEGSSQSLVVTSARPGEGKSTTALN
LAMTLAQNGGRVLLVDADLRRPKVGDYLGLESRVGLTTVLARQVALDDAIQTVGDTNPLSVLASGRVPPNPSELLGSQHM
ADLMRELERRYDYVIVDAPPALPVTDPAILGAICSGVLLVVSMNGHVRRADVQAAHERMQRIGAGVLGVVLNKTPLQRKE
RSYYHYEASAPLSESPRRVGRARARRSSSTTPMEETS
>gnl|bykdb|A0A2W1WMU4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_036] (length=470 residues).
MTLAQFVDLLRLRWLSVVAVVVLAAGLAAAVSAVQSPQYRASSAVFVSVASGASVNDLSQGNNFSAARVKSYEELALTPR
VLGLAARQLGLPADADLSRVVSAESTTDTVLITITATDTAPEQAAAIANAVADQLVKVVEQVERSTSAADSLVNLSVFQR
ASAPTVPFAPRLPVNIAIGVLAGLALGVAQAVLREVLDTRLRSFEALRRLTDASILGEFAVDDTIAKDPLVSFDNRYSTR
AEAFRQLRTHLTYTNLDGAAQSIVVTSATPGEGKSSTAVNLALMLAQNGSKVVLVDADLRRPTTGVYLGIESRVGLSTVL
TRQVDLDDAVQEIGADNPLHVLAAGRVPPNPSELLSSSRMVDLIRELESRYEYVIVDAPPMLPVTDPAVLGAICSGVLLV
VSVQGQTKRADFTTAERTVAQVGARLLGLVVNRLPPQRRAKTYYNYEPSAPVSESPRRASRARLSSKDPR
>gnl|bykdb|A0A2W1WZ29 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCLR17_036] (length=479 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDELAEIVTSDAPLNTTLISITVDETDPKQAADIANATSESLTNVVQNIEATDADGTATVKLTRVK
EAQVPNTPVSPNVPVNVVLGLLIGLALGVGVAVLRETLDNRIRTESDVEKISEKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVESEGKSTTVANLAIALDNAGFRVILIDADLRRPKVAQYMDIEGGVGLTDV
LIGRAEIEDVAQPWGRGNLVVLPAGPIPPNPSELLGSRAMQDLIAALEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDDDQPEPPKPPKRGRAGAPRGVVR
>gnl|bykdb|A0A2W1X3D9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_021] (length=462 residues).
MQPDRRLHLNYLAVIRALISGWWIIAGATLLGAGASLVVTNVTPPTYEASTSYYVSVAGDTSATAGEIAQGSNAAQQKIK
SYMQLATSPRVLQGVVDELELDTTPAALASRITTSVDAGTVIIKIAVQDGSPKVAATIAEQVGKRLAGVVQQIEPRGADQ
APSVRLEEVTPASEPTSPISPRKAADLTLGLVGGLAAGAALALLRAAVDTRVRSDEDLDGDVPVVGDIAFDADAARHPLI
IRDEVNSARSEAFRSLRTNIQFLRTSGAPTIAVTSARPSEGKTTTTANLGIALSKSGMRTVIIDADLRRPNVASVMSIEG
AVGLTDLLVGRVELDDVLQDWGLDGLSVLPAGTIPPNPSELIGSEAMARVLAELAANYDVVLVDTPPVLAVTDSALVSTL
VSTTLLVTAANQTKRSDVRLAIEALARVGQQVAGIVLTKTKHKASRSAYYRSEYKSARPSDR
>gnl|bykdb|A0A2W1XJM0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_021] (length=483 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVSATAPTSTTLISISVEGTDPVQAADIANATSQSLTNVVQDIEATDASGKSTVKLTRVK
QADVPSVPVSPNVPVNVALGLLVGLALGIGIAVLRQTLDNRIRTELDVEKISDKPVVGGIAFDAKAAERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVESNAGLTDV
LIGRADLEDVAHPWGRGKLVVLPAGQIPPNPSELLGSRAMQDLIDLLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGQTLKGQLAAAVATLENVGAPVSGFVLTKMPLKGPGAYGHGRYGYGYSYGHDEDDNTVTTSTHPPKRSGKKLGVLRR
AGR
>gnl|bykdb|A0A2W1YE21 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCBD17_040] (length=477 residues).
MELRDYITVLRKGWMMILILALVGVAAAAGFSIAKTPQYAASAQVFVSTETSGSASDLAQGNTFTQQRVVTYSNLVSTPI
VLLPVIAKLHLHMTAEQLAGLVSADAPTSTTLITINVTDVDPVRAADIANATSSSLTNVVQNIEATDANGQSTVKLTRVK
EAQVPSKPVSPNVPVNIVLGLLVGLALGVGVAVLRETLDNRVRTETDIERISTKPIIGGIAFDNKAATRPLIVQADPRSP
RAESFRTLRTNLQFLDLDGPARTFVMTSSVESEGKSTTVANLAIALDTAGYKVILIDADLRRPKVAQYMDVEGAAGLTDV
LIGRADLDDVAQPWGRGAMRVMPAGPIPPNPSELLGSRNMQLLIERLEQEYDYILFDAPPLLPVTDAAILSKKASGAIVA
VASGKTHKAQLAGAASTLENVGAPIAGFVLTMMPTKGPGAYGYGRYGYAYGYGLDNEDEAEIPRKPSAGVGPLRKAD
>gnl|bykdb|A0A2W1Z3Y0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCSS17_008] (length=482 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVTTPI
VLLPVISSLGLDMNADQLATMVSATAPTSTTLISITVEDTDPVQATEIANATSQSLTNVVQDIEATDANGTSTVKLTRVK
QADVPLSPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISEKPVVGGIAFDSKASERPLIVQADPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFKVILIDADLRRPRVGEYMEVDSAAGLTDV
LIGRATLEDVAQPWGRGNLVVLPAGQIPPNPSELLGSKAMQDLITALEQQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGLDEAEPPQQTTKAPKKARGKLGTLRRA
DR
>gnl|bykdb|A0A2W1ZIW5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. MCPF17_047] (length=481 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISKLQLDMNADQLATMVSATAPTSTTLISISVNDTDPVQAADIANATSQSLTNVVEDIEATDAEGTSSVKLTRVK
QADVPSSPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTEQDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMEVETNAGLTDV
LIGRAELEDVAQPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIERLEGEFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGKTHKGQFAAAVSALESVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLEEDENTPKVKPPKRGGKKLGALSRAE
R
>gnl|bykdb|A0A2W2BV95 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Salinispora sp. 13K206] (length=487 residues).
MDLYRQLHHVRRHWWLVLLTLMVVLGVTAFITVRAQPRYVASVTFFVTTPTQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSVVADSAIGLTADEVQRRVSTSTEAGTVLLRASVTDTDQTRALKVTEVLSTRFVELVQKVETTPDGRAGPIKIEVVSG
PRVSSSPVSPQPVRNFTLGALLGLLLGVALAIARGLADVRLRDAAGLQRTTGSPLLGEIPYENTAKGSPLIVGDAANSAR
AEAVRKLRTNLRFVDVNEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGIGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVATAARALHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVAAAAETPSVPNDRATTARHAEHAGARGVSDRTQ
ELTRLPR
>gnl|bykdb|A0A2W2E7U9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Jishengella sp. NA12] (length=487 residues).
MDLYRQLRLVRRHWWIVLVTLMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQAAVAQGQLGLTAEEIQSRISTSTEAGTVLLRASVTDTDQTRALRVTEALSAKFVELVQKVETKPDGSAGPIKIEIVSG
PRVSPTPVSPQPIRNTAIGALLGLLAGVGLAILRGMADVRLRDAAGLQRVTGSPLLGEIPIDSTARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGIDSGVGLTDVL
VGDVHVGDVVQRWGDKSLLVLPSGSSPPNPSELLGSKAMSDLLVALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKAEAYQYEAYRVVAAAANPSVPADRASAGRHAERTRAGDVGTHTQ
ELTRLSR
>gnl|bykdb|A0A2W4J0R4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium] (length=495 residues).
MNFRNWLLLVRQRWWIVLTTMVLAVLATGVVIYRTPPRYATTVTFFVTTPNQGVAEAYQGGLFLQQRVKSYGDLLTSDRL
AKTVVEKHDIGLSVEEARSRISARIHPDTVLLEATVVDENRARAMELTQAVATSFVDLVQKLETPSGAGRSPVKVEVVSG
PRLDPQPVSPRPVRDLTLAAGAGLLLGVALALLRGLTDTTVRDSGTLRAVADAPLLGEVPFDNAAKEEPLIIGDAAHTPR
AEAIRKIRTNLRFVNVGEAVQVIAVTSATQAEGKSTLSCNLAIALAEAGWRVVLVDADLRRPHVADYLGLEGDLGLTNVL
IGEVDVAEVLQPWGDLPLTVLPSGSLPPNPSELLGSKAMSDLLATLKQRADVIVVDTAPLLSITDGAVIAAQCDGAVLAT
RRGATTTSQVATAANALRAAGARLLGTVLTMAAMPKLDAYHYAAYKIATDAPVRPRVPAKSRKSASSPRQVAPTQSTGAE
HTPAEAEPELSPSQR
>gnl|bykdb|A0A2W4XST1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia xyli] (length=478 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDQLAELVTSDAPLNTTLISITVDDTSAKQAADIANATSESLTNVVQNIEATDADGTSTVKLTRVK
EAQVPNAPVSPNVPVNVVLGLLVGLALGVGVAVLRETLDNRVRTESDVEKISEKPVVGGIAYDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVESEGKSTTVANLAIALDSAGFRVILIDADLRRPKIATYMDLEGGAGLTDV
LIGRASIEDVSVPWGRGNLVVLPAGPIPPNPSELLGSRAMQDLIAGLEQQFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDEDTPMPKPPKRGRVAATRGAAR
>gnl|bykdb|A0A2W5CP38 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium granulosum] (length=496 residues).
MKFTNFVKLTRRRLVTILLCTLLGVAAGVGLLLTTPATYTASATAYVRVSVASSTNGSTDNYYSASQLASQKAKAFVTVF
TSQTVAQQVIHDLGLSMTPDALASHITASNEANSLTIKVTATAYSADTARNIANSVISESAKQVKNLEGEKSPVQVVMMT
PADLSQVKKEPSPAKYVIAGLLAGILLGYVVAGIRQLTDRRVHTVHDVTDRVDKPILATIPTSSTVAAISTDSTDDFRAA
EAIRKLRTNLRYAMIDNSSKVILVTSSLQGEGKSSVAGNLAKVMALAGEDVILVDADLRRPGVQRNFDLEDGLGLPEVLI
GAAPLEQALRTTSTAGLSILPCTDTPPNPSELLGSQHMSELVSFLAQDHVVIIDAPPVLPVTDSVVLSRLADNVIVVARV
GRTTVDQVENTVSAIEDAGGLVSGIVLNRADSSKLSNLRYGDSAYGYGYSKYDSDYRASTDKTPQTDSTTRQESGEEVRH
GGQAPDSGSTSIARLE
>gnl|bykdb|A0A2W5EY44 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria rhizophila] (length=447 residues).
MDLQQYLQTFRKYWRSILTVLSLCVGAALVFTFLQTPKYSSTSSALIAVDTAATPGELSSGALYAERQVSSFVALADSAL
VLDPVIDELGLNVTPQALRSRVSVSAPAGTSIVDVTVTDTNAGRAAEIANAITASLKNVTSDVVPTGPDGDEIVTVTVVE
TAAASSRPVSPRPVVNIALGLIAGVVIGLGQALVRRVLDSRIRTRDDLEEVTDAPVLASVVHHKGSDRPKDGAAPTRGTA
WASDESYRKLRTAVGFVALGGERRSSIVVTSSVQGEGKTETSTNLAKVLAEAGARVLLVDADLRRPQVGARLGLDDELGL
SDVLTGRADLNDVLLSVDDLSVLPAGTVPPNPSELLGSEALAELLALVEAHFEYVILDAPPLLPVTDAAVLSHQAGGAVV
VARAGVVRQNQLTEALSILEAADASVYGVVLNDVPVSQIDGYSQYYR
>gnl|bykdb|A0A2W5XV31 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Isoptericola variabilis] (length=517 residues).
MPEERRMDLIEYLGVLRKRWPVAAALGILGAVVGLGVAERTPPSYTATAKVFVAVGGGQTTSDLLQGSTYVKNLIDSYTA
LIDMPVVLDPVAETLGQPGGGRGLAGAVTAEAPLNTSIIEIKVSGGDPAWAARVADAVANQLPLSVDALTAAADADAQGV
AITVVSPAVEPTHPSQPRTRFLVATGGGGGVVLGLVGALLWALLDTRLRLPRDLEPVAGGLPTLGTIPRARRPQVLSVVE
DPLGSTAEAYRIVQTNLRYVDVEKPASLVVVTSSVPGEGKSTTARNLAAALAEGGRDVLMVDADMRRPSVSTVLGVEGAA
GLTTVLVGRADLDDVVQPVGPGLDILPVGSVPPNPHQLVASPAMRALLARTRARYDVVILDAPPVLPVTDAAVLSTMADG
TIVVVGSRRVRRQQLTHALRTLASVDARVLGLVMTFVPRSGQDTAYYGYGHGTRGAVARLLGRLRGRGEGPARPVGPVLP
AERATVGAAEDAPAPDAEPAAPDAEPAVAAADARPPA
>gnl|bykdb|A0A2W6BNW8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Solirubrobacterales bacterium] (length=692 residues).
MRGFPRKKPRDGLIIFPTDERRVESGPPSADRAGRGRAESGPASERPADQGRSSRRTAAPAPPGREAARPVKPDPPTAPS
GSEGPSASERTAASLAARAAQAQPPPAASLPSSRGPEAQGPPRPEHQVSPRPEHQVSPRSEHQVSPRSEHQSAPQELYLT
ALPSGSDSITSPPPVDLQTYLRVLWRRKWLFLAVVILVPVAAYLYSARGAKVYQASVLMEIQPPSDASVLTQSGVVATDQ
SGGLLNNQSVSIAARLIQTSGVALAAARHLSLPPSQADSLLGDITVTPDTTTGFITVTASAPSGQNAADIANAFGAAVNS
VQAKQAVAHVNDAISGLVSQLGALPANARTERNQLTGQLQRLRALRAAQSGNAQIIEPASAPGAPSSPRPVRSTLLGLLI
AVLLGLGLVALAERLDRRVRQPEDFEELTGLPVLSSVPRSAFNGGSQPPIVAEAFRSLRASLDFFNVDREVHSIVVAGGR
KGDGKTLVSLGLARACALAGRDVILLDGDLRRPMIASRLSLSAAAGLAGVLTGRAELADELQDVPVRGREGSRLRVLAAG
KSPANPSELLGSERMTRLLEELEPMCDLVIIDTSPLLAVSDALPLLDRTSGTLLVVRLGVTQRRDLRHLRKLLDAAEGTA
LGTVVTGASERGAYPNEYYLLDYQTTSGSLNGDAPTAPAGRGPLALLDRWRG
>gnl|bykdb|A0A2W6DJY1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudonocardiales bacterium] (length=520 residues).
MDLSAYLRAIRKSWWIIDLVLLLGAGAGYLQSASTTPIYAARITFYVSTPNLTAQSPLGSAQFAQDRATTYAELLSSESL
ARAVIASTHVDLSTGALTSEIAGSAQLNTVLIKATIKDSSVKRLAIIARSVAEEFPKMVESLDSSGSTKSEVHLNVVSGP
TVGSSPVSPRTKLNIALGGGIGLLLGLLLAALREVLDVSIRTSDALQEFGGAGVIGTVVRDPGIRRAPLLVGEHARSRRA
EAFRHLRTNLQFINAAGRAKVVVITSSVAGEGKSLTAANLALVVAETGASVLLIDADLRRPKIAYYLDVEGAIGLSNVLA
GQLSIEEATQAWGPRGLTVLPSGSIPPNPAELLGSDPMQRLIEAARKTYDMIIIDTPPLAPVTDAAVVASHADGVVVVFR
HGKTRRGHLTTSLGALRAVDGRVLGFVMNMTPSRAADRTYTYYQARPSRPVKKRFSRLRHRGSPQPDPVVEPLPRHESML
PPKDEGPRQSKLDPHPEFDDGGEGSSGPWWASRGTSTRRQ
>gnl|bykdb|A0A2W6RXY2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia sp] (length=494 residues).
MTQTQHVHEAGRDALRHAVGVIKRGWLVVLLITVICGAAGLIYSLLQDPVYRSTATLYVTSGTEESVQSAYQGSLASQQR
VISYTKLVDSDAVLSAALGGSDLQIGVSEAKSALSASTTPDTVLLNISAESHNKDEAAGLANAVAESLTTYVRQLETPSG
GGSPLAKLTVVTPASPHSSPVAPETMQIVSGSILGGLVIGLIVVFLRDRFNNRIRDDEEMASVTSAPVLATIPSDDLLKK
QGLIQFSSGATLAAESYRKLRTNLSFASVDTPLRTLVVTSAMAAEGKTTTAMNLAAALAETGKRVVLVDADLRRPQVYHR
AGGMGDIGLTNYLKGDGSMADLLQQSDVDGLQILGSGPQPPNPAELLGSKKAGQGIQNLSTLFDYVIIDSPPLLPVTDAA
VLAQWADGVVLVARANQSRIPDVTASIDQLEAVQAKLVGVVLTDVPTRGGAYKYGYYYSSTDVMRKPGFFSRFGKKTPKH
QDIEAVLESTPAPR
>gnl|bykdb|A0A2W6UMX9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=460 residues).
MKPDSSAWTLSTVREAIRKFWLLIVGLTILGGALGYGLSSTVTPIYQSTATLYFALNQGNSASDLAQGSTYTQNQMLSFA
QLATSSRVLDPVIDELELDTTPRVLARSVEVTIPQDTVILQVQASSTDPDEAAAIANAVSDSLTDVVRDVAPKGPAGAAT
ITAQVIDEAVVPLVQSIPNKPRDAALGALLGLVVGVLAALAITLGDTRVRNETVVAQVVDAPLLGSVTRTRGEGGLVVAR
EPLGHTSEEFRRVRAALSYANVSDSARCLLVTSSTPSEGKSTFSSNLALTLAGLQHRVLLIDADLRRPRIADYFGVEGAV
GLTTVLVGDVDVEVAKMTWGSTTLDLLTSGSVPPNPAEILTSDAMRELLREASAAYDYVVVDSPPVISVADATLIAPLMD
GVVVVVDASRTRRAQLANSVRILQGSGARILGVVLNKAKVARRRRSYYAEDAAVEGDARG
>gnl|bykdb|A0A2W6UWF7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=528 residues).
MELSDYIRILRKNWLVIVALTLLGIGAAAAYSLTREPVYEASSQVFVSSQAGSTVAELQQGNTFTQARVTTYVNLVNTPI
VLNPVITELDLEDTTAASLGAQVSATSPLNTTIIQVSVADPDPVLAADLANAIAASLTSQVEDLETLPDSDTSPIKLTRV
KDAEAPFVPVSPNVPLNLALGALVGLALGIGFAVLRTVLDTRIRGTRDVELVTDRPIIGAIPFDPRAKERPIILKEDPQN
PRSEAFRALRTNLQFLDMDGGHSFVVTSSVPSEGKSTTSVNLAIALADAGKRVVLVDADLRKPKVHEYLGLEGGAGLTDV
LIGRVQLTDVVQQWGNRSLFVLPAGKIPPNPSELLGSQQMHALLESFSRDVDVVILDAPPLLPVTDAAVLAKRTSGAIVI
VAAGETNRHQLEGAIDALETVDAKVAGLVLTMVPTRGPDAYGYGYGYGYGYGGYGYSQEPAKTGKAPKTPKSPGPRTRRG
QSGAPGAPGASGAPGAPGASGAPGAPGASGSQGRDGAAATAGQRSQTP
>gnl|bykdb|A0A2W6VZZ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=500 residues).
MTDAKTPVSPGRIFGVLLRAWWILALAGVAGGALAFAYSSTIAPVYQSTASTWFSMRSGTSGSDINQGSAYTQNQMLSFA
QLAMSARVLDQVREDLELDDMTNAQIRNMTSVSIPQNTVILDITAASTQPPFAAELANSIAQNLATVVDAIAPKDEAGTT
TIVAEVIEPAIPAVFQSSPNKQRDAALGAFTGVLLAALALAVWALLDTRVRSEEVLRRLTDLPVLGAIPLRKDKSRRPIV
VSEPNGTSAEAYRRLRTSLRFAAVEHDIAAIAVTSSIPGEGKTSTAVNLALTYAEAGHRVLLVDADLRRPMVAETLGVEN
AVGLTTMLVGAVDFEEARLPWGETSFWVLPAGEVPPNPAELLASARMSELLRELRAECDIMIVDTAPLLSVSDAAVISQY
VDTTIVVADVTKIRLAQLSRSLSALQRGRAQVAGILFSRVKRSRGDDYNYYYSPARAKRRRPALPPLRRERPRDEAAATE
ATTVERTAPEAEVVARSSGD
>gnl|bykdb|A0A2X1B539 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium bifidum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQVSSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A2X3GKL3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia kristinae] (length=486 residues).
MTLLDFLRLTRANLKYLIIFTVAGALLGLGVAALQPKVYSATSSGYVTAGGGSAVGDILSGDSAAQAKASAYLPLVTSGP
VAKKIAENNSVGIDESAIPSHLSASVEPNSTLIKVTATASSPQDAATLANNALQATADYVSDLEGRESAVKVTPLDDAQA
PDGPVSPSYRNYLLIGAAVGLVLAYLIAFLRKFADVRVRTTDDLENATEAGTLGILPKSSALDENTFLSDRADHQSEEAL
RQLRTNLRFVSVDAPPRSIIVSSPNPGEGKSTVSASLAHAFAKAGQPTILIDADLRRPTQAKIFGLDDAVGLSQVLSGQV
GPEEAIQRIGDTELYVLPAGRIPPNPSELLGSSKMQRLIQEMSQEYLVIIDVPPLLPVTDGSLLSANVDGAILVSVCGRT
RKDQAQAAAQALGRVNGHLLGTVMNMTPEKGLGSHYYGFGYGGYRSGYQAYYGQDGEGSGSGSSPAAGGKHGAKGRGRRA
RTSHSS
>gnl|bykdb|A0A2Y8ZUF1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Branchiibius hedensis] (length=479 residues).
MRIDEYYRILRRHWKIIVAATLAAIAVMFVWDLFQPKVYQASSSGFVTAGQPQNLSEAAFGDQLAKSRATSYVDVAQSRA
VAQQVIDDLNLQTTPAALINQISVDQPTNTVLLRISANASSPEQAQAIANAWVKALAAQVAKIEGSGANSLRINVQDPAQ
LPSSPISPNTKLDLIIAGIVGLLGGIGLAMLRSQMDGRLRDPNKVREQFGVPVLGSVPQNAQLSKSERTIPIVVGEGVRT
DTEGLVTAEAFLKMRTSLQYMNVDRTLRVIVVSSPNPDDGKSTVAANIAASVALSGEKTLLVDADLRRPSIATGFGLLDG
AGLAEVLAHRVDLADVLQDAPETPNLSVLAAGLTPPNPSEMLGSKAMKTLLDDLAKEYFVVIDAPPLLPVTDAAILGTQV
DGVVVVICAGKTLDHQLETSLRSLHEVHADVLGVVMNKLSQRDMQSYYGSGYGTYYGRDLDPPARSARERSVRRQRSKN
>gnl|bykdb|A0A2Z3V1Q8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Streptosporangium sp. 'caverna'] (length=481 residues).
MKGCVEPVDLLYFARLARRNWLLILFSLVLAVSTSLIVTARMPTKYVATISMLVSGYDREGSLSTAIQAGTLSQQRVQSY
ANLLPSRRVVSQITTGDDIRRVQENITAEAIPGTVLLRATVTDTDPARAARLANALGGAFTRLVDEIEQPLPTRKRKHAK
KDEEKDGRSSRKDDHPNVKVAVVDPADVPRAPISPRPLVNLALAILTALLIAMASLVLRDRMDTTIKTSEVLHEASKSSV
LGIIGYERDARRHPLILRDRGRSSRSEAFRALRTNLQFIGVDRQPRSLVVTSCLPGEGKSSTSANLAITLAQAGWRVLLV
DGDLRRPRIPNYLGIEGATGLTDVLIGRARLENAIQIWGESDLAVLPSGQIPPNPSELLGSNGMRTLLSGLTERYDIVII
DAPPVLPVTDAVALAAICDGALLIARYGKTRREHVVRAVEVLTSINARLVGTVLNFAPAKSNRYYGYEYEARAEVTPRVS
V
>gnl|bykdb|A0A315S2E9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium animalis subsp. lactis] (length=490 residues).
MAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSAN
SSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNIAVTDADPSTAARIANGVAA
SLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKQSSPKWSLNILVGVLGGLIIGILAALLKDVLSKKIQDESDVTDIVDAP
IIGRVVKDDILAGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLVVVTSAGASEGKTTISVNIAAALAEDGPRV
LLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVANAMQQYDY
IIIDTAPMVVANDAVIFMKQGGTLEMVCRRDQTLKRDLHEIADELETLDMPVTGVIINCAKENKKALENSNYYYYSNSSP
AEKNRKNRKS
>gnl|bykdb|A0A315S789 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Williamsia marianensis] (length=492 residues).
MSPTSQDVQELGKDSLRSAVGTVKRGWILILVSTLVVGIGGLIYSLLQSPVYRSTATLYVTSGNEANAQTAYQGSLASQQ
RVTSYIKLVDSDGVVAPAIGAGGVPLSLSDAKAALSATTTPETVLLNVSAESTNRQTAADLANAVAESMTTYVQRLETPA
GGRTPLAKLTVVTPAGASDTPISPRTKRNTALALVIGLLAGIAVVFVRDRYDNKVHDEDEVQDITDAPVLASVPSDGLLK
ERGLIDFSSGATLAAESYRKLRTNLSFTSVDRPFRRIIVTSALEAEGKTTTAINLAAALAETGQRVVLVDADLRRPQVNH
RTGRMGDVGFTNYLKGDGGMNDLLQPTDVENFWVLASGPKPPNPAELLGSKRAGEGIEELSAHFDYVIIDTPPLLPVTDA
AVIARWADGVLLVARANQTRLPNIASSIEQLDAVQATLIGLVLTDVPTRGGAYKYGYTYGATPETKSGPFSRFRRKPKHK
AIETVLDPNAEG
>gnl|bykdb|A0A316AE69 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Quadrisphaera granulorum] (length=461 residues).
MELVDYVVLLRRRWLVLVLGGMLGGVLGVVSTVGQPDSFRAEATVFLSLDRGGSVSELAQGSSYTQGIIQSYVLLVTTPT
VLQPVIDELGLDTTPQRLAKNITASSPVETVVIEIGATAGSARGAADVANAVASQLAVAVSDLEPSASSNSERIKVTTIA
PASPPPFAFAPQRKLMAVLGLAAGLGLAVLFVVLRELLDTKVRTEEDVALVTEAPVLGAISERAGSEPELVPFSGDAGSP
RGESYRRLRSNVQFMNLEGTSQVVVVTSSSAGEGKSTTAVNLAVTMAGAGARVLLIDADLRRPTVAKILGLVGEAGLATV
LSGRAALADVLQPVGPQRMDVLTSGETPPNPNELLGSHQMGVLLQAAREQYDVVVLDAPPLLPVSDAAVLAAQADGALLV
VNGSMTTRKHVETSIQSLLMARARLMGVVLNRVKGQVSSPYYYGPTVAQKPWGLRLRRSPA
>gnl|bykdb|A0A316AFM9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Quadrisphaera granulorum] (length=503 residues).
MELTDYLRVLRKRWLSIVVLTALALAGAAAATLAATPEYQAETRLFVRAQGQGSVSDLQQGNNFVQQSVQSYADVARTDI
VLGPVISELGLQTTPGRLAQQITAEAPLDTVLINITVTDPSPQQAAQIANAVGASLITTVATLEGNGTGTATPVQLTTTQ
PAVVPAAPSSPNAPLNLALGLLVGLAVGVGLAVLRETLDTTVRGEQDLSQLGLPVLAGMPYDDEAREHPLVVVDQPRGVR
AECFRQLRTNLHFATAASGARSVVVTSSLEGEGKSTTAINLALTMAGAGIRVVLVDADLRRPMVATYLGLEGAAGLTTVL
VGQASLDDVLQPWGDFEGLSVLTSGGVPPNPSELLASDHMTKLLHELEQRFDVVLLDGAPLLAVTDSAVLSEVVGGALLV
VGSGRARRPQVARALQALSAVEATVLGAVVTMLPTKGVDAYQTYAYKYQPLDALKTPKSRRSRAPRSGGETVTGELPAEG
GASAPRRPRPAGPRTTRSGSAER
>gnl|bykdb|A0A316B618 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter iranicus NCPPB 2253 = VKM Ac-1602] (length=485 residues).
MELRDVFRLLRDHWIPIIAAILLGTLVAFGWASLQSKQFVADSQGLVSVATGGGSDPSQEIYTQQMAQTVAKSSLATYVP
IATSRDVAQIVIDTLGLTVSPAALISSIQVVPDTVAPVLKVSATASTPEGAQRLADAWVGAIATKVKQVNQETGVGDSVT
LTVLQTAALPTSPAFPNTRLFLAVGALIGLVIGLIYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPTDKRLSETNRIVPE
ADTTDYVAADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPADGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVA
KSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTD
GAILTARTDGALVVITAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSTRSGARPDAAVEP
APTSV
>gnl|bykdb|A0A316IAU2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Lechevalieria deserti] (length=487 residues).
MDLSEYFHALRARWRWVVAGLLLGLGVAATAVLATIPVYQTSTQLFVSTQQSKDDIELYSGSSFSQQRVKSYTQIVTTPR
VLRPVIEELGLDTTPDQLAEQIVVSSPSDTVLVDIAVRDTDAARAARIANEISESFVAVVDQLERSASQPSPVRISSVRQ
ALEPTVPVLPATTLTLIMGVVLGFVLGAIAALVRHTTDTYVRTERDLGGVVNAPILGEIPFDRQSADQPCSPTLIDQPQG
AAAEAYRALRTNLQFVEAAGQLNSLVVTSSVAREGKSTTAINLALALADNGLKVVVVDADLRRPKIAHYLGLIDTVGLTT
VLLGKIDWRAALQKWGGQLHVLAAGDAPPNPSELLSTQRMTDLLRQLESEFDLVILDAPPLLPVTDAALLSTCAGGAVVL
ASSGRVRRDQLSRALRSLEIVGARLLGVVLNMLPASPRTGATYYTNSYYTTTYRPRSRWRRLFGGAPSAPAQPETVEDLR
SKSAAIS
>gnl|bykdb|A0A316JEM7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Candidatus Aquiluna sp. XM-24bin5] (length=715 residues).
DISLDTPEAANTRNLSGIQESVVLDEGQITTEIEVIQSEAISRKVVEELNLTENALFLANRETGTSRLISGLRNIAAPLV
NVLRPQPEDDGLLPLSEEDRAAARLAEAVTKLQGNMAVSRVRGSRILQVSYTAMSPSLAARIANGIADVYINDQLEAKYD
ANERATNWLRDRAEQLRAQSNALDSSVEQFKQENGLIGISGSSNVGTELERVAQQVSNAQADLLALEARLERLDDIVERG
DTTAAVSATATQSITSDLRSRFLDTLKEYNSLVSRIGEEHEQSRRLATELEQLQELLFEEIKRFAEVTANDVQVARERLV
NLQKSRDELEIQLGADNEVLVELRELERNADTVRSLYSNFLERYQTSLQQQSFPVSDVRVINPAKIPGTPSDPRATRILA
LATILGFMVAAGYILIRELLDNKIRTEEQIRSALGMEFLGGLPLISPSRKRVLDIFKPSEALGHRQISFSDMLRYAVNKP
LSSFSETLRSGKMAITLRRVDKHGLDAPKTAQGNVVGVVSCFPGEGKTTVSANLATLLAKQGSSVILIDADLRNPGLTRS
ITGDVSEGIIDVLTADANWRDIYYEDEETGVHVLPSRLGGRVVHTSEIVGGPAMGLLMQDLRRHYDYVIVDLPPLGPVID
ARAALQFLDGIFFVIKWGATNVRFIQNILQSDPRLQEKSYGAFLNMFDPKTAHQYGSYAGSHYYSYGYTKYYTDR
>gnl|bykdb|A0A316TK00 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. CCTCC AB 2018079] (length=509 residues).
MDFKQFLMVLRRRWRTIIAMLLLGLGVAAAISYFLMTPKYESTSKVVVSVNASSASEASSAAFFLQNRVATYADLAKSTE
LSERVIDVLDLDMTPKELSDKISTEVVQETSALTITVSDEDPREAQTIADVVTTEFQAFAEEIETIGSDGTSQISLTISD
SPEYNGSAVSPDWILNLLAGGLIGLLLGVALAVSRELLDRTVRTADHISEVTEAPVLASIGFDSQIRAAPLLTDLGAFAA
RTEAFRLLRTNLQFIDLDQRARVLVVTSAVPGEGKTMTGTNLAVALAQTGRTVLIIDADLRRPRVASTLGVDPAVGLTTA
LVGKAQIEDAIQVHEPSGLHVLASGAKPPNPTEILQSRVTHDLIRRLRQSYDMIIIDAPPLLPVADASVLSTLADGSILV
VRHGQTTRDQVTEAVNRLHQVGGKLYGVVVNMVAKRAIGSYYYYYYEETSPVRDGKSKNGKGKDKGSGSGSGTTRVRESR
SRRSGGTRKAVPASSSRSAEEDVQQPPMS
>gnl|bykdb|A0A317CT00 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. 5R2A7] (length=483 residues).
MDLLRQLRHVRRHWWVVLVTFMVALGVSAFVTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAENPVGLTADEVQRKVSTSTEAGTVLLRASITDTDQTRALRVTETLAAKFVELVQRVETPPEGKAPIKIEVVSGP
RVSSSPVSPQPARNLTLGGLLGLVLGVALAILRGVADVRLRDAAGLQRATGSPLLGEIPFESGARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTATPSVPADRAASARHSEGSGVGDRTQELTR
LPR
>gnl|bykdb|A0A317DJW6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. 4G51] (length=483 residues).
MDVRTYLRLIRRHWWIVLVTLMAALGTAALVTVQSPPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAESQVGLTADQVQRRVTTSTEAGTVLLKATVTDTDQNRALKVTEALSAKFVELVQKVETPPDAKNAPIKLEVVSG
PRVSSSPVSPQPVRNLVIGGVLGLLLGMALAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGARNAPLIVGEAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGIGLTDVL
VGDVEVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVVIDTAPLLAVTDGVVVAVQADGALLIT
QQGRTSRSQVAAAARSLNSVSVRLLGCVLNMAKVPKADAYQYEAYRVSVPAAGPDRAPAARRGDRAGANQVSDPTQELTR
LSR
>gnl|bykdb|A0A317DND7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. 4G51] (length=520 residues).
MDITQYLRALRAHWFLVVLVTAVGGAAAGVYSWVQTPMYQADVQLFVSISSTDAGAADLNQGGTFAQQRVKSYVDIVDSP
TVTNEVIQSLQLPYTADELAEEITAQSPLNTVLLDISVIDPSPQLARDIANAVASQVSKFIADIETPTGGKASPVKATIT
KSASLPAAPVSPRTSLNLALGILVGLAAGAGLAVLRHTLDKTIRSRREAAEVADAAVVGEFADDPKTKKRPLIIDDPTGR
RAEEYRRLRTNIRFLSIDERIGSLVVTGSVEDEGKSTVAANIAIALAQSGETVVLIDGDLRKPMIATLFGLSSGIGLTSV
LVGDVQIEAAMQHWRRDLPLYVVASGPTPPNPSELLGTRRLADLVAGLVANGMTVIFDSPPLLPVVDAAVLARATDGALV
VTRVGSTKTDQLETSIQALRQVDARILGVVANGVKRKKKRGYDGYYTDQHSGWTGAAAAKAAQAVMAPPDTDRAPAATVA
PPQGRATPPPPARGHQQRPAGGRHIDETQHISVRELRDRT
>gnl|bykdb|A0A317JTD7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora globispora] (length=477 residues).
MTVRKNLRLIRRHWWIVLLTLVAGVGIAMAVTVRTPPRYQASVTFFVTTPTPGVTDAYRGNLFLQQRVKSYADLLGSDRL
AQSVVAENPLGLTAGQLQRRISTSTEEGSVLLKAEITDTDRNRALKLTQTLATRFVDLVQKVETPTDGKPAPIKLEVVSG
PRVSSTPVSPRPERNLPLGGLIGLLVGAALAVLRGAADVRMRDAAALQRVTGSPLLAEIPFESDAKSAPLIVGEAANSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVEVGDVVQRWGDKSLLVLPSGAAPPNPSELLGSKAMADLLLALRESADIVVVDTAPLLAVTDGVVVAVQADGALLVA
QQGRISRGQVAAAARSLHSVSVRILGCVLNMARVGKADKHHYAAYRVVTPPGAPRPKRAGAGKRVNDRTQQLSRPAR
>gnl|bykdb|A0A317KP48 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. S4605] (length=486 residues).
MDLYRQLRLVRQHWWIVLLTIMVALGVTAFVTVRAEPRYVASVTFFITTPSQGVTDAYQGGLLMQQRVKSYAELLTSDRL
AQAVVAENSVGLTAEEIQRRVSTSTETGTVLLRASVTDTDQTRALRVTETLSAKFVELVQKVETPANGQTGPIKIEVVSG
PRVSSSPVSPQPVRNFAIGGLLGLLCGMGLAILRGLADVRLRDAATLQRTTGSPLLGEIPFEGSAKSEPLIVGEAVNSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRTQVAAASRALHSVSVRLLGCVLNMARVPKTEAYQYEAYRVVASTATTSVPADRATNGRHAERAGAGVPDRTQE
LTRLPR
>gnl|bykdb|A0A317ZJF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium arcticum] (length=480 residues).
MESVEYLRSIARRWLTILVLGVLGAGVGFAYASAQPALYRATSSVFVSSPRGETTNELVQGFTFTEKLVQSYTQLATMPA
VLQPVIDKLELDTTPARLAASVTASTPLNTVIIEVTVVNRSADQAARIANAITRSLATTGQELAPEGPAGSASIALQTVS
TAQPPARPFSPNTTLLVLTGLLIGLALGVAYAVLRDILDTRVRTDADIDRVTDVPVLGKVGQRGRKVPAGITMRTMPRST
LAESYRRVQANLEFIDVDHRPRLMVVTSPLTKDGKSTTSVNLALALAERSPRVLLVDADLRRPSIADLCGLDGDVGLTTV
LRGAISPEEAIVPCGDSLSVLTAGALPPNPGQLLGSAAMRTLLQTLAARFDYIVIDSPPLLAATDALGLAHIADGAIVVA
RYGVTRRAQLKDTIGALENVNARVLGIVLNGVKESRPTDYYGMVSVPEGPGVAKADAAPEAAVPPAPAVSRRAAERTTAG
>gnl|bykdb|A0A318NCD5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora arborensis] (length=487 residues).
MELLRHLRHVRRHWWVVLVTVMVLLGVSAFLTVRAQPRYVATVTFFVTTPNSGVSDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAETPVGLTADEVRSRVTTSTETGTVLLRASVNDTDQTRALRVTESLATKFVELVEKVETTPEGKAPLKIEVVSGP
RVSANPVSPQPTRNLTLGGLIGLVLGVGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFESGARAKPLIIGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGVGLTDVLV
GDVKVGDVVQRWGDKSMLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRSQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVTSISKGSVPSERAAAGRHSGTTTGVNGVADHTQ
ELTRLPR
>gnl|bykdb|A0A318RQJ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Williamsia limnetica] (length=498 residues).
MTQRQQKIEEVGRDSLRKVLDVVKSGWLVIVLAALACGAIGFLYSALQSPTYRSTATLYVTSGTDDNVQSAYQGSLASQQ
RVSSYTWLVNSDAVLIDALEASGLDITLSSAKAAVSASTTPETVLLNISAEGTDRDQTAALVNSVSASMADYVTGLETPT
GGGAPLAKLTIVTPANADAGPVAPSTTRNTALALLAGLLIGLAVVFVRDRLNNKVRGEQDLAILADAPVLAAVPSDDLLK
KQGLIDFSTGATLAAEAYRKLRTNLSFTSVDKPSRRIIVTSALAAEGKTTTAMNLAAALAETGKRVVLVDADLRRPQVYH
RTGGMGDVGFTNYLKGDGSMADLLQPSEVKGLQILASGPQPPNPAELLGSKKAGQGIDNLSAMFDYVIIDSPPLLPVTDA
AVLAQWADGVLLVARANQTRLPDVAAAVEQLRAVQADLVGVVLTDVPTRGGAYKYGYYYTSSDVMKKPGFFSRFGKKKIH
QHQNIESALEPASTIEVR
>gnl|bykdb|A0A328MVK7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora noduli] (length=492 residues).
MGALLMDLLRQLRHVRRHWWVALVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNTGVSDAYQGGLFLQQRVKSYADLL
SSDRLAQSVVAETPVGLTADEVQRRVSTSTETGTVLLRASVTDTDQTRALRVTESLANKFVELVQKVETTPEGKAPIKIE
VVSGPRVSADPVSPQPARNLTLGGLVGLILGIGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFEANARSAPLIVGDAA
TSARAEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGL
TDVLVGDVKVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGA
LLVTQQGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTPEASVPADRAASGRHSATADGVNGV
PDHTQELTRLPR
>gnl|bykdb|A0A328NYI0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora saelicesensis] (length=492 residues).
MGALLMDLLRQLRHVRRHWWVALVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPSTGVTDAYQGGLFLQQRVKSYADLL
SSDRLAQSVVAETPVGLTADEVQRRVSTSTETGTVLLRASVTDTDQTRALRVTESLANKFVELVQKVETTPEGKTPIKIE
MVSGPRVSANPVSPQPVRNLTLGGLVGLILGIGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFEANARSAPLIVGDAA
TSARAEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGL
TDVLVGDVKVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGA
LLVTQQGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTAEASVPADRAASGRHSATADGVNGV
PDHTQELTRLPR
>gnl|bykdb|A0A344UWM2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium virtanenii] (length=486 residues).
MTPESSGWTLSRIWGTLRKLWGVIAATVLAGALVTFAATSVMTPHYESTSTLAFSAGKGSTSQELADGSTYMQTQMPTYA
QLATSSAVLQPVIDDLGLKMSVNDLKKLMVVTIPQNTLVLQVAVSWTSAQESATVANAVAQSLTTVVRQVAPKPASGQRS
AINVTLVDKAVAPAHQTSPDKVKDSILGALGGFIIGVLAVLVWTLLDTRIPTPQALKQLTGASLLGSVSRVRTPSRLWVA
EDPSGQTAEEFRRIASALTYATFDKRARSIIVTSSGPGEGKSAISANLALTLASLGSRVLLIDADLRRPRVAASFGLVDV
VGLTTVLMDRTPLPQAIQKHPGSDLDVLASGALPPNPAEFLTSERMRTLLKEAAEHYDFVLIDSPPVLSVADTALLAPLT
DGTLVVVDAKHTRQGALTATVTGLEGAGGRITGMVLNRARLTRRGNRRYGEYLSEKPRKPWRGPASIGHSPTSAAAAPAK
SARRGQ
>gnl|bykdb|A0A344UX64 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium virtanenii] (length=522 residues).
MTLRDFLRLTRRRLGTIIASTLLGAAAAAGLLVLLPTHYTSQATAYVRVSVPKSASGSTDSNVYFNASQLAAQKVKAFVP
LFTSESVAQAVITQLNLSVSPTELAADLSASNAANSLTINVTATGDSPERSRQIADAVVNQAAVQVRRLEGASSPVQVVM
MAPASLSQVEKSPSPLKYMAAGVLAGLLLGYAFAFTRQHFDTRLRTAADITDRFEVPILAVLPQSKSIARTEAAADSDFQ
SAESVRKLRTNLRYANVDKQARVILVTSPLQGDGKSSVAANLAKVMAAAGDDVVLIDADLRRPSVADTYSLRGPLGLLQV
LVGSVDIENTIRHGLSVLPAFETPPNPSELLGSDRMAELVRYLSRDRVVVLDAPPVLPVTDAVVLAHLADSVVVVASAGH
TRAEQLDQTLEAIEHGEGAVAGVVLNRAASSRLARMRYGDAEYNYAYSQSEYARQGRPTPPSSTPRPQSHSEELSETRRM
PVISSDDEEAFSHAAAQPVQRTVAARHPASHRLKRAESEDLL
>gnl|bykdb|A0A345YSE8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium saurashtrense] (length=541 residues).
MTIEDFLRLLLRNLLLLLGITALGAAAGYGYSYTQPEVYSASALGYVSATAQTDDEGNPISQTSGNMDLQYTKAQSYLPL
FGTRAVGQSIVDELGLDASPDAVAGSLSVGLDPNAPILTVTARAATAEQASAIANAAVEATAQEARVLETGGDENVPVSV
QLVPYQTAVVPGAPVSPDRERYLAVGAVAGLLIALAVAWVRDRNDSRIRTAEDLEAAVSLPLLATLPESKELVRGKDGLL
AEPKTFAAREAIRRLRTNLRYVGVDEPPRSIVVTSGAPGEGKSVVAGNLARVMARSGQPTLLIDADLRRPRVAEQFGIDG
EVGLSQLLAGAVGVEDAVQPASVPLLSLLPSGQVPPNPSELLGSRRMQELIGELSRRFFVVIDAPPVLAVTDAQLLARHA
DGAIVVAVAGRTRAMGLSASVAAIRDIGATVYGVVLNRISTTRFTRIAYGETGYGYHAYAKYGDEVEIAPETDAVLPDTA
EEEAPAAAAAHADGTTSEASRAVRSAGSPEPAPTASASSAGRESPRRPRGRRVATTDRDQG
>gnl|bykdb|A0A365YAB1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Glutamicibacter soli] (length=478 residues).
MELPQYLLALRRHWILILVLAVLWGALGYGYGKISPPTYTAGSSVFVSASSGENTSELVQGSNFTQNLMQSYAQLATMPV
VLDPVIQKLGLDDTATSLAKRIDVDTPLNTVLINIKASAGDASASADLANAVADELTVQVQGLAPKQASGQPAIDMKPVA
KAAPPQFPSAPNTKLLAASGLGAGLLLGILYALLRSLIDTRVRTDQDLQRLTPYPTLGQVPRRDKKGTGVVMRTAPHDTV
SEAYRRLAANLEFLSPDNPVRSVAVTSALPAEGKSTLTLNLAVALAETRKRVLVIDADLRRPTVATVCGIDGQFGLTTVL
SGNARLDEAIVQWGPIHVMPAGRTAPNPAELLSSMAMAEILAASAGNFDFVLVDSAPLLPVSDTLALVRHVDGTLLVTRA
GSTKVRHLRTALNALEGVKATICGIVLNRVRVGVRAEHYSYNDTSAAKGRRVKPVGNPRRMQLPEAPERDVHDSAAHH
>gnl|bykdb|A0A366CQZ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. H6] (length=450 residues).
MGESRVSLRVIASSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLIGVLDTRMRNEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A366DF60 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. KT16] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEAAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHELFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSYEKYLSSVGSSARKGRRSRRKARTRS
>gnl|bykdb|A0A366DF83 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. KT16] (length=463 residues).
MNIIDFLRVLRANRLVILGCAALGLAMGLVYSLLQPTLYTATSSAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IASEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVKVTAMEDALAPATPSSPDRV
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMKDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVIRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAATGTTGDASPR
>gnl|bykdb|A0A366ILB0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brevibacterium celere] (length=533 residues).
MSAEDPAPATMDLREYLRIIRRKRLLVGLVTALGLALGIASTLLMPPKYEASTQLYVSVRSQAGSTGDLVQGSSFAREVV
GSYVDVVGTGVVLDPVIAELDLDTSVSELRKRVEASTPGESVLIDISVTDTDPEQAARIAGAVGRSLAEAVQSRLEPERT
DGQSSVTLTTTQEALTEEGPISPRPELLVPAGFLLGLLCGIGVAVLSVVLDKRVRSVRDVNQVTEKPVIGRIPRDPAVAE
DPLVVRTHPRSATAEAFRTLRTNLDFLAVGSGSRTFVISSSSVGEGKSVTAANISLTLAKAGLRVVLVDCDLRRPRIAEY
FGIEGGAGLTDVLAGRAEPSDVLQPWGEDGLRVLAAGRIPPNPSELLGSETMDAVIETLSDDYDYVILDAPPTLAVTDAA
VVGTKAAGVLLVAAAGSTEKHALDDAIRTHEGVGTSVAGIVVTMLPPTGEDVYGYGRDAYGEPPTAEDELGEDEIREGRA
RDCAASAEQDPGVPVDDERPGRDDPVGENPATVELPLVEAAWAESKTRPGGTS
>gnl|bykdb|A0A366KE79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium xylocopae] (length=471 residues).
MAIADLLRILRKHLTTAFITFAVVIAAVATVAFMMPPKYTATAELLATYTGQANTEQNTAEMSSGTSYLSTQIQTYPQLV
KTESVLKPVIDDLGLTMSVKQLADLVSATNPADTFMVDITVVGPNRQESAVIANSVAESLSRQISSALYAGKGEKSSVRL
SLVQRAQEPSSQSSPKVRLYLTAGAILGLVLAIVAAVLKEMLNTKVDSAEDVHEIIGGSPLGEIPQSEALKEHNLAVISE
PNGFNAEAFRRIRTNLSFLATEDADQGRLLVISSVSPGEGKTTVSTNIAAALAEDEKSVLLIDADLRHPSVAHKLGIEGH
VGLSHILSRQATPLDVVQKYWKTNFHILPAGKRPANASILLNSRIMTELVDQALTQYDYVIIDTAPLSVANDAIVFGRRA
GGLSLVVGKTISEKKDLVETVEAMHVAKIPLLGFIFNFADAKKIHTKNYYYYNNESKQNNRKGRRIATSPK
>gnl|bykdb|A0A366L660 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. LHW51205] (length=483 residues).
MDVLGYLRLVRRHWWIVLVTVMLALGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIRTASTTGTVLLKATITDTDQTRALKTTETLATKFTELVRKVETPPDGNAPPIKIEVVSG
PRVTSSPVSPQPTRNLVMGGVLGLLLGAALAVLRGLADVRMRDGAALQRVTGSPLLGEIPYENGAKAAPLIVGAAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAANALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVVPPAAPSVPADRAGSRRGAKAVGGDRTQELTR
LSR
>gnl|bykdb|A0A367FIB3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Sphaerisporangium album] (length=494 residues).
MPANPRSASLKGVNQVQGLYYLRLMRAHWAVVVLTLIASAAAAMVISAKTPPKYQAQITMLVTGDDKEGSLATAIQAGAL
SQQRVQSYATLVTSRRVIGQITSPDDVGRVQAGIKAEAIPMTTLIKATVTDTDPARAALLANKLGVAFSRTISVLERPSR
SSPSTVKVTVVDQAAVPGKPISPRPLTNLLIAELIALIVAFGALVLRDRMDTTIKTAETLQAVSKSPTIGMIGHERDAQR
HPLILRDHGRSSRAEAFRALRTNLQFIGVDRRPRSLVVTSCLAGEGKTSIAVNLAIVLAQADWRVIIVDADLRRPRVADY
LGLEGAAGLTDVLIGSASLDEVTQTWGPLPITVLTSGQIPPNPSELLNSQGMRKLLGTLTDTYDMVVIDTPPLLPVTDGA
SLAAVCDSTLLIARHGRTRAGHIARATELLSSLNARVVGTALNFVPTKGKDAYGYESGYEPDDGARRSTAGATSAVSISS
GADRPATISRAADL
>gnl|bykdb|A0A370CY70 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium moriokaense] (length=480 residues).
MTLKDLVKLLRARWVTVCVTMVAAVLAAVTVTLLTTPLYQASTRLFVSAGGGASEVDLNQLYSGNLLSQGRVLSYTELLT
GESLAQRTIDKLGLDMSAEALQKRVTATAKPNTILIDVKVLDESPVRARDIANALSDEFVAMVGELETPEVGSRPNARVL
VVQRASIPDDPVIPKTARNIAVGLGLGVLLGIGLAHLRDYLDNSVKDEAKLEEITHAGLVGRIPLDKERRKEPAIPFERD
TSVIAESFRKLRTNLQFLAVDNPPRLIVVTSSLPGEGKTTTAINIALTLAEAGHNVVLVDGDMRRPMVAAYLNVVGTVGL
STVLSGAADLSHALQKTGFPGLTVLASGPIPPNPSEILGSLAAKKVLVELRAQFDYVIVDSSPLLAVTDAAILATNSDGV
LVIARFGRTKREQLEHAMRNLHDVGATPLGAVFTMTPARGNVSYSYSDYGGDRAPQPSLRPQSAKRGYRRRATRAPFKER
>gnl|bykdb|A0A370E5G2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. AG1037] (length=482 residues).
MQFPELLRLVRRGWVTLLATTLVGVAVGAVAFLTTTPVYEAKAQLFVAVKSVDEGSAVEVVQGSSAAQLKVKSYVGVITS
SRVLTPVIDDLDLKTSPAALAGHVKASTPTNTVLIDLVVADTDPSRAAQIANSISKNFASVISNGIEAPTTGGSSPVSID
VLEPATVPTAPSDPKLAVTLGLSVVLGSAAGLGLLLARRALDTRIHSKADLEAITDVPVIGTIGLAPDIDRHPLVVHSKP
KGPIAESFRTLRTNLQFVDIGASERSFVITSAVPSEGKSTTAANLAVAIAETGASVVLVDGDLRRPRVAELMGIEGAAGL
TDVLIGAAELDDLLQPWGNNGLQVLPAGAIPPNPSELLGSVGMQALLAELTGRFDVVLVDAPPLLPVTDAAVISRSTRGV
IVVSGSKRATRAQFAEAIELLETIGSRVLGLVATLVPSQEVQGYGSYGAYAAYYGTTASAAPLPNRPTARRSRSETSGPS
PA
>gnl|bykdb|A0A370E8G9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. AG1037] (length=482 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMNADQLAKMVSATAPTSTTLISITVNDTNPVQATEIANAVSSSLTNVVQDIEATDANGTSTVKLTRVK
QADVPLSPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRTETDVEKISAKPVVGGIAFDGKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGARTFVMTSSMQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVNEYMEVDGSAGLTDV
LIGRASLEDVAQPWGRGNLVVLPAGQIPPNPSELLGSKAMQDLITTLEGQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVRGPGAYGYGRYGYGYGYGLDEAEPTQPDTKAPKQARGKLGTLRRA
DR
>gnl|bykdb|A0A371BP35 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. RT-1] (length=527 residues).
MSATVVPTEAPTGMELLDYVRVLRVYWRAIVASTLLTTLAAVGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAKA
KVKNYESVGKSRLVADRVIAALNLNTTADALLGSISVKVPLDTAEIRVTAESTDPSTAQRVADAWVNGLAAQVEAIEAAP
AAEAGGTGASVSAADAAAPAAATATAVRVLPLGKAVLPTSPTSPNQKLNLALGALIGLALGVAYAVIRRYLDRRISKAAE
IEQLFGVPVIGTLPVDHRLDKKSTVLDSGTAAQLQDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQSEGKSTVTA
NLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGAGVTDVLTGAAELVDVLQPWGALPNLAVLGSGRIPPNPSELLGSRV
MKNMLEALAEDAIVLIDAPPLLPVTDAAVLSRVADGAIVVVRAGRTTQDQLVQSLGNLEKVRGRIMGAVLNYVPTRGSAP
YSYYGTYTSVTCPEALSELQSADARCDSGAKGLVETALSRRRSKMGR
>gnl|bykdb|A0A371NXN9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. NEAU-LLE] (length=535 residues).
MRVWGRCRSRKRAFAHRQPGSTAVTVLDFLTLTRRGWKILVLAVVIGALAGAAYGFFAPKVYQASSTGFIAVEGDSVVAG
SDEAVARAGSYVPLINSKQVRDAIAKESDLDPSQLNGALSASVVPGSTMIRVTATSSSPKSALALANGGLNGLVKVIDEI
ESKSGNTSGTSISIIPMDNAVEPTEPVSPKPTLAIGIGALAGLVAGFIVIFLRRALDVRVRAHTDITELMGTGVLGRVPD
LGRKGKTDGDSHAQSIANEAFRQIRTGLRFSSVDAEVRVVMITSANQGEGKSMVAASLARVMAESGQRTLIIDADLRRPK
VAHNFGIDGTVGLSGVLSGQVPAPSAIQTTKDPNLYVLPAGAIPPNPSEMLGSVALSKLLAEFRRDFFIIIDAPPVLPVT
DASVVSTMVDGVVFVLAVGQTRKAEGAAARAQLQQVSARLLGVVLNKVSLKGGENGYGYGYGYGYYRQNRSYYVSPSKKD
KKGVQRTTQAPAVIPVQNAPKPQTAAAPSPAPDDPTSAQQDAAAGVPTLRRSARS
>gnl|bykdb|A0A371NYG9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. NEAU-LLE] (length=585 residues).
MEIRDYVRALKRHWIGIVLLTVLGVAVGFGWAAMQAPVYQADASGVVTVITPKDPDVALTPGANDVLTRNQVPTFVEMAQ
WRNVAEKAAEELGLDVPPEQLVQRIVVDNPAGTPILKITASGSTPEAARDLAEAWVNGLSATVDEREGTGAAGTAPINVV
LAESAALPTSPSFPDKRMAMLVGGVLGLGFGIAFALVRAASDRRVRAADDVEKNLGVPVVATLPISEEVDAEQRLLTDEQ
TGSKAGFALRESLRVLRTNLQFMDVDHPPRVIVVTSALPGEGKSTVAANLSATLAAGGSPVVLVDGDLRRPTVAKTVGVT
SPIGLTDVLAGRVELSQALQRSPQVPNLAVLTAGTIPPNPSELLGSERMKDMLAELAVHATVIIDAPPLLAVTDGAVLAH
QADGALVVVSVGKTTYDLVEKAMLALQKVHGRVLGVVLNRAPVTGSESSVYTYDYQSHGATSGRHGKRGRQASADASAEA
GPAPAAAAYSPAVQPAVVTDAPQPAAEPRTLASEQAASPVAPVAEAPVAPITSVPATAEPSASAVAAELYPADAADDDAA
DDEVDEFLREAEVEPKRAHRRTTRS
>gnl|bykdb|A0A371PBX8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. M2KJ-4] (length=479 residues).
MDLRQFLGILRTRWVFSVSTIVAGTVATILLVLSMSPVYGSSAKLFITSPIGQQSADPTAAYFASQRLASYADLAREPSL
LQDVIDRLNLTDVSRDELAGQVKAQIIATTQTLQVDVTADTPELAQRIAEAEAEGIVSLVARLEKPTSGNGAPAFVARIV
GPPTVSQTPVAPNVPLNLAVGLLLSLFVGIAGAVLRDLLDRTVKTRQEAEDLSGGAVLATLPFDRQLKKQALTSEGHGAL
AEAFRVLRTNLQFANLDAKVESILVSSAVPNEGKTLVATNLAMSMAQSGRSVLLVDADMRNPNVAELLGLENSVGLMTVL
IGRTTLEEATQTHTSGISFLGTGPRPPNPAEVLDTQAMRDLLFGLRSEYDVVIIDAPPMLPVADASILMREVDGALMLVR
YGETTREQLRLAVARIETVGGRLFGTILNRTPRRAGDAYGYGYGYGYGYGDTGGDPSKLSIGRLVRGEGRPASGRRANR
>gnl|bykdb|A0A372FUT0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Verrucosispora sp. LHW63014] (length=486 residues).
MDLYRQLRLVRQRWWIVLVTLVVALGLTALITVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQAAVADRQLGLTAEEIQRRVSTSTETGTVLLRASVTDTDQTRALRVTEALSAKFVELVQKVEARPDGSAGPIKIEVVSG
PRVTPTPVSPQPLRNTAIGTLIGLLAGVALAILRGMADVRLRDAAGLQRVTGSPLLGEIPIDASARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGIDSGVGLTDVL
VGDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLTALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKAEAYQYEAYRVVAETPATTKAGRAGAGRHAERKPVADRPDHTQE
LTRLPR
>gnl|bykdb|A0A372J6J7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Geodermatophilus sp. LHW52908] (length=961 residues).
MAGLSAATADQLVRLGGAAALGVLAVVLLRRSPQLGVGGWLAVVCLVPVWAGVGLGAYFEPQVLAGLAAVGALVLVRRCV
PLSPVGADLLIAAFALSALLPALVGRGTANGVFVLLAHWASAYLLGRLAGHRLPLGRVYALVAVAFTAVAVLALVEWVAG
WNPFHLVPGSGGLREVWATIQERGGVARAEGAFGHSIALGGSLALALPLTLAAPLRPAVRLGMAVLMGAACAVTFSRIGL
GTAVLGVLLSIAFLRTGLPGRLRLLICGGLLVGAAAAAPLVTQVFAAAGDEASGSAGYRADLLSLLGEARLLGLSPSYWR
SPTGEASFGTFRSIDSALVLTTLTYGWIPLAFLGAAVLSAVVVVVRGQATAPTVALVAQLPAFATVALITQYASLVWFVA
GLAVAAQALAPRGERAADPPGPGDATARDPHRPHSLWGTQPNPRRSMATVVAVGDRSGHRPGGDGIVGVAGYLQVLRRRM
WGVVVCVALAGGAALSASLLATPTYTSTAGLFFSLQNGNTASDLAQGATFTRAQMASYATLTTTPAVLDPVIDRLDLETT
AGGLAGRVSATAPNDTVLLQVSASATSPTEAARIADAVAGRLAEVVEEVAPADTEGRATVLVTPVAPAQVPTGPSSPDTT
LNLLVGLVAGAALGVLYAMLRESLDTRVRDAVRVRALTDAPVLGLIAARTQRAGEELVLATDPRSAQAELFRQLRTNLDF
LRLDGEPLSLAVTSSLPGEGKSTVALDLALALAEVHERVLLVDADMRRPAVAHRLDLEGSAGLSTVLVGRAAVDDVVQEW
GPHGLHVLTAGAVPPNPAQLLDSPRMTALMAELATRYDAVVVDSPPVLPVTDALLLSRCTGGTLVVVDTHRVRRNQLAEA
LRQLGNVDTRPLGVVLNRLVREKQVYGYGAYGSDQGDDVDAGRWWRKGARPAAVGRQHAVETHDAVPAGQRAPAAAGRPR
P
>gnl|bykdb|A0A373DJ45 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leucobacter sp. wl10] (length=535 residues).
MVLLFRPMIEEISSVELTDYWKILRAHWLGIISITLVGALLGLGWALLQPKVYTANASGIVSAGVSSDLGTAMAGENYAK
SRVKSYLDLAKSRSVSEAAIKSLGIDADPDALISQIEVTNPLDTATLKVSASAGNPEAARALAEAWVTAVGEKVTELENA
NAAPAVDGSLPQSIVTFQSMDAAQLPDAPSSPNTRLAIAIGALAGLALALGYALLRNIFDRRIHSIAEVERETELAVVGT
IPVHSGFDAENRMITSTGGNDRDKRSHEEYAVAEAMRELRTNLQFMNIDNPPRSIVITSALPGEGKSTITANLANTIAAS
GRNVVVIDGDLRRPMVAKTFGLLPGVGLTDVLIGNAQLAEVLQPWGTTGKLWVLGAGKIPPNPSELLGSNAMHDVIEELA
RHAMVLIDAPPLLPVTDAAILTARTDGALVVSRAHKTTYEALKAALNNLQRIKGHALGVILNGVPRKGVKADGYGYRYRT
YYGRQQEPQPQPKPQGDGFKDFAELLTQGSAASGGAAGDVATEPGPRRGRRESQP
>gnl|bykdb|A0A373DL26 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leucobacter sp. wl10] (length=476 residues).
MTENTSAWTLGAVWAALKKRWYLIAAATVIGGAGGLAMSLLATPVFQSTATLFVSINQGSSGTDLNQGTTYAQNQMQSFA
QLATSSRVLDPVIEKLGLEMTPGELSRNVQVVTPGNTVILSIQASSTSPERTAAIANAVAESLAEVVKEVSPAGAQGAPS
ITASLVDTATVPRYQVSPNKPRDTLLAAAIGLLVGIAAALVCSLLDTRIPNAMALRAAVPLPVLGTISRVRSGNQGVGLA
VAQDPLGHASEEFRRVRSALTYAGVSDRLQRILVTSTSEGEGKSTFSANFALTLAELRSRVLLIDADFRKPRISDVFGVE
GAVGLTSVLLGDATFERARIRRRGTTLDILTAGTIPPNPSEMLTSDAMRQLIDAVAPQYDYVIIDSPPILSVADASLTSP
LVDGAVLVVDAGRTRRSQLSQAVASFETAGGRIIGVVLNKVRRRGSTDGYYTETGRRTPRPSTRRPVLDASIAGRA
>gnl|bykdb|A0A374SXN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSEFLATYRSSAAASGASSNASELSSG
ANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAESVTASNPDGTMLVDISVNDPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTAVIDAPVLGS
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDT
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGHELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDESDDNGKKRQ
IQHKKSEKTKKD
>gnl|bykdb|A0A375YHM1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium parafortuitum] (length=474 residues).
MLVAVLGAVSVTLLTTPLYQATTRLFVSTTSGSSLAETYQGNRFSQERVASYAELIMGQTLAQRTIDKLGLGINAIELQE
RVTATTKPDTVLIDVAVLDESPIQARDIANSLSDEFVALVRELETPEDGSSPDSRVVVEQRASIPENPVIPKPLRNIGIG
LVLGILLGVGLAVTRDLLDNTVKTRDQLETITSTGLVGSIPLDKERRKQASISFDSETSGIAEAFRKLRTNLQFLAVDNP
PRVILVTSSMPSEGKSTTAINIALALAETDKSVVLIDGDLRRPSLHRYMDLVGTVGFSTVLSGAVSLEDALQKTRFPGLT
VLTSGAIPPNPSELLGSQSARKLLSELRAKFDYVIVDSTPLLAITDAAILAAGADGVLIMARYGHTKREHLSHAVGSLHS
VGAPLLGAVFTMTPMRGGGSYSYNYGYYGGYTANSGPQPSGDTEASVAKGDGASATAAGLPASGPGGRRRRKAE
>gnl|bykdb|A0A378GSQ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria rosea] (length=567 residues).
MEHLDAEREAPALDARDLLRLVRTHWRAITLITLLCTLLALGWTLIQPKIYSATASGLVVATGEQDLASALAGNNLAQSK
AVSYESLATSRPVAESVIDELDLDATPEELLPRIATDVPVDTPELRITADAEDPTEAADLANAWVVALAGQVQELESQGD
EDAINRVAVQPLSNASLPLAPSSPNLKLNLALGFVGGLGLGLLYAFARYKMDRRIKSVEEIRDGFGVSVLGVIPTDDRLS
DHRAIVETGISAGRGHHEFAEALRELRTNLSFVSVDNPPKMIVVTSSLPGEGKSSITANLAVAIASTGRNVVVVDGDLRR
PVMTDLFGLVAGVGVTDVLTGQVQVEEVLQTYDTFPNLQVLGAGKTAPNPTELLSSKAMHNMLETLAEDALVLVDAPPLL
PVTDAALLTASADGALIVATAQKTTTDELSKALENLHQVRGNVLGVVLNRVPTTGADAGYYGYYGKSYYANSDEKAAPKT
GAQPVVPAPVGKHQPWGTELRPQPAEAQPPATPRAQQDPTVPSAEDAAPAPTRADQPDVPGSAEHETFGLEAWGRSGSST
GSTSTGH
>gnl|bykdb|A0A378SHC9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium gilvum] (length=498 residues).
MNLQDFVKLLRSRWLTVAVTTVAAVLLAVVISLLTTPLYQASTRLFVSTTAGSSLSDAYQGNRFSQERVVSYTELLMGQT
LAQRTIDKLGLNTSAEELRQKVVANAKPDTVLINVNVLDKSPVTARDIANTLSDEFVNMVRELETPEDGARPDARVVVEQ
RASIPSSPVVPKTARNVAIGLALGLALGIGLAVLRDILDNTVKDRDTLEQITGAGIVGTIPLDKDRRKQPAISFETDNSG
IAEAFRKLRTNLQFLAVDSPPRVIIVTSSMPSEGKSTTSINIALALAEADHNVVLVDGDMRRPTLHKYLDLIGPVGFSTV
LSGAADLDDALQRTRFPGLTVLTSGATPPNPSELLGSQSARKLINELRTRFDYVVIDSTPLLAVTDAAVLGAASDGVLVI
ARFGQTKREQLSHAVEHLASVGAPMLGSVFTMMPTRGSAAYSYDYSYYGTEADERSNHRPASSGPLALGVAETASGVGAP
AQEVGQAVGRRRRRESSD
>gnl|bykdb|A0A378VDM5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium aichiense] (length=477 residues).
MNLQDFTKLLRTRWITIVVTMLVSVLAAVAYSLLTTPLYQASTRLYVSTSAGSSAADLYQGNRLSQERVLSYTQLITGET
LAQRTIDKLGVNMTAPALQERVKASAKLDTVLIDVSVLDESPVRARDIANALSDEFVVMVRELETPKPGAAPDARVIVEQ
RASVPTKPVIPKTARNLAIGLGLGLLTGIGLAVLRDMLDNTVKSRETLEEITGVGIVGAIPLDKVRRNQPVIPFDTETSA
IAEAFRKLRTNLQFLSVDNPPRVIIVTSSVPNEGKSTTAINLALALAEAEHNVVLVDGDMRRPSLDRYLHLVGQVGFSTV
LSGGASLSEVLQQTQYPRLTVLTSGAIPPNPSELLGSMAAKTVLTELRQKFDYVIVDSAPLLAVTDGALLAANADGALIM
TRFGQTKRDQVVHAARNLADVGASLLGAVLTMMPTRGGGSYSYSYSYSYYGESAKPESKEAKSAASDTSPESSDTAP
>gnl|bykdb|A0A385ARQ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. B006] (length=483 residues).
MDVLGYLRLVRRHWWIVLVTVMLALGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRNRIRTASTTGTVLLKATITDTDQTRALKTTETLATKFTELVRKVETPPDGKAPPIKIEVVSG
PRVTSNPVSPQPTRNLVMGGLLGLLLGAALAVLRGLADVRMRDGAALQRVTGSPLLGEIPYETGAKAAPLIVGAAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAANALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVLPPAAPSVPADRAGSRRGAKAVKGDRTQELTR
LSR
>gnl|bykdb|A0A386WGZ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora tulbaghiae] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLGLGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIHTTATTGTVLLKATITDTDQTRALKTTEMLATKFTELVRKVETPPDGKAPPIKIEVVSG
PRVTSNPVSPQPTRNLVLGGLLGLLAGVGLAVLRGVADVRMRDGAGLQRVTGSPLLGEIPYETGARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNAAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVVPPAAPSVPADRAGSRRGAKAVGDRTQELTRL
SR
>gnl|bykdb|A0A395XCD7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum] (length=490 residues).
MADEYSEKQSTATASTAKQSGVTFSDLFGILRKHWITIVVTFVAVVGGVTLWTAMSPVTYSSTAQLFATYNDESDTTNSA
EQNSGSSYIMSQIKSYPALTTTQSVLQPVIEDLGLHISVAQLKGQISVTNPANTAFVNISATNSNPEQAANIANAVAKSL
SSVVENTLYSSGTHSSIKLSIVQPAISSSTPSAPNWKLNILIGIVGGLILGVFVALLKDVLAKQIQDDDEISEYIDAPII
GRIPEEDLLKGTKPAVVNEPGSPVAEDFRRVRTNLSFMAPVEDTNCRLIVVTSTGASEGKTTTSVNIAAALAENGAKVLL
IDADLRHPSVANKLDLDGAAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASALLNSPIMVELLNNAIERYDYVL
VDTAPMVVANDAVIFVRRGGALIMVCRRAQTLKRDLREISEELTTLDLSANGVIFNCARDSKKSLEHSNYYYYYSDHNKD
HRKKRRFSFK
>gnl|bykdb|A0A395XYP7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A396G475 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTSQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVHELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVISSTDPSEGKTTVSANVAVALAEEGKSVLFIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASEATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGKKKARK
>gnl|bykdb|A0A397LPH3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Promicromonospora thailandica] (length=653 residues).
MTEYLRIIRKHWVPVTALALAGIVLAGMFAFTRTPAYTTSSQVFVSFHGAESTSELATGTTYVQRRVVSYSNLVRSAQVL
EPVVEELGLDTTPGELATRVQAAPVTDTVLIDITATDADPTLAARIANTVAESLAVRVDELETPQRSGDSPVQLQLVREA
TPPGSASYPNIPVMILVGFLLGSATGIALAVLREIVDTRVRSEQDLRAVTDSAVIGTITLDDEAKENPLVVQTSPYHTRS
EAFRRLRTNLQFLDLDGGPQAMVVTSSVPDEGKTTSAINLAITLADADAKVLLIDADLRRPSVAGYLGIEGSVGLTTLLI
QRATIDDVVQPWGSAGLYVVPAGAVPPNPAELVGSRAMSRLIQQVSEQFDYVIIDTPPLLPVTDAALIAKMTSGVLMVAG
AGQVRREQLRQSLANLSAVSARVLGIVLNKVGRDADAYGAGYGYYDYRPHQEDDGDHGHGGDGDGRGGGRGGGRGGRGGG
GRGGNGGGRDGHGGGRDGGGRGGRKGWRRGKGTRRVPAEKVGSASSDAADATRATPRQPDAQPVGAPKAGAPKAGPSKVI
RPKPGPNGTKPTPITRISAPTPARSSNAPAVPPTGPSALAGRGSAAHPMLPARPTPVWAPVRGGATPGLAPTTQLQAIGV
TARTSTPPGRARR
>gnl|bykdb|A0A399N224 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. insidiosus] (length=472 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFIQQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A399NHL8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=518 residues).
MRDGGGTMDPHDYWTALRRRWITILLLGIVGGGAAYAYAATLSPSYRSTSSVFVSSTQGATTSELVQGSTFSQDLVQSYA
QLATTPAVLEPVITRLGLDATPTALARSITVDTPLNTVIIDISVTDTVPEQAARLADAVSDSLAGVVGDLAPESASGAPS
VELTTVAEAQVPRAPISPNTRLIALTGIIAGLAAGVVYALARQVLDTRLRTERDVERVTDAPVVGSVERRDRADGITMLA
TPHSAAAEGYRRIRTNLEFADVDAPIRSLAVTSAVPGEGKTTTAVNLALALSEHAESVLLVDADLRRPTIAEQTGLEGAV
GLTTVLVGGARAEDAVQQWAPGVDVLTSGGIPPNPNQLLGSAAMATLMADLTSRYEFVVLDTPPILPAADALTLAHLTDG
ALLVSRVKSTKRAQLAEAVDALDAVKARTLGVVLTRVAPSKHTSYYGPDAQATTHVAAPAGAAPAADTSAAAPADSAPET
AAEESPATVTSAPSAVAVPVAPATRRHSGPPRKGSGER
>gnl|bykdb|A0A399NK31 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A399NXI4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=462 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDATPQELARAVTVTTPQNTVIMEISVTEPSPSDAADIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPENQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTTAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASSRMEDLVGLAKASYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQTGRAGRAAGKAPVAG
>gnl|bykdb|A0A399NY19 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSSNVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDQYGLDVTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGESLKTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A0A399QBR8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. nebraskensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFIQQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A399QFM2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. nebraskensis] (length=468 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDVTPQELARAVTVTTPQNTVVMEISVTEPSPSEAAEIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPEFQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTTAPLLGALERERGVTGVAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASNRMEDLVARAKADYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQVGRAPRGAGKAHAAGKARAAG
>gnl|bykdb|A0A399SS87 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. insidiosus] (length=463 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDRTPQELARAVSVTTPQNTVIMEISVTEESPADAAEIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPLSQSAPNGRTNTLAGLLLGLLAGLLGIALVRLLDTRVRSAETVAHLTPAPLLGALERERGVTGLAMALRPLSTAA
EGFRQLKANLRFVLLGDRASSIVVTSSIPGEGKSTVAANLALSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEEVVQPWGDGTLDVLTSGEIPPNPSELLASTRMEELVARAREAYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRGQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRMETEQAGRAGQAARPARRATP
>gnl|bykdb|A0A399TA45 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter sp. CFBP 8615] (length=473 residues).
MDPHDYWTALRRRWITILLLGLVGGAAAYGYAATLSPSYRSSSSVFVSSTQGDTTTELVQGSTFSQDLVQSYAQLATTPA
VLEPVITRLGLETTPTALARSITVDTPLNTVIIDVAVTDAVPEQAARISDAISDSLADVAGDLAPANASGDPSVELTTVA
EAQVPRNPIGPNTRLIALTGILAGLALGVLYALARQVLDTRIRTDRDVARATDAPVVGQVERRDQADGITMLAAPHSAAA
EGYRRIRTNLEFADVDTPIRSLAVTSAVPGEGKTTTAVNLALALSEHAESVLLVDADLRRPTVADQTGLEGAVGLTTILV
GGARAEDAVQPWAPGVDVLTSGTVPPNPNQLLGSAAMATLMADLTARYEFVVLDTPPILPAADALTLAHLTDGAVVVTRA
RSTRRAQLAEAVDALDAVKARTLGVVLTRVAPSKRTSYYGPDAAAASAADAAPGGGAVATDERAAEETRPAAN
>gnl|bykdb|A0A399TDC3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter sp. CFBP 8615] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVSDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVTASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGNLVPETIEGTPQVQITQLE
EAEIPESPSSPNLPVNIIVGAIIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A0A399TPV7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. phaseoli] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A399VFU7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nakamurella silvestris] (length=676 residues).
MELSEFLLILRVRWKALLLSILLCAMAAAGWTLSQTPVYSADATGFIKTGGDLNPNSGDVYAKSRAKSYVGLALSRATAE
TVINDLGLNISPSALVDEITVQAPTGTVLIQVTAKSSSASLARDLANAWIRALAIQVEQVETDKKNPEVNPVAAASLEPI
ESAVTPKTPISPNPQRNIAIGLLLGLGLGLGYAMLRHHLDKRMRTADSVEGQFKRPVVGTIPLDDSLTDRDRITISLSGR
APAGGHDPAIAEAFRGLRTNLRFMNVDKPPRKIVVTSPVSGDGKSTVTANLGVAIAASGEKVVIVDGDLRHPVMAGVFQM
SEDAGLTDILIGRATLAEMMQPWGRNGDLHVLGAGSVPPNPNELLSSELMHSILDELAKDYIVLIDAPPLLPVSDAAALA
ARADGVLVVITSGRTTKDNLSRALSMLDKVDGTTLGIIMNRIPRKGPMAHQYGYYGSSYYPGSPADPVPLGRMATLLAKV
GIGRDRPTTEVTDEDSSTPETVDTLPTVDDGADMPDARPSAADTARSTPVRTGKFRFKKAGGGTADPVVIPAPAADQAVA
TDTASDAPGSSEIDATTSAPERDTWTIAAPKSTGTPAKGTSAAPRSPVPGPAKTVQVPPTTDPAVTDDESVTSKNNGDPA
GSPVARGTAKPSTTPQTSPGGASTNGHPTPPRKKKV
>gnl|bykdb|A0A3A1TUK9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Amnibacterium sp. DD4a] (length=496 residues).
MFHPVHLRCDTAASVVTQRRERPPTARRTRAKKGSPVNLRDHLHVLRRGLPLVIALPVLTTVAAGVVSAAQAPVYQATTS
LTVSAATATSGTDLNQGGTYVQQIVKTLSDVVTKPIVLDRVRQSLDLPQSESQLAASIVATAPLNTTIIEITAADSSPQR
AAAIAQEASDQLVDLSATLVPSDAAGKATVKVIPIQRAVVPSSPVSPTVSRNLALALVAGLALGLGLAYLWSAIDTRIRS
ARDVGAITGTPVVGEILADPRAAAHPLVVQTSPGSIQAEAFRGLRTNLQFIDFESGTQSFVVTSSHPGEGKTTTTANLAL
AAADAGLEVVLVDGDLRKPRVHALFGIEGGLGLVDAVIGRAPLDDVLQPWSDRLHVLPAGMIPPNPAELLQSRAMSALLD
ELRERYDLVVIDSPPLLPVSDAAVLARRTGGAIVVAAARRTRRQHLERALQALDQAGAGVLGVVVTMLPTKGPDSASRSV
YGYGETPGSSAVLGKA
>gnl|bykdb|A0A3A1U0E9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Amnibacterium sp. DD4a] (length=494 residues).
MPSAALRTRAGARRPNARRARRNPLDLHQFLRTVRRSWPVIVMVLAVFIIVGAAYTIVQRPSYSASATAYVSVSTNSSVN
DLSQGADFVQQAVKSYAGVATSAYVLERVIDRLDLDESVGTLKEQVSAQAPVDTTLLDISATASSPTQAAAIANAVTTEL
SSAVDRLTLDARSSSSAVVLTRIDPATAPSTPSSPNVPLNLGIAAILGLAVGLGIAVLRDRLDTRIRDREEAGALVAAPV
LGEILEDPRAASRPLVAVGGDDSPGAEAYRTLRTNLEFLDFDKRPRSIVVTSSIPREGKTLSVVNLAAVTAEAGHSVVVV
DADLRRPQVGRYFGLEDRVGLTDVLLGTVRLDDAIQQWGGPQGPLVLPAGRIPPNPSELLQSEAMRELIEQLEARYDVVL
IDTPPLVPVSDAAILTRRTGGALLLAASRRTRKADLRRAAANLAQVDGRLLGVVLTMVAGRDSAAYSYERAQLPAASEQP
DDAERPRVRERARS
>gnl|bykdb|A0A3A4WFE0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium] (length=527 residues).
MELRDYLKVFLARKWLVLAATLVTTTAALVASLLQPRVYEARSSLLVKERNRGSNILGSMLPALSLEPERSVRTHIELIK
SPALIRRAAGSVKARPGEISSALSVEVLPQTNLLHVSISHRNPTRAAKIADAVASTYAISNRNVNASEIEEARRKVHFKL
RDTEEDILALQQVISGKGKRVTPELKRNAQGKLRMSLGVYQMLATKEQELRISESTEPGEVVLIQRAVVPTAPSTPKPLR
NTVLGLVLGLSLGVGGAFLLEGMDTRIRSADEAGDVFGLPVLARIPLARCEKPSDAFFVTPTSASAEAEAFRALRTSLSY
VNYNGEIRTILVTSGSPREGKSTISANLAGALVQAGYKVILLDCDLRNPGLHTLLELPPGPGPASVIAGQTAFESAITRH
KPSGVDVVCGSLSAPPNPSELLNSRTMDELLAKSLEKAHFVILDSPPVLAVTDPVVLAAKVHGVLLSSSVGETTREEAQR
VVERLSSERVRLLGVVANKVPAEQAAAYYPYYQRERKLRPKPAAQEH
>gnl|bykdb|A0A3A5H3U9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. K1W22B-1] (length=476 residues).
MDLRDYLRILRRHWLLIALCFAAALVVSGLVTSRMIPQYSSSSRIFISTNNSSSDQAYQDGLFSTQRVASYADLVTGKDM
AADVIEDLGLDMNPTELAANVTAQAVPETVLLTISVTDPDPDLAQLLTRTYGEQLALLVADLETPPGGDGPVLKATTVDS
AGLPTAAVSPNWTRNLGLAGVLGLLLGFGLAVLRELLDTSVKSAEDITELAESSVMASIAYDPATVKRPLVSDLGSHEPR
AEAFRVLRTNLQFVDVDASSKAYVVTSSVPGEGKSTTALNTAITLAQTGQNILLIDGDLRRPQVANVLGLEPAVGLTTVL
VGKIDLAAAVQKHETGLHVLTSGTVPPNPAELLQSQAMASLLTAARSTYDVIVIDAPPLLPVTDAALLASMTDGALLVVR
HSRTTRDQLRGAHDRLESVGADTLGVVFNMVPKKGGGAYGYGYGYGYGYAPEPEPAGKRRGAKAVKPPKPEKPAKA
>gnl|bykdb|A0A3A5H3V1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. K1W22B-1] (length=466 residues).
MNVDFKELFRTLRRRWKTIVALALIATFGSLALSLTTTPTYESKTKIYVTSDTSTLQDQYAATLYASQRIASYAELANHR
VLLQRVVDDLDLDMTASELAEKVKAEVETSTVILQITVTDTSAKRAQEIANAEADQLVEFLQELETPSTSDVSQILPTIT
DPATFNANPVAPRTVLNTVVALLIGLTLGTAVAVARELLDQTVSSAEDVDKATQVPIMAAIGLDPSVAKDPLLTDLTTFS
PRAEAFRLLRTNLQFLDLDHPPRSIVITSSVSGEGKTTAATNLAVALAQAGRRVLLVDGDLRRPRVAALLGLEGSIGLTT
VLVGRTKIEESVQKHEASGVFVLASGPTPPNPSEILQAKATHDLLGKLRDTYDMVIIDAPPLLPVADAAILATATDGAII
VTRHGKTTRDQLEGAATRLNTVGARTFGVVLNMVPKRFGQMNYYYYYYAEESQPSGGKRSAGRGKG
>gnl|bykdb|A0A3A5HBN2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. K1W22B-1] (length=603 residues).
MPRSRLAPCQPRRPPARSRSRHVRPPASPKSRRPVGTLTYARTTPRARPSRRTVRERGPRRRSRRWGRPGRSDGPEGIRT
TWGPASVPCAQHRDRRLGPPAIRTAMETYVEISDYLRALRNHWAGAMALTILVGAAAFGFSLLQPKVYAANANGFVGTGS
SENGALGSVNDQLAKSRATSYVDIAKSRATAQDVIDDLGLDASPSGLVGRIDVQQPLDTVSLHITARASTPREAQELADA
WVRALALQVREIESPNTDKVPDGTPRVIPVESAELPTSPVSPRTDRNTALGLVLGALLGLGYAVLRSTLDRRLRTASDVE
SRFPVPVVGSIPTSTALRNRDTTDPTRTSYGHEDPSAGEAFRKLRTNLVYMDVDSPPRVLVVTSPKPGDGKSTVAANIAM
TLETSGQKVVLIDADLRRPTVADAFGLDPAVGLTSVLSGQVPISLALREVPDRSNLRVLTAGPLPPNPSELLGSKAMGAL
IRSLAEGPEGGYVIIDAPPLLPVTDAAILSTSADGAFVVVSAGKTLDTELASALGSLESVGARTLGVVINRTAAPGRGYG
YYGYYAAVGDKAGAKGAAKARTNVAAEAGAAEGKRAGARRAGR
>gnl|bykdb|A0A3A5M3T5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp. Hz2] (length=485 residues).
MELNDYVRLIRRSWGLISLATVLGLALAVAISMLLPRSYSAETRLFVAAQNSGSAVELQQGNTFTQARIKSYAETATTPL
VLQPVIDDLGLAQSADELAEHVAATSNANTVLLSVVATDASPVQAAAIAQAVAESLIDTVESLETTSDGSSPVKLAVVTP
ASAPEQAASPNVRLNLVGGTGAGLLLGLGLALLRQSLDTKVRGEADLRRASSAVILGGISFDTDAQKKPLLTQAPAQSPR
AESFRQIRTNLQFAHVSHKSKAVLVTSSLPGEGKSTTATNLAIAIAQGGQSVVLVDADLRRPRVDEYLGLERNAGLTTAL
IGRADVEDLLQPWGIDELYVLTAGQIPPNPSELLGSDAMKQLIIRLEQKFDAVIIDAPPLLPVTDAAVLAQEVGGVVLVV
GSSKVRVPDLQKSLGNLEMVGADLLGVVFNFLPSKGPDAYAYSYYSYDSVAASPTAEKPVMARRSTKNSRSDFDERIFGL
RSQEE
>gnl|bykdb|A0A3A5MNU5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium sp. Hh39] (length=484 residues).
MELRDYIRILRKSWVLIVLLALVGVGASAGYSLYQTPMYSATSKVFVSTQNSGTTSELAQSNSFTVARVKTYVALAETPI
VLLPVVSELNLNITAGQLSGQITASAELDTSIINITVVDADPVQAAEAASAISESLATVVKELETPDIADAVTPVKLTLA
QEATVPSVPISPNVPLNIALGGLVGLALGLGIAVLRETLEVRIRNERDVEQITDLPILGGIVFDPKAAERPLIVHVDPRS
PRAESFRTLRTNLQFLDIERTDRSFVVTSSIEAEGKSTTGANLAIALADAGSRVLLVDADLRRPKLADYMGIEGAVGLTD
VLVGRAELEDVIQPWGRAQLFVLPGGRIPPNPSELLGSARMTHLIAEFNRTFDVVIFDAAPLLPVTDAAILAKNVGGAII
VVAAGRTHKNKLKSAITVLDNVGAPISGLVLTMLPTKGPDAYGYGRYGYGYGYGYGYGYGYGSDLEAEQAAAELEPTRRS
RTKK
>gnl|bykdb|A0A3A5N2D6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cryobacterium sp. Hh39] (length=486 residues).
MELRDYIRILRKSWVLIVVLTLGFVGAASVYSLLQTPTYSATSKVFVSTQSSGTTTELAQGNSFTVQRVKTYSDLVSTPI
VLLPVIANLELGITSSQLGAKITASAPLDTSIIDITVVDTDPTRAADTANEISESLTAVVEAIETPEAEGALSPVKLTPA
QEAVVVATPVSPNVPLNIALGALVGLALGLGVAVLRETLETRIRNERDVTQITEVPILGGIVFDPKAGERPLIVHVDPRS
PRAESFRTLRTNLQFLDVGRTDRAFVVTSSIESEGKSTTGANLAIALADAGARVLIVDADLRRPKLADYMGMEGAVGLTD
VLIGRAELDDVIQPWGRGGLHVLPAGMVPPNPSELLGSARMTALIAQFNATFDVVLFDSPPLLPVTDAAVLAKNVGGAII
IVAAGRTHKNQLKSAISALDNVGAPVSGLVLTMLPTKGPDAYGYGRYGYGYGYGYGYGSDVAPAEGDVATPQVLAEPMTR
RSRVKN
>gnl|bykdb|A0A3A9A6J6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudolongum] (length=496 residues).
MAENIVEQQAAGQVGAGAKQENDGMTLSALFGIMRKHIITIIITFLVVLGAVITLTAMSPVEYTTTSQLFATYNDSSDGT
ANSSEQNSGSSYIMSQIKSYPALTTTQSVLQPVIDDLGLHTTVGQLKGQISVTNPTNTAFVNISVTNGDPAQAADIANAV
AKSLSSVVENTLYASGSHSSVKLSIVQPAISPSSPSAPKWKLNILIGIISGLILGVFAALLKDVLAKQIQDDDEISEYID
APIIGRIPEVDLLNDTKPVVVNEPGSPVAEDFRRIRTNLSFLAPLEDANTNCRLIVVTSTGASEGKTTTSVNIAAALAEN
GAKVLLIDADLRHPSVAAKLDIDGSAGLTHVLSGQASVKDVVQRYWKPNLHVLPAGPKPPNASTLLNSPIMVELLNNAVE
RYDYVLIDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLREISEELTTLDLPASGVIFNCARESKKSLERSNYYYYY
SDSNKKRSKKHRFSLK
>gnl|bykdb|A0A3A9XK63 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. MS1-9] (length=486 residues).
MDLLRQLRHVRRHWWVALVTVMVALGASAFLTVRAQPRYEASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQTVVAENPVGRTAEEVQRSVSTSTEAGTVLLRAAVTDTDQARALKVTETLAAKFVELVQTVETPPEGKAPIKIEIVSGP
RVSSSPVSPQPVRNLTLGGLIGLVLGVGLAILRGVADVRLRDAAGLQRTTGSPLLGEIPFETGARSAPLIVGEAANSSRA
EAIRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGIDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVSQ
QGRTSRTQVAAASRALHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVATTELAEAPAERPKTARHSDSGEPNAVSDHTQE
LTRLPR
>gnl|bykdb|A0A3A9YX36 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora endolithica] (length=487 residues).
MDLFRQLRLVRRHWWIVLLTVMVALGVTTLVTVRAQPRYVASVTFFVTTPSQGVSDAYQGGMFLQQRVKSYAQLLTSDRL
AQSVVAENPVGLTAEQVQRSVATTTETGTVLLRATVTDTDQNRALRVTETLSAKFVELVGKVETKPDGNAGPIRIEVVSG
PRVSSAPVSPQPVRNFALGGLLGVLAGIGLAILRGLADVRMRDAAGLQRTTGSPLLGEIPFESGAKASPLIIGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGLDAGVGLTDVL
VGDVGVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAARSLHSVSVRLLGCVLNMAKVPKGDAYQYEAYRVVVPAEPVPAHAGRGAAPRHAENRDNGHVGDRTQ
ELTRLSG
>gnl|bykdb|A0A3A9ZIB5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora costi] (length=483 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLTSDRL
AQSVVAENPVGLTADEVQRRVSTSTEAGTVLLRASVTDTDQTRALKVTETLAAKFVELVQKVETPPEGKAPIKIEVVSGP
RVSSSPVSPQPVRNLTLGGLIGLVLGVGLAILRGVADVRLRDSAGLQRATGSPLLGEIPYEGSAKSAPLIVGDAATSSRA
EAIRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGIDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALMVSQ
QGRTSRTQVAAAARSLHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVAAETPAVPEERTAPPRHADGVNGVSDRTQELTR
LPR
>gnl|bykdb|A0A3B0B4T8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. CGR2] (length=485 residues).
MELRDYVRILHRNWILILILLILGLAGGAGYAAMQEPKYVASTQMYVSVRTEGAATGDLVQGTTFARQMVASYVDVVSTA
LVLEPVIEELDLDTSVAGLSSRVSATSPLDTVLIDVTVTDADPEQAAAIANAVAASFQDAVQNTLEQPAAEGAVSPVQIN
VTEPAVAPSVATSPNTRMLTILGGILGLALGLGIAVLRTVLDNRIHTLHDIEALTDRPVLGGIAFDPEATKRPLIVHADP
RSPRAESFRSLRTNLQFLNVDSGPRIFVVSSAGPGEGKSTTTANLAIALAETGARVLLVDGDLRLPRVADYMGIEGGVGL
TDVLIGRVDVADALQKWGANDLYVLPSGQVPPNPSEMLGSAAMDQVLKPLGEYFDYVLIDAPPLLLVTDAAVIGAKTRGV
IVAAASGKTKKQELAGALRTLETAGVNLLGVVVTMLPTKGPDSYGYGAYTYGSTHDIGDAESSTKKKKKAKKKSSAPKRR
KVTVS
>gnl|bykdb|A0A3B0B6M9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. CGR2] (length=477 residues).
MELRDYARILRAHWVVVVVATVVGALAAFGWSSLQPRVYSADTTGIVTSVGGDGTSGSALVGNQLAQSRVKSYLNLGSWS
AVAEHAIDELDIDASPDALVNRITVTNPIDTTALMVTATGPTPEEAQALAQAWLDGMAIEIEKLEGGTAETPAAISLVVG
DSARLPTAPTSPNTRLNVVLGALIGIAAGLVYAFVRHTVDRRVRHPRDIERETGASVIGTLPLEKSMAGERQVIDFSLDS
QHGVSHHTIEAMRELRTNLQFIDVDNPPRIIVVTSSVPGDGKSTVSVNLASSLAAAGQWAILIDCDLRRPVVADIFGMSH
DVGLTDVLAGRAELQDVAHRPSKDVPLAVVGAGRIPPNPSELLGSRRMRDFLGEISKSAIVILDSPPVLPVTDAAVLAAG
ADGVLIVVSSGKTTFDMLQRAISAITRTKGRVLGVVLNRVPRKGAESAYYGREYYGTFERYAQDGASDRRNPSASNR
>gnl|bykdb|A0A3B7D7I9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium sp. A1-2] (length=485 residues).
MELRQLLRTLRRRWKFAVASFLLGIIGAAVLTSAITPTYQSQARIYVTATSTGTLDAYNLSIYSAQRVASYADLAKDPAV
LQRVIKQVGLDITPDELGPRVSATAVPNTVILQITVTDEDPQVARDLARAEGNEIVKLVATLEAPGKTADGEEQASPIIA
RLAGDASYDANPVSPNLTINLAVGAILGLLIGVAGAVLRDMFDTSIKTPQDLSEVTDSAVMAIVPFDSSVPKHPLISDDE
GSRERVEAFRVLRTNLQFVELDSKRQMLMISSAVPDEGKTVTATNLAITLAQTGRRVLILDADFRKPRVARLLGLENSVG
VLTVLVGRAPVEECIQQHESGVDFLATGPTPPNPAEVLETQAMRDLLMKVRDAYDVVIIDAPPLLPVADPAIIAPMADGV
LLVTRYAKTDKDLVQEAVDRLDAVDGRIVGVVLNMTPRRAVSGYGYGYGYGYGEEIEAGRSMRAATKPRRASRGERKQSQ
HERTR
>gnl|bykdb|A0A3C0AT24 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp] (length=501 residues).
MAAAESNAPQTSQVVVEPTDTEDNGITLMDLFRIIRKHLLIGIITFVVVFIATCAYTFLTPPKYSATSQVFATYSEASVD
NNISNINSASTYITNQIQSYPTLATTESVLEPVIDELGLDTTVAGLAGQLNVTNPTDTAFVNITAQSGDPKQAADIANSV
AKSLSNVVEKSLYASGKESLVKLSVVQRATEPAAPSSPKVTLYLAIGLVGGLVLGIFATLIRDLMTTRVEEASDLQDIIN
APIMGRIPADDSLKDNRPIVVSAPSSRIAEEFRRIRTNLSFTSKIEGSDARMIVITSCDPFDGKTTVSVNLAAALAENGA
KVLLIDADLRHPSVADRLGLEGGAGLAHVLSGQAMVKDVVQRYWKPNLHIMPAGPKPPNASMLLNSKTMTELLDMALHTY
DYVIVDTSPMVVANDAAVFGAKSDGVVMVSGRDVTMKRDLKDIAIQLENLNVPVTGFVFNLEKERKTPQNDNYYYYYDDK
AKGRKAHKHRPKSKTKGRRTA
>gnl|bykdb|A0A3D0PUZ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp] (length=501 residues).
MAAAESNAPQTSQVVVEPTDTEDNGITLMDLFRIIRKHLLIGIITFVVVFIATCAYTFLTPPKYSATSQVFATYSEASVD
NNISNINSASTYITNQIQSYPTLATTESVLEPVIDELGLDTTVAGLAGQLNVTNPTDTAFVNITAQSGDPKQAADIANSV
AKSLSNVVEKSLYASGKESPVKLSVVQRATEPAAPSSPKVTLYLAIGLVGGLVLGIFATLIRDLMTTRVEEASDLQDIIN
APIMGRIPADDSLKDNRPIIVSAPSSRIAEEFRRIRTNLSFTSKIEGSDARMIVITSCDPFDGKTTVSVNLAAALAENGA
KVLLIDADLRHPSVADRLGLEGGAGLAHVLSGQAMVKDVVQRYWKPNLHIMPAGPKPPNASMLLNSKTMTELLDMALHTY
DYVIVDTSPMVVANDAAVFGAKSDGVVMVSGRDVTMKRDLKDIAIQLENLNVPVTGFVFNLEKERKTPQNDNYYYYYDDK
AKGRKAHKHRPKSKAKGRRTA
>gnl|bykdb|A0A3D1TNE2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp] (length=494 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLATAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRGIVRA
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIEFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQGYWKPNLHILPGGKRPANAGVLLGSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYYYYEDG
APRSSHRAKGKKRH
>gnl|bykdb|A0A3D1YWU2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium] (length=494 residues).
MSITASRTDRQKGPRRCVACMKHPYHGVYVEEQIEIVQFLKIIAKRKGIVIIGTVLCVLLAMIATMYMTPQYNATAKILV
AQAQAPVNNQSSSESYQAVLLGQQLAKTFSEIMVSRTLAERVIARLELPLLPDDLMKKVKAQPIRDTQLIVLKVTDTNPK
RAKDIVNAYVEEFIDFIPSTVPTTSQMKVSAIELAVVPLKPVTPKPLLNTVLALVLGLSMSVGFAFVLEKLDVTVKESDM
LEQLLGITSLGLVSKSQQPLLLGDNNTDTSESMRRIRTNLQYLNFDQSIRSFAVASPETGDGKTTVASNLAIVFAQAGQN
VLLVDCDLRRPSISQVFHLPDARGLSNVLIGAADADSVILSSGVDGLSVITSGPIPPNPADLLNSERMDELLARFEGRFD
IVILDCPPVLALSDTVILASKADAVLMVSSFGKSKKADMLAARNALTKVGARILGFVINGARTSKQNGYYNQPYTSRQAL
RDAPLNQPRDIRGV
>gnl|bykdb|A0A3D1Z248 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Actinobacteria bacterium] (length=514 residues).
MGINSANSLNGRRGEYGVDKLKESSDVDLAQYARTIAKRKKLIFVITLICLAIARIVTFQMTPVYEATAELLVYQSEPAA
ADRPLAESYQAVLISERLTNTYSQMLKERTVAEKVVNKLDLDTNPIDLAKRIDARPIQDTQLIQVSVVDSDPRRASRIAN
TLSEVLGQTVKEISASPVVFTAEIKLVEPAVSPVEAVAPKPALYAIVAMLFGLTSSIGLAFLLDRFDTTIKSRKSAEALS
GLPSLGSIPSTSGISFVTASSPQSRVSDAYRHLRTTIQRIAFESTPLIAVTSSGPRDGKTSLAINLGAVLAQAGHRVLVV
DCDLRKPSIHGILELGNDVGVASVIAGDIDIAQAIQLSPVERLSILTAGPRQVNPADLFSSERMDIFLRGVQGIFDYVIL
DCPPILAVPDAVILATKTDGALISAAFGKTNKDELVQSRIELERVGARILGFVLSGEAQQGHAYDIYYRSEPGERGTRKT
GLKRILATTLLIISIGSLVVLAVILSLSIASAGW
>gnl|bykdb|A0A3D3LZQ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rothia sp] (length=472 residues).
MTILDFLRMVRANLKLLLIGLLVGALLGFGYSLLQPRVYASSSTGFVTVGEGSGINDVISGSVAAKEKATAYLSLIKSSA
VADEIIAANPEINLTRGEIQESLTASVDSNSALISVSATASSPEAAQALANSSLEAVAKVVNDLEGSSSVRVIPLEDAAL
NPSPTSPDTSKLVLIGAGLGLALVLAAVMLRRTVDTKLRTRDDATKATDAGVLGVLPVSDELSEENILSANKDHISQEAI
RQMRTNLRFVNVDNPPRSFIITSAEPGEGKSTVSSSLARALADADQPTVIIDADLRRPTIAKKFKVDSKVGLTQVLAGQV
ELADAVQQFDDTQLFILPAGRIPPNPSELLGSDKMRQLIHELSQEFTVVIDVPPVLPVTDASLLSNSVDGVVLVGTVGKT
RKENLAEAAKNLRAVNAKILGLVINQAPRTGLGNSYYGFAYSSNGAYASYYGKEEQSKKGSKRSAKKAKSKA
>gnl|bykdb|A0A3D4PTL2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp] (length=497 residues).
MHSPFSGRARNTRRGKGLFSLRILGPADHTEDRDSRRPRMQMTMQDYVRVLRRNLVLILSLLIIGLSAGIVVALNTETKY
TTSTELFVSAQAGDGATTAELNLARGYAQQAVTSYVTLFSSAIVLQPVIDDLGLDTTVGALGSKVTATASTASTAITVTV
TDHNPGQAARIANAIGESFTTVVAEELERPVDSGVSIVRIDTLEAAQVPVSPAAPNVRLIVILGALLGLAAGIGIAALRA
VLDNRIRSIEDVENAIKVPILGGIALDPEARTQPLIIAASARNHRAEAFRSLRTNVKFLAIGGEPSAFVITSSGPGEGKS
TTAANLAIAFADSGARVVLIDADLRLPRIADYFAIEGGVGLTEVLVGRVAASEALQRWGRGTLFVLPSGTVPPNPAELLG
SAAMSDLISDLKTTFDIILIDSPPVGLVTDAAVLARRTEGAILVAAAGKTHASRLADAVTSIESIHAKVVGAVVTMLPTK
GVDRTSYGVYGGYEATR
>gnl|bykdb|A0A3D8UCA0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A3D8UF99 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSNGSPIK
LTVVQRAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNPKVDSTDDVRELTHASSLGTVPQASILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSIASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A3D9L8Q2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Citricoccus muralis] (length=492 residues).
MDLRDYIRILRNNWLSILLVTLLGVAVAAGATALTKPTYTARTQIFVAVNSGDTASDILQGSSFSEKRVTSYVSLATSPR
VLQPVIEDLGLDLTVQGLAATIEATAPPQTVLINLSASHEDPAQSAEVANSVAESLISTVYEVEDPEGTSDPLVDLSVVE
QASVPLSPSSPRVALNLVLGLVVGAALGVAFALLRTLLDSRIRNREDVERITDAAILGAFADHKSAEDEPIISLDDQFDP
RAENYRQLRTHLKFTNVDGGTQSVVVTSSIPGEGKTTTACNLGIMMAESGSRVVIIDADLRRPRVAKTLGLEGAVGLSTI
LSGQIDLEDAIQSWGPEGELDIITSGEIPPNPSELLGSEAMRRLLRQLEGRYDVVLIDAPPLQPVTDPTVLASMASGVLL
VTRVDGYVHREQLQGGLDSLASVDARVLGLVLTRVPQKRGTYYAYQYAYESDAVEPTSARRSQGSRSSGAGGASTRGKGQ
SNQKALTGMRFR
>gnl|bykdb|A0A3D9PKF1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter sp. 199] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMFVAPSSSGNVQELQQGNNFTQQAVKSYADVVTTRA
VLQPVIDQFGLDITSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|A0A3D9PPQ8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter sp. 199] (length=462 residues).
MTLHESTALLRRYWYVVVAAMLAGGVVAFGLSQLATPVFTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVIARLGLDTTPQELARAVTVTTPQNTVIMEISVTEPSPAQAADIANAVAASLRDTAESYAPKGAEGSPTVSVRVIQ
EAPEPLSQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTTAPLLGSLERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLVGDAGLTTVLV
GQALIEDVVQPWGDGTLHVLTSGEIPPNPSELLASARMEELVARARSTYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRGQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAAEPATGRAARKARREHAAR
>gnl|bykdb|A0A3D9PSJ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces sp. OV429] (length=493 residues).
MELRDYIRILRQSWVLIVLLTLFGVAAGAVFSIMQTPLYSSSAKVFVSTSNGGSIGEMAQGNAYTQQRVTTYADLASTPI
VLLPVIADLQLDTTSDELAREVVATTLADTSLIEITVTDENAALTAEVATAVSESLTNVVSAIETTGVSTGAEAEGDEAA
AASPVRLTLVQHASVPQKPVSPNVMLNIVLGGLIGLALGVGAAVLRETLDTRIRNERDIEQVTDVPVIGGIVFDPKAKDR
PLIVHADPHSPRAESFRALRTNLQFLDAGRPDRSFVVTSSIESEGKSTTAANLAIALADAGARVLLVDADLRRPKVASYL
GIEGAVGLTDLLIGRAELQDVIQPWGRSQMYVLPAGRVPPNPSELLGSVVMAETVKELNRAFDVVLFDAPPLLPVTDAAV
LTRAAGGAILVVAVGRAHKGQVKGAFSVLENVDANVSGIVLTMLPTKGPDAYGYGRYGYGYGYGYGYPSNGEPQPEPKHE
PRHDPKQEPVAGA
>gnl|bykdb|A0A3D9U3N3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium trichothecenolyticum] (length=460 residues).
MELRDYLRILRAHWLAVVALTLLGVAVAWGWTALQPKVYTAHASGIVTATNAGSDTGASLVGDQLARSKVTSYVELGSWR
AVAECAIDELGLSTTPESLVTRVDVSNPLDTVIVRVTATASSPEEARDLAESWLGCMVQQINTVEGTDETGTAAVTLVTG
DSARLPTAPSSPNVRLALALGALVGLALGIGYAVVRHVLDRRLRDPRDIERETGVPVVGTLPIDKGLSVERGLADFESQH
SSSAPLAEAMRELRTNLQFMDVDNPPRAIVVTSPLPGDGKSTMAANLAVSLAAAGRHVVLLDADLRRPMVSTVFGLPDGA
GVTDVLAGRAELNEVVHNVGTSRNLAVITAGRIPPNPSEVLGSNRMQALLQSLTEHALVIIDSPPILPVTDAAVLTTAAD
GALIVVSAGKTTYDMLHKAIANLGKANARVLGVVLNRVPRKNGGYYGYQYQGDYAAADTR
>gnl|bykdb|A0A3D9UM43 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Calidifontibacter indicus] (length=469 residues).
MTLREFLTVVRRRWRIIALCTLVVVAVAALVTMQQPRSYTARSSFYLQTTAQSSGANNGIAVITAQDLNTYVAVLGSPPV
IEPLRRRLGLPAGYPINVSATVNPSASILNVTAVDSDPRRAAAIANATGPQLAEAAATFSPLLKSSGQAVAATTISPAAV
PASPTSPNVTRNIELAVLAGLLLGIAFALMRNVFDTKVRGEGDLQTVSDSPLLAALPADNMQKVISSWDSRAAERHGYLE
AVRRLRTSLMFVDVTTTGNAFLITSAVPGEGKTTTAINLARAVAETGSRTLLVDADLRRPTVASTLGLEGAAGLTTVLLG
RADLNDVIQPYGATNLYILAAGQVPPNPSELLGSQRMAEVFEKLVADFDYVLVDSPPVLPVVDAVLLDKLTAGLVMIVAA
DRTRKRDLAQALKVLQTAGVEIDGFAMNKVNAKSDSYYGTYTYESDVSTRSNKRGSRSEGGRRRALPRR
>gnl|bykdb|A0A3E0VEH4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=492 residues).
MELRDYLRVVRKGWVIIVAITLAGVAAASLISIAEVPKYLASSKVFVSAESAGSVSELSQGSSFTQNQVKSYTDVVTTPA
VLQPVIDQLGLDISAADLAKQVTASTAVGTVVVDISVTDESAQHAAEIANAISSTFETVVAKLVPVNASGASPVKISVLQ
QALVPTEPSSPNTRLNLVIGAALGLIAGLIVATLRQLLDTKIRNEQDVEAVTSAPILGGIAFDPRTSERPLVVHDDPRSP
RSESFRTLRTNLQFLVAAEAPKSYVLTSSIPGEGKSTSSANLAIVTAAAGTKVVIIDADLRKPRLSTYLGIEGGAGLTDV
LVGRATLADVLQKWGTDELWVLPAGRIPPNPSELLGSLAMIKLIATLEAEYDLVIFDAPPLLPVTDAAILAKHTGGALLI
VGSGRVHRGQLKGSIAALQNVGSGIAGIVMTMLPTKGPDSYGYGRYGYGYGYGYGDDLQTEGKQKRKRSTRGGQTTEALP
SDSVDADQKLPV
>gnl|bykdb|A0A3E0VEK0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=473 residues).
MSLDGYIRVIRKGWVLIVVFALLGLAAGAALAILATPQYRSTATMYVSVAVSDTPTAGDLTSGNSYAQAKVKSYTDIITS
ASVLDNVIKDLNLSVTSKALANQLSASSPVGTVIIELTATDPNPQQAANLANATAQSFSDVVIDDLEKPTGGGASLVKIQ
IVDPAIPATSPSSPNVPLNILLGAVVGIIFGLGAAFLRTSLDTRVHGTHDVEAVSDSPILGGISFDPESNKHPLLVHSDP
RNPRAEAFRALRTNLRFVNAGSDNRCFVVTSSIMGEGKSTTSANLALALAETGVRVVLIDGDLRKPKLAEYMGLEGAVGL
TDVLIGAVPLADVLQRWGNRELYVLPAGRVPPNPSELLGSDAMQNLLTALNEQVDYVIIDAPPLLPVTDGAIISSMTAGA
IVVAASGKVKRTELARALNSLSSINSNIVGVVMTMLPNKGPDSYNSEKYGYYGAGPDEDFAETTPPRRRRGRK
>gnl|bykdb|A0A3E0VFB7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=584 residues).
MSDYTNRGLGGRSGPARRSIRAPRRRAAGTPARQRVCVTISRRSTIAAKGELVDLSGYLRVLRAHWIAIVVFMLVGGLAG
YGWSLIQPRVYTADASGIITTGVSTDLGSALVGDNYAKSRVKSYLNVAKSRSVAAYAVDKLGLQSSPEDLISRVTVSNPI
DTAVLAVSAQSSTPEGARDLAETWIAGMVQQVTDLENSGTLDTTTAPAGTASIVKLQTLDSAVLPASPSSPNTRLAIALG
FLFGAIGGIGYAFVRNTLDRRIRSVENVEKAFGLAVVGTIPFDRNFTDANRLVDHISSSNYSVRRTDDDAVAEALRELRT
NLQFMDVDNPPRIIVVTSSLPGDGKSTITANLATTIAASGQRVVVVDGDLRRPTVAKSFNLLPGVGLTDVLVGRAEIEDV
LQPWGDSGRLMVMGAGVVPPNPSELLGSRAMQTLLNHLARDSIVLIDAPPLIPVTDAAILTACTDGALVVASVGKTTTDA
LGKALNNLERVNGRALGVILNRVPRRGSGSTYYGYQYKGDYNARVEDDVPVSPIEPSVDLRSENAHARRAAPVERVLAPG
AGGTPDDTANGADGTSTRATTDRR
>gnl|bykdb|A0A3E0VGJ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=490 residues).
MDPHDYWKALRKRWAVIVTLGILGGGGAYLYAQSLPDSFQSTSAVFVSSTQGATTSELVQGSTYTQNIVQSYVQLATTPK
VLAPVIAELGLDTTPNRLAKSITASTALNTVIIDITVTDGDPNRAADIANAVSQSLTSVATALAPQLAGSTSSISMEIVT
PAQIAANPVAPNRRLIGISGLAIGIVVGVLYSLGRTLLDTRIRTDRDIERISDVPVIGNVERTRRRSPQPTGITMRLAPH
SLMAEDYRRVRTNLEFADVDDAITSITVTSASPGEGKTTMAINIALAMAERSLRTLLIDADLRRPSVASYAQIEGAAGLT
SVLVGSATLDDVIQQWAPNVDILASGVAPSNPNQLLGSTAMARLMETVKGEYDFVIVDTPPILPASDALTLTHMTDGAVV
VALFNSTTRQKLSDTLGALDAVRARTIGVVINQTKPKARDGYYGRDLSIVPAVRTEADEAAGEKPAVEGPLDLQAVVAET
ASRPVLGHVQ
>gnl|bykdb|A0A3E0VTS3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=489 residues).
MNMDPHDYWKALRKRWIVIAILGVVGGGVAYAYAESLPDSFTATSEIFVSPTQGQTTSEVLQGSTYTQNLVQSYSQLATT
PAVLAPVIAELGLDTTPAKLAKAIKAETPLNTVIIQITVTDSSPELAASIANSVGASLSSAAIGLSPKNSTDVPSISMSI
VTPAQPAVNPVGPNRRLLEISGVAAGLAAGVLYAIGIAVFDTRIRSPRDIERLTETPVVGNVERRRRRSPQADGITMRMA
PHSLLAEDYRRVRTNLEFADVDNPIRSIVVTSAMPGEGKSTMAINIALAMAERSIRVLLIDADLRRPSIATYAQIEGAAG
LTSVLVGSADLKDVIQPWAPNVDILTSGTIPPNPNQLLGSTSMARLLQTVIADYDFVIVDTPPLLPASDALTLTHMTDGA
LVVSLYNSTTRQRLTDALAALSGVRARTIGIVLNQTKPKARDEYYSSDVTKMVSPTADEKTPDEKPHTEALPKPSESAVA
PFAELRPVP
>gnl|bykdb|A0A3E0VY43 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=485 residues).
MIMDPHDYWKALRKRWIVIAILGVVGGGVAYAYAESLPDSFTATSEIFVSPTQGQTTSEVLQGSTYTQNLVQSYSQLATT
PAVLTPVIAELGLDTTPARLAKAIKAETPLNTVIIQITVSDASPELAASIANSVGASLSSAAIGLSPKNSTDVPSISMSI
VTPAQPAVNPVGPNRRLLEISGVAAGLAAGVLYAIGIAVFDTRIRSPRDVERVTEVPVVGNVERRRRRSPQADGITMRIA
PHSLLAEDYRRVRTNLEFADVDNPIRSIVVTSAMPGEGKSTMAINIALAMAERSIRVLLIDADLRRPSIATYAQIEGAAG
LTSVLVGSADLKDVIQPWAPNVDILTSGTIPPNPNQLLGSTSMARLLQTVIDDYDFVIVDTPPLLPASDALTLTHMTNGA
LVVSLYNSTTRQRLTDALAALSGVRARTIGIVLNQTKPKARDEYYSSDVTKMVNPTSDEKTHSEAQPKPAESADAVPSAE
LRPVP
>gnl|bykdb|A0A3E0VYJ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=530 residues).
MDLSGYVRILRGHWIAILICMALGAGSAAGWSLVQQRVYSADASGIITTGVSQDLGSALVGDNYAKSRVKSYLNVAKSRA
VATYAIEQLGLSISPEALVSKISVTNPTDTAVLQITAQGSTPEGARSLAETWIAGMVSQVKILENSGDAASIAPGTTPGG
GSIVNLQTLDSAVLPSTPIFPNTKLAIIIGVLAGLLIGIIYAFVRHTLDRRIRSVASVEKEFGLSVVGTVPFDRNFTDKN
RLVEETSSTNYADRHTDDDAVSEAMRELRTNLQFMDVDNPPRIIVVTSSLAGDGKSTITANLAITIAASGQRVVVVDGDL
RRPTVATSFNLLPGVGLTDVLVGRAEIHDVLQPWGDTGRLQVMGAGAIPPNPSELLGSKAMLTLLNELARDAIVLVDAPP
LIPVTDAAILTARTDGALIVASVGKTTVDALGKSLQNIEKVKGRTLGVILNRVPRKGGEGGYYGYTYKGDYYSSTGNPEG
VDVPHQIPDPAELPKSHARRAARAARPVRESAPNTAESVPDEQPVKPTAR
>gnl|bykdb|A0A3E0VZJ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=476 residues).
MDIHDYLRILRKSWVLILALILLGIAAGSLVSILTTPSFQATTKVFISVQSGGTVSDLTQGSNFTQNQVKSYTDVVVTPA
VLQPVIDELKLNTTAAELAKHVSATTSPDTVVVDIGVTDPSPEAAAAIANQVATSFEETVGALVPGGTGSASPVKITVLQ
DALVPLAPVTPNTALNIELGALVGLVVALVAAVLRQTLDTRVRNEHDVEQVAEAPILGGIIYDASTAEHPLVVHDDPRSP
RAESFRTLRTNLQFLVTPESRRSFVITSSIPGEGKSTSTANLAIVTATAGSRVVLIDADLRKPRVAQYLGLEGGAGLTDV
LVGRAELDEVLQPWGANGLFVLPAGRVPPNPSELLSSPAMIQLIETLEERFDFVLFDSPPLLPVTDAAILAKHTAGALLV
VGASKVHRGQVRGSVAALKNVGSGVAGVIITMLPTRGPDSYGYGRYGYGYEYGYDDNTPTPKEARQARKSKLREAT
>gnl|bykdb|A0A3E0VZK6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=473 residues).
MTLEAYIRIIRKGWILVVVCALIGIGAGAAAAILTTPQYQATTTMYVSVQTSDQPSVNDLSSGNSYALAKVKSYVDIITS
ASVLDNVVSDLDLSITSRQLASKLSASSPTGTVIIELTATDPNPQTAANIANATADSFSNSVINQLETPEGSTASLVKVQ
VVDKALPAAAPASPSVPLDLLFGFIVGLVFGVAAAFLRSTLDTRVRGVHDVAAVSDAPLIGGISFDPESNTHPLLVHTDP
RNPRAEAFRALRTNLRFVNAGSDNRAFVVTSSIAGEGKSTTSANLALALAETGVRVVLIDGDLRKPRLAEYMGLEGAVGL
TDVLVGSVPLADVLQRWGNRELYVLPAGRIPPNPSELLGSDAMQNLLQALNEQVDYVLIDAPPLLPVTDGAIISSMTAGA
ILVAGSGKVKKTELARALNSLTSINSKVVGVVLTMLPNKGPDSYNNEKYGYYGAGPVEEEPENAPARRRRGRK
>gnl|bykdb|A0A3E0W244 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=485 residues).
MDLRDYLRVLRKGWIIILALVLMGVALGSVFSLLSTPMYLASSKVFVSVQSAGTVSELTQGSNFTQNQVKSYADIITTPA
VLQPVITQLQLPITAETLASRVTASTATGTVVVDIGVSDGSPQSAADIANAIASSFEKVVSSIVPVDATGTSPVKITVLQ
QALVPLEPATPNTRLNIILGGVIGLVLGLVVSVLRQTLDTKVRNEHDVEGITSAPILGGIAFDPRTVERPLVVQDDPRSP
RAESFRTLRTNLQFLVALDRPKSYVITSSIPGEGKSTSSANLAIVTASAGTRTIIIDADLRKPKLAEYLGLEGGAGLTDV
LVGRAEVSDVMQRWGSHDLFVLPAGRIPPNPSELLGSNAMIALIQKLEAEFDLVLFDAPPLLPVTDAAILAKHTGGALLM
VGAGRVHKGQLKGAVAALTNVGSGLAGIVMTMLPTKGPDSYGYGRYGYGYGYGYGLEFETTPGSERKRRKGAVAPRHEEG
FLPVK
>gnl|bykdb|A0A3E0W260 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=613 residues).
MRHERTDLRRGRVPLPSSLSSSTTSASTLCCRKWSSERRGRRKGDAGGSPPKGRVSSRSSQATPVQGDTMELTSYLRIVR
NHWIGIVLLIAVGAGAGAGWAIIQPRVYTADASGIITTGVSTDLGSALVGDNYAKSRVKSYLNVAKSRAVATYAIDKLGL
TTSPESLISSITVTNPRDTAVLQISAQGPTPAKARDLAETWVDGMIEQVKALENSGVAAEPSTTAPAPTTSGPSIVTLQT
LDSAVLPTSPTSPDTRLAILLGLLGGFALGIAYALTRNTLDRRIRSVTAVEKEFGLPVVGTVPFDRNFTDTNRLVSQMNV
SDYTAKRTDDDAVSEAMRELRTNLQFMDVDNPPRIIVVTSSLAGDGKSTITANLATTIAASGQRVVVVDGDLRRPTVAKS
FDLLPGVGLTDVLVGRAEIEDVLQPWGESGNLFVMGAGVIPPNPSELLGSKAMRTLLNELARDAMVLIDAPPLIPVTDAA
ILTARTDGALIVASVGKTSIDALRKSLQNIEKVNGRTLGVILNRVPRKGSANGYYGYQYKGDYYSSNATGEDRAPHVIPE
YADAVRSKSRRGAPLERRQGDDESTARPAGPAVSESDSPRAARSELTEHNTAP
>gnl|bykdb|A0A3E0W3A0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=473 residues).
MTLEGYFRVIRKGWVFIVIFALLGIGAGAALAIIATPQYRTTTTMYVSVAVSDTPTAGDLTSGNNYAQAKVKSYVSIITS
ASVLDKVIAELNLDTTSKSLADHLSAASPVGTVIIELTATDSDPQTAANLANATAQSFSDAVVNELEKPAGGGASLVKVR
VVDPALVPTSPSSPNVPLNIALGLLVGLVLGLGAAFLRTALDTRVHGAHDVSSVTDAPLLGGISFDPESNKHPLLVHSDP
RNPRAEAFRALRTNLRFVSAGSANHCFVVTSSIAGEGKSTTAANLALALAETGVRVVIIDGDLRKPKLAEYMGLEGAVGL
TDVLIGTVPLADVLQRWGNRELYVLPAGRVPPNPSELLGSDAMHNLLEALNEQVDYVIIDAPPLLPVTDGAIISSMTAGA
VVVAGSGKVKRTELARALNSLTSIDSKVVGVVLTMLPNKGPDSYNNEKYGYYGAGPVEEESENAPARRRRGRK
>gnl|bykdb|A0A3E0WAC7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=475 residues).
MHIRNYLRVLQRSWILIAGIVLVSVAASATYAILQTPLYQASTKVYVSTSSSATTAELQQGNTFTQQAVKTYADLVSTPI
VLDPVISQVGLSETSDDLAKTVTATAPLDTTIIEITVTSNSAADAATIANAVAKSFSTNVPALVPEAADGTPQVKISTVK
TATPPLRPTSPNVPLNVALGLIVGLLVGLALAFLREALDNRIRSQRDTEAITTAPVLGAIFFDPRASERPLVVHAEPKSP
QAESYRSLRTNLQFLEFGDLPHTFVITSSVASEGKSSVSSNLAIALADANSSVIVIDADLRRPRLASYLGLEGAVGLTDV
LIGRVELGDAIQQWGEREMYVLPAGSIPPNPSELLGGPAMKKLLETLETEFDTVIIDAPPLLPVTDAAILAKATRGAIVV
ASAGKVHKAQLRSAIDILDNVGATVLGLILTMLPTRGADAYGYGHYSYAYAEDEKPSSSSAEPILPVTDTPVAKS
>gnl|bykdb|A0A3E0WC79 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=566 residues).
MDPHDYLKALRKRWIVIAILGVLGGGVAYTYAESLPDSFQATSEIFVSSTQGQTTSELVQGSTYTQNLVQSYSQLATTPK
VLTPVIAELGLQVTPAQLAKSITAATPLNTVIIQITVTDGTPARAAAIANSVGESLAKTATALSPQNSSDVASISMEIVT
PAQAPVNPIAPNRRLIEISGLAVGLAAGVLYAIGRALFDTRLRSPRDIERLTDVPVIGNVERRRRHDPQPNGITMRLAPH
SLIAEDYRRVRTNLEFADVDNAIRSIVVTSAMPGEGKTTMSINIALAMAERSLRVLLIDADLRRPSVATYAQIEGAAGLT
TVLVGSADLDEVIQHWAPNVDILTSGVIPPNPNQLLGSSAMARLLSTVIGQYDFVIVDTPPLLPASDALTLTHMTDGAVV
VSLYNSTTRQKLTDALAALSGVKARTIGVVLNQTKPKARDEYYSSDVTKMDAPEGAAPRQTGAAEVSAPSARPSTTATAA
GPAEPAAEETATAASSAETTPSTLSAPVAPPRKPRAPRNPRTVKPAHTSPDGTERQAQNDTERSTPGVSKSVSQNVSQSA
ELRPVP
>gnl|bykdb|A0A3E0WEQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Subtercola boreus] (length=488 residues).
MELRDYLRVLRKGWIIILALTLLGVALGSLYSLATAPLYLASSKVFVSVQSAGTVSELTQGSNFTQNQVKSYTDVITTPA
VLQPVIEQLGLSVSAQSLASQVTASTATGTVVVDIGVTDRSPQRAADIANAIASSFETTVGQLVPVNTTGTSPVKITVLQ
EALVPNEPASPNTKLNILLGGIVGLILGVSVAILRQTLDTKVRNERDVEAVTSAPILGGIAFDPKAVERPLVVQDDPRSP
RAESFRTLRTNLQFLVALDRPKSYVITSSIPGEGKSTSSANLAIVTASAGTRTIIIDADLRKPKLAEYLGLEGGAGLTDL
LVGRAEISDVIQRWGSHELYVLPAGRIPPNPSELLGSKAMIGLIEDLEAEFDLVLFDAPPLLPVTDAAILAKHTGGALVM
VGAGRVHRGQLKGAISALTNVGSDIAGVVMTMLPTKGPDSYGYGRYGYGYGYGYGYGEEFDNTKASDRKRRKTKAEVPDD
AMELTSLK
>gnl|bykdb|A0A3E1Z1H9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Jishengella endophytica] (length=483 residues).
MDVLGYLRLVRRHWWIVLVTVMLALGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIRTASTTGTVLLKATITDTDQTRALKTTETLATKFTELVRKVETPPDGNAPPIKIEVVSG
PRVTSSPVSPQPTRNLVMGGVLGLLLGAALAVLRGLADVRMRDGAALQRVTGSPLLGEIPYENGAKAAPLIVGAAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAANALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVVPPAAPSVPADRAGSRRGAKAVGGDRTQELTR
LSR
>gnl|bykdb|A0A3E4S4A8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIIRKHLASAIISFVVVFAAVAAVAFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTAANPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGTRPANASILLNSDLMKEMVEQALTQYDYVILDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A3E5ATI8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudocatenulatum] (length=501 residues).
MAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVVNLAGQLTVTNPTNTAFVNITAETGDAKQASDIANS
VAESLSNVVEKSLYASGKESPVKLSVVQRAAEPISPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASDLQDII
NAPIMGRIPTDESLQSNKPIIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLDAALQT
YDYVIVDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYYYYYYY
DEDGKKSKHAHKNSRKKSKHN
>gnl|bykdb|A0A3G2SMM6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHELFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHDKYLSGVGSSAKKGRRSRRKARTRG
>gnl|bykdb|A0A3G2SMN6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=463 residues).
MNIIDFLRVLRANRLVILGCAALGLALGLLYSLLQPTLYTATSTAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IAAEGLDTAGATLSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVKVTAMEDALAPAAPSSPDRV
RHLLYGLGAGLVLGLIVAFLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMRDLLTALAETHMVLVDAPPVLPVTDSTLLATAVDGTVLVIRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDAYYQAPRDAAEAAAGTAGDASRR
>gnl|bykdb|A0A3G8JTQ2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia sp. MMS17-SY073] (length=483 residues).
MIRDGWLVIGLTTLLFGLVGLVYCILVTPIYQASATMYISSTVDDSTPAAAYQGSLASEQRVASYTKLADSDVVLREAIG
SGNLPVNVAEARTSVSASTTPNTVLLNVRARSSDSELAARMANGVAAALTRYVAQLETPAGSQEPLVKLSMVSPAAQPDT
PVSPNTLRTVFLAAVVGLILGLGLVFVRNRFSDRVKGEADLETVTDLPVVATVPTDTNIEGDELVDFAAGASLAAESYRK
LRTSLSFADIDNPPRTILVTSAVGGEGKTTTAMNLAASLAESGNSVLLVDADLRRPQVAKRMKLPVGIGLTNWLRGDAPF
GDLVQTGPIENLSIMTSGPQPPNPAELLDSERMVAGLKELSAKYDYVVFDSPPILPVVDAVILSKTVDAVLVVTRVGYSK
MKYVSAAIVSLQRAQARMAGVVLTDTRYARSATYAYYGPSSASSDTVVAPVKDSAAVGVGEQTMAPRADTEVEESRGLDR
NLR
>gnl|bykdb|A0A3G8VEK9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. PA-3-X8] (length=468 residues).
MDLKDYLRILRHRWLLIVAITMGAAALAHGYTLITQPVYQSTGQLFVAVTGGDSVGDLNQGNAFAQSRVASYVILATGST
VRSTVADRLDLDPASLIGTISASNPAQSVLIDISAVDSDPVAAARIANTAAQVLVDLVDDVESANEVDAAGALGDPTPVG
LTIVEEASPPRSPVAPNVLQNLAVGILAGLALGVGITLLIEVLDTRLRGRAAIEKLTDTSILGAFHTEPTDAAQLILGST
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSVPGEGKSTTAANLALVLAEAGNSVLLVDADLRRPRQHEMFGLEGAV
GLTTVLTGRISLGDASQAVDGAGRLAVLTSGELPPNPSELLGSAAMERALSEMERAYDVVVIDTPPLINVSDPTALSTLA
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRIEVARGEQSSSYAYYHRTAPTRRPRRTTA
>gnl|bykdb|A0A3G8VFV2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter sp. PA-3-X8] (length=460 residues).
MELRDYLRVLRKYWVLIVALALLGVAIAATYSLVKTPEYSSSAKVFVSTQSSDNVQELAQGNAFTQQRVKTYADLVSTPI
VLLPVVGSLELNITAGELAQQLTASAPLDTTLIEITAMNPDPVLAAEIANTTAESLTAVVSKIETPEDGASSPVKLTLVQ
QAGVPNTPVSPNVPLNIALGLLVGLAIGVGFAVLKETLDTRIRNERDVEGVTDIPLMGGIAWDPKAKQRPLIVQADPKSP
RAESFRSLRTNLQFLDVTDQPRSYVITSSIQSEGKSTTAANLAIALSDAGHKVVLIDADLRRPKLANYFDIEGAVGLSDV
LIRRATLDDTMQQWGRGLLQILPAGAVPPNPSELLGSVVMQKLIRGLEQQFDYVIIDAPPLLPVTDGALLARHTGGALVV
VAAGRTHKNQLKGALESLAHVNASVAGLVMTMVPTKGPDAYGYARYGYGAGYGYAEDVKK
>gnl|bykdb|A0A3G8WK80 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQSAQTPTGQSSPNIPLYLAMGLILGLIVGIGVALLKDILNPKVDSTDDVRELTHASSLGTVPQASILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSANVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVAGDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A3G9J2B6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides baekrokdamisoli] (length=446 residues).
MELDDLIGIARARWRIIVAVFLSALALASAYVFLTPAQYKSTATVFLSINLDQNNLSSGSYALSQNVASYASLVTTDLVA
KQVAADLPDLNLSPQALVGKLSSQVQQGTTFVDVSAQDHDPVKAQRIAQAAADEFRKEVQSLQTGLHAAATDAASLPIKP
TSPKTTLDLLVAAIIGLLLGIAGAAIRDRLDKTIRTDKQVESATGAAVLAKVIHDSQASTKPLLTDIGEFASRAEAFRLL
RTNLQFVDLDHPPRVFVVTSSVPAEGKTQTATNLAISMAKAGHRTLLVDGDLRRPTAAGLLGLDSSVGLTTVLTGQIDLS
KAIQVHPESGLHLLAAGKRPPNPTEVLQTQATRDLIGALREAYDAVIIDAPPLLPVADPAVLASAADGAILVTRHGATTA
AQLEVAAARLHSVGARIFGSVVNMVPRPDPGAYAYYMEYAPVANKQ
>gnl|bykdb|A0A3L7ALP7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycetocola lacteus] (length=497 residues).
MNFTDYIAAVRRHWIAVVIAIVIACGIAGVATAVATPQYQSKTQLFVSVGGGDSVGDLAQGNSFSERRVSSYVSLATSSR
VLEPVIQKLNLKMSLDQLKASISAASPPTTVLINITVTHPDPELAKRIADAVAESLVSEVEVVEGSASTSLIKMSVAEEA
VVPTVQSSPDIKKNLLMAIGVGGAIGVLYAVLRSLLDTRIRNREGVTNITDASILGVIAEEPGLDDDPLAILTDPYGVRA
ENFRQLRTQLQFTNLDHTSQSVVVTSSLPGEGKSSTSINLALMLAEGGGRVLLIDADLRRPRVATYLGLEGTVGLTTVLA
GRVDVADAIQSVGNRSKLDVLTSGQIPPNPSELLGSATMNTLLRDLEEHYDTIILDAPPTLPVTDPAVLSTITSGVLMVA
TLDGRLHNEELRAGLDNLDGVGARILGVALNRMPQRASAYATYGYQDTIEPSRREMRKSARRAKKGSKPGSPQAKPPAGP
IRKPATAGAPRHNEAIV
>gnl|bykdb|A0A3L7B488 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. CV-4] (length=486 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVSDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAENPVGLTADEVQRRVSTSTEAGTVLLRASITDTDQSRALRVTETLAAKFVELVQRVETPPEGKAPIKIEVVSGP
RVSANPVSPQPVRNMTLGGLIGLVLGVGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFESGARSAPLIVGEAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTATPSVPTDRATSARHSESNGVNGVSDRTQE
LTRLPR
>gnl|bykdb|A0A3L7BEY7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. BL-4] (length=486 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVSDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAENPVGLTADEVQRRVSTSTEAGTVLLRASITDTDQSRALRVTETLAAKFVELVQRVETPPEGKAPIKIEVVSGP
RVSANPVSPQPVRNMTLGGLIGLVLGVGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFESGARSAPLIVGEAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTATPSVPTDRATSARHSESNGVNGVSDRTQE
LTRLPR
>gnl|bykdb|A0A3L7IX11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycetocola zhadangensis] (length=470 residues).
MELRDYVRILRRSWAVLLLATLLGVSAGAGYSLLDPPRYSASSKVFVSTSSGQSAQELAQGNSFTVQRVKTYSDLAKTPI
VLLPVIAKLQLNMSADALASDIAVSAAVDTTIIEITASNASPVMAADIANTVSESLTAAVEEIETTDAGNAMSPVKLTMV
QQADVPSTPVSPRVPLNLALGAFVGLALGLGAAVLREMLDNKVRNERDLQALTPAPVIGAIAFDPKAKQRPLIVHANPRS
PRAESFRTLRTNLSFIDVGTKGRTFVITSSVQSEGKSTTGANLAITLADAGARVLLVDADLRRPKVAEYMGVEGGAGLTD
VLIGRAELPDVVQPWGKSKLFVLPAGKIPPNPSELLGSRAMAELILILEREFDAVIFDAPPLLPVTDAAILSKSVGGAIV
VVASGRTHKNQLKGALTALENVGASVSGIVLTMMPTSGPDAYGNGRYGYGYGYGASEADVLSDELAHKPA
>gnl|bykdb|A0A3L8P6G2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola sp. 4Q3S-7] (length=563 residues).
MSSPSPASGAGPSTPLVSRVIDIRVVLGLLRSYWPGLVVGVLLGAAAAYVYTATQPKIYAADASGIVTTGPTSGAGEASV
ADQVAKSRAASYVPLATSRSVAARVIDKLHLDTSPAALVGQITASNDDGTVLIDISAVSSSPSQAKQLADAWIEALAAEI
KRIEAPTDTTAAAEDYVHLEPVESAELPTAPISPSPKRNELLGVMAGLVLGAGYGFVRFRLDRRIHGSSDVAAYGVTVAG
VIPLNSAFAKRRGVSVESARDLRADSGAPGEAIRKLRTNLQFMDIDDPPRTIVVTSPLPGDGKSTVAANLAVALSASERP
VVIIDADLRRPVQADSFGLAEGAGLTDVLIGRATFEQVAQRPAQHPALIVLAAGRVPPNPSELLGSRTMGKLLAQLADTY
TVVVDAPPLLPVTDAAVLTANADGALIVLSAGSSLDVQLGEAIGNVRAVNGHVLGVVLNKVKRGVKSGYYGYSYDYAPAS
AGRSAPLWRRLAGLVRRPGRGLRPGESGALLPLPAFETSRTETSRTETSRTEPARIESARIEAPARPSRPPSPANRPPGP
PRR
>gnl|bykdb|A0A3M0GWZ7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Tessaracoccus sp. JDX10] (length=482 residues).
MELQQYLLIVRRYWRSAIATLLLCVVIAAAVTLTQKPTYTASAALFLAVESGDTAGDLAQGATYAERQVKSFVSVATTAV
VLQPVIDELKLDMTSTQLGKKLTVTSPTATTLIDVTSTDGDPAQAALLANTVADSLQKAVEKLSPAGVNGAKLVTATAID
PALAPTQPTAPRPTVNLALGLVLGMLLGVGQAVLRSVLDTRVRTVDDLENLTEAPLLGAIGHVDAPSDRALETEGQHWSN
AEAYRRLRTNVGFVGLGGERRPSMVVTSSVGAEGKTETVVNLARVLAQAGESVLLIDADLRRPQVANRMRLDSEFGLSEV
LSGKGSLQDMVIDVVPGSLAVLPAGTVPPNPSELLGSEAMAHLLATVERQYDHVLFDAPPLLPVTDAVVLAGQTAGAIMV
ARSGKVKRPEFEAAVGLLESGSVTLLGVVLNDAPANGSGSYGGYYAEYTSVPASDSVKAKREPVRARKRTNKVAEPVLEH
QS
>gnl|bykdb|A0A3M8AFW0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agromyces ramosus] (length=501 residues).
MELRDYLRGLRRHWIAILLMTMLGAAAGYGWTMLQTPVYVASASGLVQSTGQGDVGTQSLGDSLARSRVQSYLVIAGWTD
VAQGVIDDLGLETTPEQLIQRVEVTNPPGTVILSVSAEANTAQGAKDLSEAWLRSMKTVIDDIEADGSADGNAPVTIISR
ESASVPTSPAFPDVQTALIVGGVLGFGFGVAFAMIRTASDRRIRNGDDAEQKTGVAVVGTIPLVPSLDPEHRLIDASASN
STGKNGTFAVSEALRSLRTNLQFMDVDHPPKTIVVTSPLPGDGKSTIACNLALTLAAAGTTVVLVDGDLRRSMVASIMGL
PGGAGLSDVLAGRAALAEVLQRTPKSSNLLVLAAGSVPPNPSEVLGSERMHSLLSDLTKYATVIIDAPPLLPVTDGAVLA
HQADGALVVVTLGKTTYDLLDKALDTLRKARGRALGIVLNKVPIRGADAATYSYEYRRDYTSPATEVTPATETPEAGQVE
NPAKEAELVPRAPSGQRGRRG
>gnl|bykdb|A0A3M9MHZ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Flexivirga sp. BO-16] (length=514 residues).
MTLEDLWKLTRRYWLMLVACAAIGLALAAAYTWTRTKEYTATAQALVASPTASGRNNAQNSSAAYSNGLVAQQRATVWAN
LATSQQVTSQVIRNEHLNETPGQLAGNISATVPQTSPIITVHATSTDPAKAKAIANSVVDVLTSYVQKADPDTGVAIKNT
SSAVLPSTPSYPKPAKLLPIGLLAGLIIGYLLALIQHRRDTRVRSTDDVEENLGAAVLGVIPATRGLAAADRSLHGKQDF
STREALRQLRTNLRFVDVDHDPRSIVITSARMGEGKSTVAASLAWVIADSGDKVVLVDADLRRPAVAGIYDLDSSVGLTQ
VLAGTATIEDAIQPTDKHGLYVLTAGQIPPNPSELLGSGRMKQLLETLAVDYRVILDAPPLLPVTDAALLSASADGAVVV
VAASDTRVEHVQRAAHNLQAVGGRVLGGVLNRVNTRRINRIMYGDTQYGHGAYGTYAGEKYYGDNQPTDTPVGTLPPETD
DDVTQVGVTVRAPNDTEPAANLTSRKLLRKERAK
>gnl|bykdb|A0A3N0BZS5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter oryzae] (length=484 residues).
MDFSEYLRALKRSWAVLLVATLLGGIVGFGYARSSPPLYKASSSVFVSAQQGTTTSELVQGSTYTQNLIQSYAQLATLPT
VLEPVIARLRLDTTAAELARSVSAVSPLNTVLIEISVVDSSPAEAARIANAVSDSLATTVQGISPKTAAGTPAVAMQQVA
QAQEPAFAFAPNTRLLTLTGALLGLALAVIFAVGRELLDTRIKMVKDLHRVTDQPLLGTIPWRRRTDPAGIALRVAPQGR
AAESYRRLAANLEYINPDAPVRSVVVTSASEGEGKSLTAINLALALREKFPRVLLVDADLRQPRLAKYCQIEGGVGLSNV
LAGAAELGAVIEPWGGIHVLPSGTVPPNPNQLISSETMLALLRTCTADFDIVVIDSAPLLPVTDSLVLSRISDGAVFVAR
SGRTKRAHLAAALEAVAGVNGHVVGVVLNGIKTPRKDQAYGYGIGILREAPEAEGQISKRPEHRSDEASVDDNLTDPAAV
RAAS
>gnl|bykdb|A0A3N0CRL5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola ginsengisoli] (length=447 residues).
MAQRRWLTIVVFFLLGLLGGGALTYFQTPQYESKARVFIAAQNSTDANDSPIIASYFASQRVESYAQLATSRELMQRVIA
RLNLKETPAQLADQIEAKVSELTVIIEIKVHNPDAAQAQAIAKAESEVFTDYIAELETSPVKATIVDPASYSSNQVSPKP
VLNLVIAGVLGLLIGLGMALLRDLLDNTVSSAADVENTIDAPVLSSVAYDSDVPKHPLLTEVGSHSTRVEAFRLLRTNLQ
FLDLDTRPRAIVITSAVPSEGKTSTATNLAIALAQTGLRVLLVDGDLRRPKVASVLGLERSVGLTTVLVGRSELQDSIQK
HTDSGIYFLASGPIPPNPTEVLQSRAAQELFDRVSQMFDMVIIDGPPLLPVSDAAIMARDVDGAILVVRHGKTSKEQLKQ
AALRLAQVDANLLGVMVNMTPKRGGKGSGYGYGYGYAYGYGPDKPKS
>gnl|bykdb|A0A3N0DPX8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola solisilvae] (length=457 residues).
MDFKELLRIVQRRWLTIVVFFLLGLLGGGALTYFQTPQYESTSKVFIAADSSSGDSNAQDPIFASYFAQQRVQSYAQLAT
SRELLQRVISATNLNLTPAQLSSKISSSVDVNTVIIQLKVSDESPAQAQKIAKAESEAFTSYLTELETSPVKATIVDPAS
YNPAQVSPKPALNLVIAGVLGLILGAGMALLRDLLDNTVSSASDVENTIDAPVLSSVAYDADVPKHPLLTEVGSHSTRVE
AFRLLRTNLQFLDLDARPRALVITSAVPSEGKTSTATNLAIALAQTGLRVLLVDGDLRRPKVASVLGLERSVGMTTVLVG
RSELQDSIQKHTDSGIYFLASGPIPPNPTEVLQSRAAQELFDRVSQMFDMVIIDGPPLLPVSDAAIMARDVDGAILVVRH
GKTTKEQLKQAALRLNQVDANLLGVMVNMTPKRGGKGSGYGYGYGYAYGYGPEKHKS
>gnl|bykdb|A0A3N0GXT5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola pocheonensis] (length=447 residues).
MAQRRWLTIVVFFLLGLAGAGALTYTQTPQYESNARIFISVDTSGDSTQAAQGALFGINRVQSYAQLATSREVMQQVISR
LNLNLTPNQLAGKISSSVATETVIIVVKVTDPDPAVAQQIAKAESEVMTSFISDIETSPVKATVVDPASYNGNQVSPQPV
LNLALGALIGLLVGLGVALLRHLLDNTVSSPEDVEQAAEAPVLASIAYDGDVPKHPLLTEAGSHAPRVEAFRLLRTNLQF
LNLDTRPRSLVITSAVPGEGKTSTATNLAIALAQTGQRVLLVDGDLRRPKVASVLGLERSVGLTTVLVGRSELQESIQKH
AGSGIYLLASGPIPPNPTEVLQSHAAQSLFDRLNQMFDMVIIDAPPLLPVSDAAIMARDVDGAILVVRHGKTSKEQLRQA
RLRLDQVDANLFGVAVNMAPRRGKGAYGYAYGYGYEYSYEPKRAKAK
>gnl|bykdb|A0A3N1HM47 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB186] (length=490 residues).
MELRDVLRLLRDHWIALVAAVLLGTLVAYGWSLTQKPRYAAEAQGLVSAAVADAGGDPSQAIYLRQIADSVAKSSTLTYV
PIAKSRNVAEIVIGNLGLDVTAESLITAVQVTPDPESPILNVRATASTPEGARTLADAWIDAIAVRIQQVNQEAGAGDIV
SLAGVQSAALPSSPEFPNVRLVLGVGALAGLVLGLVYAFVRNTLDRRIRTAEVVERLFDLPVVGTLPVDKRLNETNRIVP
EADTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDMLLHEIAREAIVLVDAPPLLPVT
DGAILTARTDGALVVISAGRTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSQKSGARPDTAAA
PAPAPAPSAV
>gnl|bykdb|A0A3N1JE86 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. ZW137] (length=483 residues).
MELRDYITVLRKGWVLILVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETTGSASDLAQGNTFTQQRVLTYSNLVSTPI
VLLPVISSLKLDMNADQLATMVTATAPTSTTLISISVDDTDPVQAADIANATSQSLTNVVQDIEATDANGTSTVKLTRVK
QAQVPSTPVSPNVPVNVALGLLVGLALGVGIAVLRETLDNRVRTELDVEKISDKPVVGGIAFDNKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGARTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPRVAEYMDVDGSVGLTDV
LIGRASLEDVAHPWGRGNMVVLPSGAIPPNPSELLGSRAMEGLITTLEQQFDYVLFDAPPLLPVTDAAILAKKASGAILA
VAAGKTHKGQLAAAVTSLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGLGEDDESASEGARTSKRIGKKAGVLRR
AEH
>gnl|bykdb|A0A3N1JFL7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. ZW137] (length=456 residues).
MFVVTVARAVLAGWWIVMATTALGAGAALLVTNATTPVYRASTSFYVSVTGQDALSAGEIAQGSTAAQQKITSYIALVSS
PRVLRPVVERLGLHTTVADLGSRVSATTRTGTVIIVITASDPDARAAKTLASAVGSSLAEVVSDIEPAAASGVASVTLEP
VMPATVPTTPSSPRPAADLALGIGAGLAAGVLLALVRAAVDTRVRTAEDLDVDVPVVGDVAFDPDVERRPLIVRDDGSSA
RSEAFRSLRTNIQFLRSGGAPTIAVTSARQAEGKTTTVANLGIAMSTGGLRTVIVDADLRRPAMAQTMGLEGAAGLTDVL
VARAELEDVLQPWGDDGLHVLPAGTVPPNPSELIGSEAMERVIAELARRFDVVLVDTPPVLAVTDAALMSTLVSTTLIVV
AANQGRRSDARAVVEALARVGEHADGIVLTKTRHAISRRSYYRSEYGARRTTEPAR
>gnl|bykdb|A0A3N1K349 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. PhB107] (length=493 residues).
MELKDFIATIRSSWLLVVAVTAVALMTAAAVTLMTPKTFTSSTQLFVSVAPLGTSSAGDLVQGSSAAQAKVRSYVDVVTS
GRVLAPVIAELGLDETPAALAARVSASSPPNTALIDLSASDTDPAAAAALTSAVAASFESIVETELEAPDGGVPLVTIER
LDTPVAATRPSSPSPVLALSVGGVLGLLAGVAASLLRRTLDVRVRGKSDVESLTDAPVLGTIGQHDESPTAPLIVQNEPR
SPLAEAYRALRTNLQFTSFDRAERSFLVTSAMPSEGKSTTAANLAICLAETGASVLLVDADLRRPRVAELMGIEGAVGLT
DLLVGRAEIDDVLQPWGSQRLSVLPSGPVPPNPSELLGSTAMRSLVQHATAMFDFVVIDSPPLLPVTDAAVVSRLVSGVI
LSASARRSTRPQLRQALLAVSEIGSRTLGVVLTMALLRGRDAYGYGHYGAYYGHGTGPTPGTAGTAPVTPAPAPTPPATT
TRAAALSPSGAPA
>gnl|bykdb|A0A3N1K9V0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB115] (length=487 residues).
MTLVQFLDVVRRRWLTIAIAVVVGVATAYGATQLQTPEYQSEAGVFVSVSGSDSISDLSQGNNFSAARVKSYAALATTPE
VLRAAATAAGLHGPAAAIGGTVGVTTDPDTVIISITATATDANRAAAVANAVAAELIDKVATVERRTGSAIVHLSVIEKA
MPAGSPFTPRVPVNIALGLLGGLAIGLAGALLREVLDTRLRSTEVLHRLIDTSVLGEFPIDDSVRDHPLLDATNRYTPRA
EAFRQLRTQLTFTNLEGSSQSLVVTSARPGEGKSTTAVNLAMTLAQNGGRVLLVDADLRRPKIGDYLGLESRVGLTTVLA
RQVALEDAIQTIGDTNPLAVLASGRVPPNPSELLGSQHMAELVRELERRYDYVIVDAPPALPVTDPAILGAICSGVLLVV
SMNGHVRRADVQAAHERMQRIGARVLGVVLNKTTLQRKERSYYHYEASAPLSESPRRVGRVRARRTSSTPSSSSASPTTT
PISEETR
>gnl|bykdb|A0A3N1KAQ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB115] (length=478 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDELAEIVTSDAPLNTTLISITVNDTNAKQAADIANATSESLTNVVQNIEATDADGTSTVKLTRVK
EAQVPSAPVSPNVPVNVVLGLLVGLALGVGVAVLRETLDNRVRTESDVEKISEKPVVGGIAYDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVQSEGKSTTVANLAIALDSAGFRVILIDADLRRPKVATYMDLEGNAGLTDV
LIGRATVEDVAVPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIAGLEQQFDYVLFDAPPLLPVTDAAILAKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDDDTPMPKPPKRGRIGAFRGAER
>gnl|bykdb|A0A3N1MQN7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB93] (length=490 residues).
MELRDVLRLLRDHWIAIVAAVLLGTLVAYGWSLTQKPRYAAEAQGLVSAAVADAGGDPSQAIYLRQIADSVAKSSTLTYV
PIAKSRNVAEIVIGNLGLDVTAESLITAVQVTPDPESPILNVRATASTPEGARTLADAWIDAIAIRIQQVNQESGAGDTV
SLSGVQAAALPSAPEFPNVRLVLGVGALAGLVLGLVYAFVRNTLDRRIRTAEVVERLFDLPVVGTLPVDKRLNETNRIVP
EADTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDMLLHEIAREAIVLVDAPPLLPVT
DGAILTARTDGALVVISAGRTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSQKSGARPDAAAA
PAPAPAPSAV
>gnl|bykdb|A0A3N1NCJ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB171] (length=478 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDQLAELVTSDAPLNTTLISITVNDTNAKQAADIANATSESLTNVVQNIEATDADGTSTVKLTRVK
EAQVPNAPVSPNVPVNVVLGLLVGLALGVGVAVLRSTLDNRVRTESDVEKISEKPVVGGIAYDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVESEGKSTTVANLAIALDSAGFRVILIDADLRRPKIATYMDLEGGAGLTDV
LIGRATIEDVAVPWGRGNLVVLPAGPIPPNPSELLGSRAMQDLIAGLEQQFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDEDTPMPKPPKRGRVAATRGAAR
>gnl|bykdb|A0A3N1NCT6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB171] (length=469 residues).
MTLAQFLDVLRRRWPSVLVVTVLATATAIGLSFVQTPQYRASSEVFVSVAAGSSVTDLSQGNNFSAARVKSYTALAVTPR
VLGAAAQQLGLPRGTDLSSVVSATSTNDTVIIVVSATSASPTRAAAIANAVTEQLVGVVDEVERSAQKNALVHLSVFQPA
HAPSVPYAPRASVTIAVGLLAGLALGLAQAVLREVLDTRLRSFEALRRLSGASVLGEFAVDESVAKHPLVSSEHSYSTRA
ESFRQLRTHLTYTNLDGASQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVLLVDADLRRPTMGTYLGIESRVGLSTVLT
RQVQLDDAVQVVGADNPLHVLAAGRVPPNPSELLSSSRMVDLVRQLEASYDYVIVDAPPILPVTDPAVLGAICSGVLLVA
SVNGQTKRADFVAAELTLRQVGARVLGLVVNRLPAQRRAKTYYNYEPSAPVSESPRRSSRARRSPEETR
>gnl|bykdb|A0A3N1QGT9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frondihabitans sp. PhB188] (length=477 residues).
MELTEFIRLLRRSWMLILTATLLGLLSGSLLSLLATKTYESTTTLYVSVQTPGDNSAVDLSQGSTAAQAKVRSYVQVVTS
SDVLDPVVKELGLAESGMQLASRVSAQSKPNTVNIDITVSDTDPGRAASTADAIAKSFSTVVSKKLEAPAVGSTSPVSIA
TFQKAVAPTSPASPNVPVNIALGFVVGLLAGLAGALLRNTLDTRIHGAPDVASITDTPVIGGIGFDPEAAKHPLIVHVDP
RSPRAESFRALRTNLNFIDPGVTRRSYVVTSAMPAEGKSTTTANLAIALAESGASVVLVDADLRRPRTAEIMGIEGAVGL
TDVLIGQIEMDDALQPWGSRGNLAVLPAGRVPPNPSELLGSMGMSAALEQLSERYDFVLIDAPPLLPVTDAAVLSKIVTG
TLLIVSAASSKRGQLREAMTLLQNIGSRTLGVVMTKLPTKGPNGYGYGGYSEYYGRAPEKTIPAGGMSRKALRQVRQ
>gnl|bykdb|A0A3N1YB74 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. JUb34] (length=478 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDQLAELVTSDAPLNTTLISITVNDTSAKQAADIANATSESLTNVVQNIEATDADGTSTVKLTRVK
EAQVPNAPVSPNVPVNVVLGLLVGLALGVGVAVLRETLDNRVRTESDVEKISEKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDIGTGSRTFVMTSSVESEGKSTTVANLAIALDSAGFRVILIDADLRRPKIATYMDLEGGAGLTDV
LIGRATIEDVAVPWGRGNLIVLPAGPIPPNPSELLGSRAMQDLIAGLEQQFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDEETPMPKAPKRGRVAATRGAER
>gnl|bykdb|A0A3N2AT99 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agrococcus jenensis] (length=467 residues).
MELSDYLRVVRKNVILLLALMLAGVGVGALIATVQQPSYSAQTQVFVSTQGGGSSAELVQGNSFTLSRVKTYASLATSQD
VLERVIADLGLTLDSQTLAESVAASPVLDTTIIEINAVDEDPALAARIADAVAASLATTVAEIESPGEGGSPVQLTTVER
ATVPQTPVSPRPMLNVALGALLGLALGIAIALLREVLDTRIRDERGLKLVTELPVVGSMTFDPKAKQRPLVVHSDPLSPR
SEAYRTLRTNLQFVEVDGRSRTFVVTSSTPSEGKSSTAANLALALADAGETVILIDADLRKPKVAEYMNIDGSVGLTDVL
IGRAELVDAVQMWGESSLYVLPSGQIPPNPSELLGSKSMQALITQLETEFDWVLFDAPPLLPVTDAAVLSRNTAGAIMVV
ASGRATRHQLDVALGMLENVDAPVAGVVLTMLPAKAANAYGAYGAYGEGYALSKTKTKPKAKAKARG
>gnl|bykdb|A0A3N2AWG3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agrococcus jenensis] (length=475 residues).
MNPAPATWTLTHAWEAVRKYWILIVGFAVLGGGIGYAVSASTPPRYQSAASLYFALNQGTSGADLNQGSTYTQNQMLSFG
RLATSSRVLERVIDELDLQSTPRELARSVSITVPQDTVILEVAATSSEPERAAAIANSVAEQLAVVVLDVGAESVEGAAS
ISASVIDDAVAPTVQTTPNKTRDALLAAAIGFLLGVLTAFVATLADTRVRNEAAVARVTDLPVLGVVTRATRGVGAGLIS
AREPHDPVSEDMRRIQSALAFTTLDGTSRRLLVTSSSPGEGKSTFSTNLAVTLADSGDRTLVIDADLRRPRVDELFGLDG
SVGLTTALMGGIDLSRAIVGWREHGPDVLTSGALPPNPATVVTSEAFRSVLDDASERYDVVIIDSPPVLTVADSNLIAPL
ADGVVIVVDASKTRRPQLANTIRSIESAGGRILGIVLNRARPSKHRNTYYADDPSAERRQKRPVARVRHSAVPKA
>gnl|bykdb|A0A3N2BDL8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bogoriella caseilytica] (length=515 residues).
MELREYLAILRKRWIAIALCVVLGLLTAATVSLLLPPQYEASARVYVAAVGGENVGELTQGSSFAERQLASYAEIATAPL
VLEPVAERLGTSVAASHINVTTADGTTILEVRATGSDAQASAALANAVADQLVVVVEELSPNPAGQDLVAARVVELAASP
RSPVFPNIPLNLAMGFIVGIAVGVAVAVLRTVLDTRVRTERDVAEWSSAPVLGTFRYDDKDPDSPLYMVREPTSERSEAM
RRLRTNLQFVDLGESKSIVVTSSVPGEGKSTTSVNLAIALANAGERVILVDCDLRRPDVANYTGLEGWAGLTTALIGKAE
LDEVIQPWLNGQLDVLTSGQLPPNPSELLGSTAMRKVLEELADSYDVVVIDSPPLLPVADAALLAKFASGALVVVGADRI
HKGQLSQTIRNLDTVDARVLGTVLNKASPLKDGTYYSGYTYTYETVGDAQVMEDQGSMAPVRSTVSHSENGALGRGARSA
ATRDLDSTDSLGAHASSRGFSGGTWPGKRLQESGD
>gnl|bykdb|A0A3N2BZR7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter flavus] (length=479 residues).
MTVHDYLGAIRKQWAVILILALLGAAGGYVYAQSMPSMYRSTSSAYASAAYGESTSELVQGSTYVQNLVQSYALIAKSPY
VLQPVINDLDLDLSVAQLARTVTADTPLNTVVVDISVVNSDPELARAIADGIAKSLSDAVANISPKDAAQAASVQLTIIS
PASAPVNPVSPDVRLITGLGAAVGVLLGLAWAVLRELVDTRIRSNTDIDLVTDLPLLAEIGRTSRERRIAQVVRSSPNGV
TAEAFRSLCMSLAFADVDKPVASVVVTSALPGEGKSSVSVGLAMSLAESSGSVILVDGDLRNPSIADYTGLEGSVGLTSV
LLGDSSLDEAVQPWGVPGLDILVAGAVPPNPNQLLASDTMRGTLEALKAQYDFVVIDTSPVIPVTDPLWLVHETDGAIVV
VRERRTKRQQLQKALSNLDSVGARVLGVVANDVRHHERTTYYTDDENARPRQSGRALRPRRRAVTTGASEPTPETAGDR
>gnl|bykdb|A0A3N2C1T7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter flavus] (length=468 residues).
MDLKDYLRILRHRWLLIVAITAGTAALAHGYTLITQPVYQSTGQLFVAVTGGDSVGDLNQGNAFAQSRVASYVILATGST
VRSTVADRLDLDPASLIGTISASNPAQSVLIDISAVDSDPVAAARIANTAAQVLVDLVDDVESANEVDSPGALGDPTPVG
LTIVEQASPPRSPIAPNVLQNLAVGVFTGLALGVGITLLIEVLDTRLRGRSAIEKLTDTSILGAFHTEPADAAQLILGST
ESYSRRAESFRQLRTHLQFASIDGGLRSVMVTSSVPGEGKSTTSANLALVLAEAGNSVLLVDADLRRPRQHEMFGLEDAV
GLTTVLTGRISLGDAVQAVNGAGRLAVLTSGELPPNPSELLGSAAMERALSEMERAYDVVVIDTPPLINVSDPTALSTLA
SGVLLVASADGRLHRDQLRQSLENLSFVQAKLLGVVLNRVEVARGEQSSSYAYYHRTAPTRRPRRTTA
>gnl|bykdb|A0A3N2C5B5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Plantibacter flavus] (length=460 residues).
MELRDYLRVLRKYWVLIVALALVGIGVAATYSIVKTPEYSSSAKVFVSTQSSDNVQELAQGNTFTQQRVKTYADLVSTPI
VLLPVIGTLQLNITAGQLAEQVTASAPLDTTLIEITAMSPDPVLAAEIANTTAESLTNAVSKIETPEDGASSPVKLTLVQ
QADVPNAPVSPNVPLNIALGLLIGLALGVGFAVLKETLDTRIRNERDVEGVTDIPLMGGIAFDPKARQRPLIVQADPKSP
RAESFRSLRTNLQFLDVTDQPRSYVITSSIQSEGKSTTAANLAIALADAGHRVVLIDADLRRPKLANYFDIEGAVGLSDV
LIRRASLDDTIQPWGRGLLQILPAGAVPPNPSELLGSVTMQKLIRGLEQQFDYVLIDAPPLLPVTDGALLARHTGGALVV
VAAGRTHKNQLKGAIESLAHVNASIAGLVMTMVPTKGPDAYGYARYGYGAGYGYAEDVKK
>gnl|bykdb|A0A3N2CYC6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Marmoricola aurantiacus] (length=495 residues).
MELRDYLRIARRRWVLILLSTLTALGLAAVFTAQATPQYESTARVFISTSASGSSSDAYQGGLFSQQRVASYADVVNGVD
VAQRVVDDLQLDVSAETLASRISAAVVPETVLLQVSVRDPNRFEAQRINEALMVQIQDVIRELETPPGRRVATLKATVVD
TPQLPETAVSPQPTRNLGLALVLGLLLGTGLAVTRELLDTSVKAIDDVPTLEHLPVLSGLSYDPQVFGKPLITDLPTHSP
RVEAFRVLRTNMEFLDVDATSKVFVVTSSVPGEGKSTTSTNSALAFAVAGRNVLLIDADLRRPQVSNLLGLVDSVGLTTI
LAGQASIDDALQMHADSGLSVITSGAIPPNPAELLQSRAMQELLDQLRDRFAVIVIDAPPLLPVTDAALLASEADGAVVV
VRYGRTTKDQLRGAADRLGSVDAKLLGIVFNMIPERGAGYGYGYGYGYGYGPDQATSSTRGRLTWRQRRDQRRQRRQSGQ
GGRHNDEGATTSAMS
>gnl|bykdb|A0A3N2FLV7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter sp. PhB127] (length=490 residues).
MELRDVLRLLRDHWIALVAAVLLGTLVAYGWSLTQKPRYAAEAQGLVSAAVADAGGDPSQAIYLRQIADSVAKSSTLTYV
PIAKSRNVAEIVIGNLGLDVTAESLITAVQVTPDPESPILNVRATASTPEGARTLADAWIDAIAVRIQQVNQESGAGDTV
SLSGVQSAALPSSPEFPNVRLVLGVGALAGLVLGLVYAFVRNTLDRRIRTAEVVERLFDLPVVGTLPVDKRLNETNRIVP
EADTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDMLLHEIAREAIVLVDAPPLLPVT
DGAILTARTDGALVVISAGRTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSQKSGARPEAAAA
PVPAPAPSAV
>gnl|bykdb|A0A3N2GHT0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB78] (length=452 residues).
MNYLAVIRALLSGWWIIAGATLIGAGASLVVTTITPPTYQSSTSYYVSVAGVTSATAGEIAQGSTAAQQKIKSYMQLAAS
PRVLQGVIDELDLDTTPAALASQVTTSVDTGSVIIKIAVQDDSAKASATIAERIGKSLATVVQQIEPTGADRKPSVTLEE
VTPASVPTSPIAPRKAADIALGLFGGLAVGAALALLRAAVDTRIRSGEDLDVDVPVVGDIAFDTDAARQPLIIRDEVNSA
RSEAFRSLRTNIQFLRTSGAPTIALTSARPSEGKTTTTANLGIALSKSGIRTVIIDADLRRPNVAALMNIEGAAGLTDLL
VGRVELEDVLQDWGVDGLAVLPAGTVPPNPSELIGSEAMSRVLAELASRFDVVLVDTPPVLAVTDSALVSTLVSTTLLVT
AANQTKTSDVRLAIEALSRVGQQVAGVVLTKTKHKASRSAYYRSEYTSARPA
>gnl|bykdb|A0A3N2GI81 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB78] (length=478 residues).
MELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVSTQTSGSASDLAQGNTFTQQRVLTYSNLVETPI
VLLPVISSLKLDMTSDQLAELVTADAPANTTLISITVNDTSAKQAADIANATSESLTNVVQNIEATDADGTSTVKLTRVK
EAQVPSAPVSPNVPVNVVLGLLVGLALGVGVAVLRSTLDNRVRTESDVEKISEKPVVGGIAYDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSVESEGKSTTVANLAIALDSAGFRVILIDADLRRPKIATYMDLEGGAGLTDV
LIGRATIEDVAVPWGRGNLVVLPAGPIPPNPSELLGSRAMQDLIAGLEQQFDYVLFDAPPLLPVTDAAILSKKASGAIVA
VASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGYAYGYGLQDEDTPMPKPPKRGRVAATRGAAR
>gnl|bykdb|A0A3N2HI53 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. PhB24] (length=469 residues).
MELKTFITVVRARWRLIVVVTLSTVLLGSIASLTTTRSYSSSTQLFVSVSSIGSSDAGDLVQGSSAAQAKVRSYVSVVTS
GRVLEPVIADLGLDTTPAGLAAEISASSPVNTSLIDISVTDPDPAQAARLTGAVAASFEKVVEEQLERPVGGGSGLVTVE
SLDSPAVPTRPTNPKPVLWISLAFAVGVLSGTALALLRDTLDTRIRSKADVEEVTDAPVLGGIGFHPRATTAPLVVDHAP
RSPLAESYRALRTSLQFVTFEGHGRTLVVTSAMPGEGKSTTAANLAVCLAETGASVLLVDADLRRPRIAEIMGLEGAVGL
TDLLVGRAELVDAVQPWGDLALHVLPSGTVPPNPSELLGSLAMASLVSTVEVDYDFVVIDTPPLLPVTDAAVLSRCVSGV
IVATAAQRSSRHQLKQALAAISEIGSRTVGIVLTMAPMKGLGAYGYGEYGGYHVSIPESPASASTATAG
>gnl|bykdb|A0A3N2HXF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. PhB118] (length=469 residues).
MELKTFITVVRTRWVLIVVVTLSAVLLGATASLATAKSYASSTQLFVSVSSIGSSDAGDLVQGSSAAQAKVRSYVSVVTS
GRVLEPVIADLGLDTTPAGLASKISASSPVNTSLIDISVTDGDPAQAARLADAVATSFEKVVEEQLEQPVGGGSGLVTVE
SIDAPVVPTSPANPKPVLWISLALGLGILSGTALALLRNTLDTRIRSKADVEGVTNAPLLGGIGFHTEASSAPLVVNNDP
RSPLAESYRALRTNLQFVSFEGRSRTFIVTSAMPGEGKSTTAANLAVCLAETGASVLLVDADLRRPRVAEVMGLESAVGL
TDLLVGRAELVDVVQPWGRLGLHVLPSGTVPPNPSELLGSLAMASLVSTVEVDYDFVIIDTPPLLPVTDAAVLSRCVSGV
IVATAAQRSSRHQLKQALAAVSEIGSRTLGVVLTMAPTKGLGAYGYGAYGGYYGSVTENSVPASRAAAR
>gnl|bykdb|A0A3N2IBU5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frigoribacterium sp. PhB160] (length=486 residues).
MTSYLTAVRRHVVLVLVGVLLGTTFGAVASAASVPLYSSTTTLFVSVGSRGEASSLELAQGSTAAQNKVVTFVDVIRTPG
VLGPVIDRLDLDTTPTELAGRVSAENTFGTVLIDVSVDDHDAQTAADIADEIGVVLAEVVTETLERPSDGSQSLVLITPV
EPAEVAVVPSTPGPLVVVGVAALAGLVLGLLAAVVRSGLDTRLHDDADVARVTDAPLLGAIDFDPAFSAAPLAVATHPQG
PAAEAFRTLRTNLWFLESAPAAGCLVVTSSLTGEGKTTTTANLALALAENGSSVVVVDGDLRRPRLAEVLGVEGGAGLTD
VLIGRADLDDVLQPRGDRPLSVLASGAIPPNPSELLGSEAMRSLLDQLASRFDHVLIDAPPLLPVTDSVLLSRLARGALL
VTASGRVTSSQLESATRSVETAGGTVLGVVLTMTPRTSRSTYDYASDPAGEAPATRARPARLPRRGRLVPARARRRATAS
GPRRRA
>gnl|bykdb|A0A3N2P6W2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. HM5-17] (length=491 residues).
MDLQNYLRALRQRWWVVLATVMVALGVAGFVTVRATPQYGASVTFFVTSPSQGVSDAYQGGLFLQQRVKSYVDLLTSDRL
AQTIVAEEQLGLTADEVRSRISARVEADTVLLSATVTDSDQARALRLTEALAAHFVTLVQTIETPPGAREAPLKIEVVGG
PRVDAEPVSPRPVRNLLLAGILGLVLGVGLAVLRGLTDTTVRDGDALQEITSAPLLGSIPYDGHARSSPLIVGAAAQSPR
AEAMRKLRTNLRFVDAQEPARVIAVTSAVQAEGKSTLACNLAITLAEAGWQVLLVDADLRRPRVAGYLGIPAGAGLTDVL
IGEVPVEDVLQPWGDKSLLVLPGGSVPPNPSELLGSKAMADLLLSLRDLTDIVIIDTPPLLAFTDGVVVAVQADGALLVS
RGGRTPRAQTAAAARALHSVSARLLGCVLNMSKENKIDVEQYRAYRRGVPVENLLGRRDDRRDDPGPARIPLDGAGLGLP
ADTEELSRVPR
>gnl|bykdb|A0A3N4VGE6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frondihabitans sp. PhB153] (length=478 residues).
MELREYITVLRKGWILILVLALVGVALAATYSLVKKPVFSATAQVFVSTQSSGSVSDLVQGSTFTQQRVTTYANLVTTPI
VLQPVVASLKLDMTAEELAQIVSADAPLNTTLIQITATSTSGVQAAEIVNATSQSLTNVVQNIEATGKDDASTVKLTRVQ
EAQVPTSPISPKVPLNVILGLLIGLAVGVGLSVLRETLDNRIRNEGDVEKIHSGPIIGGIAYDAKTSSRPLIVHADPRSP
RAESFRTLRTNLQFLELEGKARTFVMTSSVQSEGKSTTVANLAIALETAGYRVVLIDADLRRPKIADYMGLEGAVGLTDV
LIGRFDLSDAVQPWGSGNLHVLPAGQIPPNPSELLGSRRMQDLLSTLEASYDYILFDAPPLLPVTDAAILAKRASGAIVA
VAAGQTHKNQLSGAVATLENVGAPIAGFVLTMMPLKGPNAFGYGRYGYGNYGYGTSDEAVAPARGGLFRRGPSRQATR
>gnl|bykdb|A0A3N4VMC7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Frondihabitans sp. PhB153] (length=472 residues).
MQLNDYIRIVRRRWATIVVVTLVAVSCAAAYTITATKTYVASTQLFVSVQAADASSAVEAVQGTSAAQEKVRTYVGVIKS
STVLAPVIKKLHLDTTPAALADRVTATANSNTTLMDVAVTDTDPQRAAEIANAVGASFTTEVLDLESPLAGGSSLVKVRT
IEPAVVPGYPSSPRVLFTLALGGLIGLAAGFSVAVLRSALDTRIHGSSDVEGITAVPILGGISFDPSIKNRPLIVRADPR
SPRAEAFRALRTNLQFVDIGATKRCFVTTSSVPSEGKTTTTANLAIAIAESGATVVLVDGDLRRPRIAEIMGLEGAVGLT
DILIGRVELEDALQPWGRGSLTVLPAGSIPPNPSELLGSAGMHALIRELTAAYDYVLVDAPPTLPVTDAALLSTVTSGAL
VVAAAGRTTKNQLQSALDNLERTGSHPAGVILTMLPAKGPNAYGYGSYDAYYGIDGKDPSLETDALISGRHR
>gnl|bykdb|A0A3N4VQ98 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB137] (length=475 residues).
MTLSQFLEVIRRRWISALALVLLATSAAVGVTLVQAPEYRASSEVFVSVAAGSSVTDLSQGNNFSAARVKSYTALALTPR
VLGAAAKQLGLPAGTDLSKVVTASSTDETVIISLSATSTSPARAAAIANAVTTQLVAVVDEVERSSQQSDLVHLSVFQQA
KAPTMPFAPRIPVNLAIGVLAGLALGVAQAVLREVLDTRLRSFDALRRLTTASVLGEFGVDDTIAKHPLVAVDNRYSTRA
ESFRQLRTHLTYTNLDGGPQSIVVTSATPGEGKSSTAVNLALMLAQNGSRVLLVDADLRRPTTGTYLGIESRVGLSTVLT
RQVALDDAIQEVGGDNPLHVLAAGRVPPNPSELLSSSRMADLVRELESRYDVVIVDAPPLLPVTDPAVLGAICSGVLLVV
SVNGQTRRADFVAAEQTLRQVGARLLGLVVNRLPAQRRMKTYYNYEPSAPVSESPRRSSRARNDSTATTEQKETR
>gnl|bykdb|A0A3N4VVK7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. PhB137] (length=512 residues).
MWQYFHADRWDNPGRPATGKLQDTATFGEGCRVELRDYIAVLRKGWVFILVLALVGVAAAAGFSLLKQPVYSASAQVFVS
TETSGSASDLAQGNTFTQQRVLTYSNLVSTPIVLLPVISSLKLDMTSDELAEIVTSDAPLNTTLISITVNDTNAKQAADI
ANATSESLTNVVESIEATDADGTSTVKLTRVKEAQVPSAPVSPNVPVNVVLGLLVGLALGVGVAVLRETLDNRVRSESDV
EKISEKPVVGGIAYDSKASERPLIVQVDPRSPRAESFRTLRTNLQFLDLGTGSRTFVMTSSVESEGKSTTVANLAIALDS
AGFRVILIDADLRRPKVATYMDLEGNAGLTDVLIGRATVEDVAVPWGRGNLVVLPAGQIPPNPSELLGSRAMQDLIAGLE
QQFDYVLFDAPPLLPVTDAAILSKKASGAIVAVASGRTHKGQLAGAVSALENVGAPIAGFVMTMMPTKGPGAYGYGRYGY
AYGYGYGLQDDDDATTPKPPKRGRIGAFRGAE
>gnl|bykdb|A0A3N4YN11 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Myceligenerans xiligouense] (length=527 residues).
MEPSNYIALLRKRWPWFVAFVVAGVMVFAVITFFTTPIYQARSQVFVSLRGSDNTAELVQGGNYTAKQVASYKELVSSPR
VLDPVIEELGLDESAASLAAKVQAEAPKDTVLINIVASGDVPTDAAKIADATALSLAGLVSEIEKPQSGGESPVELSVVR
EATVPSSPVLPNTRLNLLLGGLIGLVAGVGVVLLRERLDTRIRSHEDLRMVTDASVIGVVTFDDDAPAHPLIVEESPQSP
RAEALRRVRTNVQFLTLDTDRRILVMTSAIPGEGKSTTSINLAITMADAGSRVVLVDADLRRPSVSKYMGLEASIGLTTV
LIGRIDLADAIQTWGNKNLHVLPSGVVPPNPSELLGSTHMKELLTQLATEYDVVIVDTAPLLPVTDAALLARIAGGAVLV
VGAGVVHRPQLAEAVGALQTVEAPVHGIVLNRMPVAERASYKYRYYEYQPDPTERQPVGESGSGPGQKGIWPGPKPELPK
HRRGDDAPDPEPAASRPSMRDHEAPASAFSDERTFEQSGESTLEQKV
>gnl|bykdb|A0A3N4YTR5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Myceligenerans xiligouense] (length=453 residues).
MELADYVAALRKRWVVLVVAILAGGLAGLGYAQTVAPQYRATTSVFVGLERGDTVSELMQGATYTQNLVTSYASLATMPA
VLNPVIGELDLDTTPRDLSERVEAVVPLDTAIIEISAEADGPWQAAEVANSVARHLSETVSEVSPSNADGRSTVRLTVVA
AAEAPEFPFAPDTRLLTAGGAAAGLAAGALIAVGLALFDTRIRTAKDLPAGEDLAVLGTVPQIRKGTTDPQLLAESYRRI
RTNLQFLDVGAPVRSFVVTSSVPDEGKTTTAIGLAHALAERGSRVLLIDADLRRPSLADRLGLEGGAGLSTVLIGRADLE
DVVQQVGPPRFAVLTAGDLPPNPGRLIEAESMDQIVRQARANYDVVIFDVPPLLPVTDAALLARRTQGAVVVARARKVRR
AQLHDAIASLDAIGATCLGLIATGVSRKDHDFDTYAAYGDGDIGSFRSRWRRT
>gnl|bykdb|A0A3N4YXR7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Georgenia muralis] (length=492 residues).
MDLTDYLGVLRKRWSTIVLIALLTLGAAVALTLAAVPQYTATTRMFFAAEGGESISDLNQGSTFAERQMVSYAAVAASPM
VLDPVIEDLGLDVQAHELAEALTATILPNSVILDISATDEDPQLAADLADAVADELSAVAEDLSPERSDGTQPVQATIVT
EARVPTEPSAPNTVLNVALGLVFGVLLGTVTAVARELLDTKVRGAKDVTALTGVPVMATVQYETGSRSSPTFMVDDPHGS
RAEDVRRLRTNLRYVGLDHKLRSIVVTSSLPGEGKSTTSIALSLALADTGARVLLVDADLRRPSVAEYLGIEGAAGLTTV
LIGRAESADVVQRWRRTGLDVLPAGDVPPNPSELLGSRAMATLLVDLMAAYDIVVVDSPPLLPVTDAAVLGKLAGGTLVV
AGADKVHKAQLREALDALDQVGAHVLGVVLNKVGRRDANRYGYESYRSRGPGETPRRPESPAEVAAELGVTRRVTRDDAE
PGSPPAGTTLPV
>gnl|bykdb|A0A3N4Z5J3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Georgenia muralis] (length=503 residues).
MQFRDFLAILRSRWITIVLATLVVLGAATAATLSITPMYTASARVFFSAEAPSDDDGRTGGTYVITTSDLSTYLEVLNSP
MVMDPIREDLGLQGVPFRVSAEIPGGTPILRITAVAPNPDQAAAVANAVGPQLASVAGRFSVLLASSGQDVETTAITPAS
PPSSPSSPDITRNLALGLLTGLVIGVGLALVRHGLDTKVRRESDVRALSDRPVLAHVPYDKASREQPLVMENDPHGLHAE
SVRRLRTNLLFVDVTTRKHSFVVTSALPGEGKTTTTINLAMAMADAGARVLLVDADLRNPSVARTMGLEGAAGLTTILLG
RATVDDVVQQWRGTTLSVLPAGQVPPNPSELIASAAMESLFAELAQRHDFILIDSPPVVPVIDAVLLNRLTGGTLMVVAM
ERTTKKHLASALKSLATVDVKVAGFALNMVPTRGESSYYGYGRRAYGTPPETGPDPDTEVPRPGSATVPPVVAGRDDDGA
AGEGTQGTSRTRRSSSAAGARRR
>gnl|bykdb|A0A3N9W7A4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. LB39] (length=487 residues).
MDLLRQLRHVRRHWWVALVTVMVALGISAFLTVRAQPRYVASVTFFVTTPNSGVTDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQRRVSTSTETGTVLLRASVTDTDQTRALRVTETLANKFVELVQKVETTPEGKAPIKIEVVSGP
RVSANPVSPQPVRNLALGGVIGLILGVGLAILRGVADVRLRDAAGLQRATGSALLGEIPFEANARSAPLIVGDAANSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVKVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTTGASVPADRAASGRHSETITGVNGVADHTQ
ELTRLPR
>gnl|bykdb|A0A3N9XFS0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. LB32] (length=487 residues).
MDLLRQLRHVRRHWWVALVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNTGVSDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQRRVSTSTETGTVLLRASVTDTDQTRALRVTESLANKFVELVQKVETTPEGKAPIKIEVVSGP
RVSANPVSPQPARNLTLGGLVGLILGVGLAILRGVADVRLRDAAGLQRATGSPLLGEIPFEANARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVKVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASTAEASVPADRAASGRHSATADGVNGVPDHTQ
ELTRLPR
>gnl|bykdb|A0A3N9XL76 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora sp. LB19] (length=487 residues).
MDLLRHLRHVRRHWWVALVTVMVALGVSAFVTVRAQPRYVASVTFFVTTPNSGISEAYQGGLFLQQRVKSYADLLTSDRL
AQSVVADTPMGLTAEEVQRRVSTSTETGTVLLRASVTDTDQARAMRVTEVLAAKFVDLVQKIETTAEGKAPIKIEVVSGP
RVSASPVSPQPIRNLTLGGLFGLVLGIGLAILRGVADVRLRDSAGLQRVTGSPLLGEIPFEANARSAPLIVGDAATSARA
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGLDAGVGLTDVLV
GDVKVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLTLRESADIVIIDTAPLLAVTDGVVVAVQADGALLVTQ
QGRTSRTQVAAAARSLHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVATTAGASVPADRAASGRHSATADGVNGVPDHTQ
ELTRLPR
>gnl|bykdb|A0A3Q9CQB2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium acidipropionici] (length=515 residues).
MRPPCPCRLRPLVAIRCFQEAPHMTSEPSGWTLSRIWGALRKLWVVIVASMLIGGLVTFGVTSVMTPDYESTSTLAFSAG
RGSTSKELADGSTYTQTQMPTFAQLASSSAVLQPVIDDLGLGMSVNALKKQMVVTIPQNALVLEIQVSWTSAQESATVAN
AVAQSLTTVVRQVSPKPSAGQQSAVNVTLVDKAVAPDHPTSPDKVKDPILGGLAGFVIGVLIVLLWSLLDTRIPTVGALR
AMTGSPVLGSVSRTRSTARLWTVADPAGQTAEEFRRISSALTYATFGRQAHSIVVTSAGPGEGKSAVSANLALTLAGLGS
KVLLIDADLRRPRVAANFELVDVVGLTTVLMGRTSLQQAIQQHPGSDLDVLTAGALPPNPAEFLTSERMHALLEETVAGY
DFVIIDTPPVLSVADAGLLAPITDGALIVVDAKHTRQAALTSAMTGLEDAGGRITGMVLNRARIDRMGAARYGEYLAPAS
RHSRRTDAVAQDAAPASPDTPVQAARRGRRLSDRA
>gnl|bykdb|A0A3Q9UNX8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium jensenii] (length=555 residues).
MTLRDFLKLTRRRLGTILVCTLLGAVAAAGLLLVTPTTYSAQATAYVRVAMPQTSDGSNDSGSYAAAAQLASQKVKAFVS
VFTSQSVAESVIKELNLDTTPAELADRVSASNAANSLTIVVTATGDSPEQARKIADAVVTQSAAQVKSLEGANSPVQVVM
MAPAGLSEITTTPSPIKYLSIGVLAGLLIGYAIAFARQHFDTRIRTADDITDRFNDPVLAVLPQSKGIARTDADSNGDFQ
SAESMRKLRTNLRYANVDHQAKVILVTSPLQGDGKSSVAASLAKVMAVAGDDVILVDTDLRRPSVADTFALHGPLGLLQV
LVGSTKPESALRPTKIDGLSVLPTFDTPPNPSELLGSSRMAELIQELSSNHTVILDAPPVLPVTDAVVLSHLADSIVVVI
SCGRTRKEQLKQAVDSIERGDGKVSGIVLNRASSTKLSRLRYGDAEYGYEYSYSHEYAADHSRPDAGGASGSSGPAGHPH
RKSHHPAASPDERSDRNAAGQYTSEESSETRRIAVVTLAESEQWAHAGVEPGPDHQPTHEQMGRRRLWRDNPERP
>gnl|bykdb|A0A3Q9V497 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter iranicus] (length=485 residues).
MELRDVFRLLRDHWIPIIAAILLGTLVAFGWASLQSKQFVADSQGLVSVATGGGSDPSQEIYTQQMAQTVAKSSLATYVP
IATSRDVAQIVIDTLGLTVSPAALISSIQVVPDTVAPVLKVSATASTPEGAQRLADAWVGAIATKVKQVNQETGVGDSVT
LTVLQTAALPTSPAFPNTRLFLAVGALIGLVIGLIYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPTDKRLSETNRIVPE
ADTTDYVAADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPADGKSTVTANLAVTLAASGQRTVVVDGDLRKPTVA
KSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVTD
GAILTARTDGALVVITAGKTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSTRSGARPDAAVEP
APTSV
>gnl|bykdb|A0A3R8QM28 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium paraconglomeratum] (length=586 residues).
MELQQYLTILKERWSTAAIAAVIVLAVVSTLTLTRTPTYTATNRVFVQTEAGGSVSERSSGVNFASQQIITYADLAKTPI
VLDPVIEELGLDLTADQLADRISTRIPEDTLIIDITASSVDPQVASAIANATSESLRTQVSTLEAPTQEAAATGTTEDGF
EAVPSTVELTVISAAATPSSPASPNIPRDLALGVLLALLAGLAAAVVRDFLDNRVRRPADIEALYDLPVIGSIPSVHSSQ
NVALIAAQKPSSVQAEAYRELRTNLHFMLTADRMNTLLVTSSLSGEGKSSTAINLAQVLAQAGDRVLLVDADLRRPSLAT
ELGLERTVGLTTVLIGDVELDDVTQPLETAGLDVLTSGPIPPNPSELLGSEAMRSLLEAASEAYDYVVVDTAPLLAVTDA
VALSRFVDGSLVVAQSDRVKKQQLGEALAKMDSVDARVLGVVVNNAPRDVRDVYTYLPDEESSEPAVSVVPAEDRPAEAW
PEDARPSRSASSEHRHEEALEAEEATGDRPEALPAARAARPTAMHGGRPAAPRRRAVRRPEATRPDGTGPADAERSSGGT
HEADVPADGPTLTVSGGAGRQGARSA
>gnl|bykdb|A0A3S0SJN0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Verrucosispora sp. FIM060022] (length=485 residues).
MDLLRQLRLVRQHWWIVLVTVMVALGVTALITVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSAAADRQVGLTAEEIQRRVSTSTENGTVLLRASVTDTDQARALRVTEALSANFVELVQKVEAKPDGSAGPIKIEVVSG
PRVTPSPVSPQPVRNTVIGALLGLLAGVGLAVLRGMADVRLRDAAALRRVTGSPLLGEIPLDGSARVAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGHYLGVDSGVGLTDVL
VGDVHVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKTDAYQYEAYRVVTDTASTAAARSSAGRHAERRGPAEPVDHTQEL
TRLSR
>gnl|bykdb|A0A3S0TBD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. HSID17257] (length=468 residues).
MSLAQFLVVVRRRHWFLTLFVLLGVLAGTAVALTSTPLYRAEAQMFVSVDGGATASDLSQGGSFSESRVSSYAKLSTSPS
VLAAAARKARVADTVPELQGSVRTTTSADTVILSIAATQPDPERAAALANAVAEQTVKLVGDIEKTDALGESLVKLSIYQ
RAEAPTVPTSPRVVVDIVVGALLGLLVGIGTALLREAMDTKVRSADHLARVAEKSVLAEIPIADDITTVALANDGRHFSN
TAESYRQLRTHLTFTNLDGDCQVIVVTSSVPGEGKSSTAANLALMLAQNGQRTILVDADLRRPSIAGFLGIESSVGLSTV
LAHQVELDDALQSVGEAGLQVLASGQVPPNPSELLSSQQMQLVIQTLSASYDYVIIDAPPALPVTDPAVLGASATGVLFV
TSVDGRTTERDVAQALGTIDSVGARIIGVVANRTAAGRRPDSYYDYSTERPQSESPRRAARRAAVEPR
>gnl|bykdb|A0A3S0VQS9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Curtobacterium sp. HSID17257] (length=482 residues).
MELRDYITVLRKGWVLIVVLALVGVAAAAGFSLLKKPVYSASAQVFVSTETSGSASDLAQGNTFTQQRVLTYSNLVQTPI
VLLPVISSLGLDMNADQLATMVSATAPTSTTLISITVQGTDPVQATEIANATSQSLTNVVQDIEATDANGTSTVKLTRVK
QADVPLKPVSPNVPVNIALGLLVGLALGVGIAVLRETLDNRVRVETDVEKISDKPVVGGIAFDSKASERPLIVQVDPRSP
RAESFRTLRTNLQFLDLGTGSRTFVMTSSMQSEGKSTTVANLAIALDSAGFKVILIDADLRRPRVGEYMEVDSAVGLTDV
LIGRATLEDVAQPWGRGNLVVLPAGQIPPNPSELLGSKAMQDLITTLEQQFDYVLFDAPPLLPVTDAAILSKKASGAILA
VASGKTHKGQLAAAVASLENVGAPIAGFVITMMPVKGPGAYGYGRYGYGYGYGLDEAEPPQPTTKAPKKARGKLGTLRRA
DR
>gnl|bykdb|A0A3S1BFT1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HSID17245] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGLLAARSTDQSLIAGNGPAESRAQAYVALINSQAVR
ERVAQDTGQDDDDSLSAALVPGSSMIKVTATSTDPETAAQLANSALQATADVAAEVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAADLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHELFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLQLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLMGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKARTRS
>gnl|bykdb|A0A3S3M2W8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agrococcus lahaulensis] (length=466 residues).
MELSDYIRIIRKYWVLLVAATLVGLGAGAIVSLMQTPIYSSSTQVFVSVQTGDTTAELQQGNTYTLSRVQTYANLVDSQR
VLDGVIESLSLDETFSSLESRISATSVPETTIIEISATSDDPAESAALADASAASLAETVTAIEARPDQTSPVQLAVVER
ATAPSSPISPRTPVNIALGALVGLALAMGFALLREVLDTRIRSERDVRGVTDAPILGAIAFDPKAKQRPLIVHADPLSPR
SESFRTLRTNLQFIEVDDDSRSLVVTSATPGEGKSTTTANLAIALADSGQTVILVDADLRKPKVAEYMNLDGGVGLTDVL
IGRAELVDAVQQWGTKSLYILPAGQIPPNPSELLGSKAMTTLLKELQSEFDWVLFDAPPLLPVTDAAVLSKHVESVVIVA
SAGKATKHQLETAVHLLETVDSELSGVVLTMVPTRGAESYGYGHYGYAERKLKQKRATRFALPKSR
>gnl|bykdb|A0A3S4AKV9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Labedella sp. 11W25H-1] (length=469 residues).
MTIHDYIAAIRKQWIVIALLTVLGAGAGFAYAQTMPDMYRSTASAYASTVSGETTNELVQGSTFVQGIVQSYATVAKSPY
VLEPVIEDLGLDMSVKDLAKAITADTPLNTVIVEISATSGDPEQARRLAQAVVRSLADAVADTGISPRGSDGKPMVQLTV
ISPAATPVAPFSPDTKMIAALAGGIGLLLGLAWAVVRELVDTRIRSQKDIELVTDSPVLAEIGRGPRDRSIAQVIRTNPN
GATAEAFRGLTMSLAFADVDKPVSAVVVTSAMPAEGKSSVSVGLALTLAESMGRVLLIDADLRKPSVADYTGLDGSVGLT
NVLLGSSTIADAVQPWGAPGLDVLTAGTIPPNPNQLLASDTMRATLAELKKQYDFVVIDTSPLIPVTDPLWLVHETDGAI
VVARNKKTKRPQLSKAMATLGSVGARTLGVVANDVKGHERLTYYTESEKSPSRPSRDAIVSAATGQDDA
>gnl|bykdb|A0A3S4BC26 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Labedella sp. 11W25H-1] (length=472 residues).
MELRDYIRILRKSWILITVLTLLGIAAAAAYSLLQTPQYSATSKVFVSTQSGGTVSDLAQGNTFTTQRVQTYADLVSTPA
VLLPVIAELGLSADAGVLGRSISSSAPESTSLIEITVVDPDPVLASDIANSASESLTNVVDTLERPLEEGAVSPVKLTLV
QQAAVPNSPVSPNVPVNIVLGFLVGLALGVGLAVLRDILDTRIRTERDIKGITEAAIVGGIAFDPKATARPLIVQDDPRS
PRAESFRSLRTNLQFLGAGQRHHSFVVTSSIESEGKSTTAANLSIALAAAGSRVVLVDADLRRPKVADYMGIEGAVGLTD
VLIGRAELQDVLQPWGRSSVTVLPAGRIPPNPSELLGSPAMEALVEELNREFDHVIFDAPPLLPVTDSAILGKLVGGALV
VVAAGRTTKHQLEGAVTTLEHVGAPVSGIILTMLPTSGPDAYGYGRYGYGYGYGVDDDENALTEPTRSAARP
>gnl|bykdb|A0A3S4VIP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium aurum] (length=483 residues).
MVATFVAVLGAVAVTLLTTPLYQASTRLFVSTTTGSSLAETYQGNRFSQERVVSYAELLTGQTIAQRTIDKLQLDMSAGE
LQERVRATVKRDTVLINVDVLDASPIKARDIANTMSDEFVVMVRELETPDDGTLPDSRVVVEQRASIPSSPVVPRPARNI
AIGFALGIVLGVGLALLRDLLDNTVKTTEQLETITKTGLVGTIPLDKERRKQASIAFDKETTGIAEAFRKLRTNLQFLAV
DNPPRVILVTSSMPSEGKSTTAINTALSLAETEKTVVLVDGDLRRPSLHRYLDLVGTVGFSTVLSGAVSLDDALQQTRFP
GLTVLTSGAIPPNPSELLGSQSARKLLNELRAKYDYVIVDSTPLLAITDAAILAAGADGVLIMARYGHTKREHLSHAVGS
LESVGAPLLGAVFTMTPTRGSGAYSYSYGYYGEYTAKSSSPRELEAPQTPISKATSEEPMTKFGSIGTHSSGKRRRRQAP
TEP
>gnl|bykdb|A0A3S5K1S4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HSID17227] (length=463 residues).
MNIIDFLRVLRANRLVILGCAALGLAAGLVYSLLQPTLYTATSTAFVTVEGEASISGTETAQTRAQSYIPLINSRTVRER
IAAEGLDTAGATMSAALVPNSNLITVSAVAPDAQQAAALANGALVATADVANELDPTSNVKVTAMEDALVPATPSSPDRV
RHLLYGLGAGLVLGLIVALLRRLLDVNVRTTTDAQVAGGAGLLGAIPLDPSMKAERTAPMAPLSPRASEAVRQLRTNLRF
AAVDDPPRTIAFTSSNPGEGKSTVIGNLALTVAAAGQPVILIDADLRRPRQALQFGVDGRVGLSEVLNGDVALQDVLIPV
GEDGLLLLPAGRTPPNPSEQLGSERMKDLLTALAETHMVLVDAPPVLPVTDSTLLAAAVDGTVLVIRHGKTRKEHLEVAR
DMLAGVNARVLGVVLNGTPASGVGSDYYGGGYGADGGSYDVYYQAPRDAAEAAAGTAGDASPR
>gnl|bykdb|A0A3S8SNK3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brevibacterium aurantiacum] (length=550 residues).
MSIIDFMRIVRKNIVLLIVMIAAGGLGGVGVYLLLPDEYTSQTELFVSTVEAANPDQKQIASAFVQERLRTYVDLADSRL
VLEPVIRDLDLKISPERLAEYVSASSDHGTVLLTVSATATTPGGAARVSEAVADSLTTTITDLESRHGKAQSGIRLAVAN
DASVPSTASGPARWLCAAIGIFLGAALGIAIALFRSAVDSKIRDITGIREVTAAPILASVPVRNESSAHPEPTASYQDSP
YAEAIRRLRANLRFARVEDANNVIEVTSSVPSEGKTSTSVNLAISLAQSGQRVVLVDVDLRQPAVADRLGLENSAGLTTA
LLGTADVHDLLQPWGQDELYVLTAGDKVSNPVELIDSRSMSTLMTVLRNDFDTVILDCPPVLPVADGLLLAKIAGRIIHV
IAVNETSRNELEEALNDLSVVDTPLSLVVNKVPLGHSDLTGYTKTYSARQSAASLPPASGRGTTSREEEPPHTDVREPVG
WLPGELGAEQSTRTPRVWPGSRTRRRAQRTGGTGRLTARSDSAVREADQPASGTGDSPRRIGAGERTAEQ
>gnl|bykdb|A0A3S8Z6W5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Flaviflexus salsibiostraticola] (length=464 residues).
MELQQYLKIIRDYWRSILATLFVVVAAVAGYTIMQDPTYRADATVFITVESGDTAGELSQGANYAERQVQSFVQVVSTAS
VLQPVIDELDLDATPASLSRSISASSPNATSLIEIAASGENSAEVTDLANAVAASLVATVDDLAPTSSDGLNLVSASVID
PATVPTTPTAPKPMTNLALAVILGLLLAFGQALLREVLDTRVRDAGDIQEVTDKPILATVGHISKNMTPSERRAHSEAYR
RLRTNVTFVGLGGERKKSLVITSSLPDEGKTQTAVSLASVLAQAGETVLLIDADLRRPSVANRLQIDNELGLSDILTKRG
TLADLAIPAATNLWVLPSGTVPPNPSELLGSGAMKQLLSHAEREFDYVVLDTPPVLPVTDAVVVASQAGGAIVVSRAGVT
KRSQIQSTIDVLESGLASTLGLVLNDAELKSREERYGYYSGYTQGDANTENVAARHKGSVRQRS
>gnl|bykdb|A0A3S9JFD4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium acidipropionici] (length=530 residues).
MTLREFFRLTRRHLGTIAAFTVLGAIVAAGLLMVLPARYTSQASAYVRVSVPKSASGTADSNAYFNASQLASEKVKAFVP
LFTSETVAQAVITQLGLSTTPAELASGLSASNAANSLTIDVTATGDSSEQSKKIADAVVNQSASQVRRLEGATSPVQVVM
LSPASLSQTTKSPSPIKYLAAGVLAGLLLGYAFALARHHFDTRLRTADDITERFTTPILAVLPQSKAIARTQAASEGDFH
AGEALRKLRTNLRYANVDHQARVILITSPQQNDGKSSVAANLAKVIAMAGDDVVIIDADLRRPSVADTYGIRGPLGLLQV
LVGSARVENVLRPSRIAGLSILPTFDTPPNPSELLGSDRMAELVKYLSRDRTVILDAPPVLPVTDAVVLAHLADAVVMVA
SAGRTRAEQLDHALGAIERGEGDVAGVVLNRAASSKLARLRYGDSEYSYASGSESEYVRADRPTPSSDRGTETPVPDSEE
LSATRRMSAISASDSEPNPHANDHAGSREPVHQTRTTSRRLKRAQPDELD
>gnl|bykdb|A0A3S9PWP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Flaviflexus sp. H23T48] (length=466 residues).
MELQQYLKVFRDYWRSILATLFVVVMAAAGYTLMQAPTYTATATVFVTVESGDSAGELSQGASYAERQVQSFVQVVETAA
VLDPVIDEFSLDTTSRSLAGQISASSPNATSLIDITANGGNATETADLANAVAASLVVTVDDLAPTSSNGQGLVSASVID
PATVPNTPSAPKPTTNIALGIILGLLIGLGQALLRSVLDTRVRNSDDIESVTDKPILATVGHISKNQDASEKRAHSEAYR
RLRTNISFMGLGGERSTSFVISSSVPGEGKTQTSVSLARVLAQAGETVLLIDADLRRPQVANRMQLDSELGLTDVLTRRG
TLADLAIPASTNLWVLPAGTIPPNPSELLGSEAMAKLLNLVEREFDYVIIDTPPVIPVTDAVILASQTGGIVLVTRSGIT
RRAQFGESIEILDAGNATVLGVVLNDVNLRSKSDRYGYYSEYTTEESPEALSARPSSQPKHQDIGV
>gnl|bykdb|A0A3S9W679 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium lemovicicum] (length=467 residues).
MTLHEYIASLRRSWWIILLLAAIGAGAGFGYATVQPKVYRAQADVVIIPARGASTSELVQGSNYVQNLVQTYALVATSPT
VLEPVVDRLGLDSTPRALATSVSVQAPLNTQVLEIGVTSRDADTAAAVANAIGSQLAVAVRDLSPQFDDAQPAVRIETIT
PATPPNAPISPNVRLLTLLGGLAGLVAGVVYALLRRLLATRLSSHVDIAAVSDIAVLGDVYTTGSSRSLPGVIRTDATSA
VAESVRSFVAGLRFANVDGAKKVLLFTSSHSGDGKSSMSIATALILAEQGNSVLLIDADLRRASIATLSQLEGSVGLTSI
LLGETTMDVAVQPLGNDGAQVLTSGVLPPNPGQILTSELLRGVIAEAREQYDFVIVDTPPVLAVSDPLWLAPLVDGIVIV
VRSRVTKRDALRRTLLALESSPTPVLGLVLNDVRRTQSSAYYEDQAGRSARLKRKDPTSVRENVSRR
>gnl|bykdb|A0A3S9WH06 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oxydans] (length=450 residues).
MGESRVSLRVIASSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLIGVLDTRMRNEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A3S9X0U7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium oxydans] (length=450 residues).
MGESRVSLRVIASSLRKFWWMVVLFGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDAKAAAELADAVAEQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGAVLGLAIAALIGVLDTRMRTEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPSEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTVPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A3T0DDC5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brevibacterium aurantiacum] (length=488 residues).
MLLRGHHLASLIFSRMERTKTMGLSHQAARIARFWRSALLIFLLSLGVSAGLTSLQTPVYTAASTMYITVGAGESAGELS
DGASYAEDQVSSYMRLALTEEVLAPVLERLDLNLTPAELAEQLVVSSPDATTMIEVSANSEDPKEAMRLSHEVAVSLIDT
ILDLSPKEARKSGIVNATLVTDATLPLYPSSPRPVVNLAVAAAIGLFLGLAQGLARSYFDTRVRGVEDLESLSTVPILGE
VRRLDAGRARGSVRARNEWAYRESIRKLRTNFGFVDLGGSRRRSTVITSALSGEGKTSVAVNLAWSLTAAGHSVLLIDAD
LRQPQIASRLSVDSELGLCEILMNRGKLSDFVVRMYPHRLNVLAAGSLPPNPAELLGSVAWSHLLSEAERSYDYVLVDSP
PLLPVSDAVIMAARAGGAILVARSGKVRVPQFKSALQALQNASVTPLGFVLNAVKPSGAREYAYYMEPVRRQQGRRRLRR
SGGSRADG
>gnl|bykdb|A0A3T0SSY7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter rathayi] (length=488 residues).
MELRDVLRLLRDHWIPIVAAILLGTVVAFGWSLTQKPRYVADSQGLVSVATGGGGSDDSQAIYTQQIAQTVAKSNLATYV
PIATSRDVAQIAIDSLGLDVSPAALISAITVQPDTVAPVMKVSATASTPEGAQKLADAWVSAIATKVQQVNQETGVGDTV
TLTVLQTAALPSAPAFPNLRLVLAVGALVGLVLGLVYAFVRNTLDRRIRTAEMVERLFDLPVVGTLPVDKRLSETNRIVP
EADTTDYVKADGKHALAESLRELRTNLQFMNIDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGDLRKPTV
AKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWVLGAGSIPPNPSELLGSNGMDILLHEIAREAIVIVDAPPLLPVT
DGAILTARTDGALVVISAGKTTTDELGKAIQNLERVSGHTLGVILNRVPARGQVGRGYGYYYTSYYGSERSGARPDTAVE
AEPAPTSA
>gnl|bykdb|A0A3T0T1X6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rathayibacter festucae DSM 15932] (length=496 residues).
MKELDTVELRDVLRLLRDHWIAIVAAVLLGTLVAYGWSLTQKPRYAAEAQGLVSAAVADAGGDPSQAIYLRQIADSVAKS
STLTYVPIAKSRNVAEIVIGNLGLDVTAESLITAVQVTPDPESPILNVRATASTPEGARTLADAWIDAIAVRIQQVNQES
GAGDTVSLSGVQSAALPSSPEFPNVRLVLGVGALAGLVLGLVYAFVRNTLDRRIRTAEVVERLFDLPVVGTLPVDKRLNE
TNRIVPEADTTDYVKSDGKHALAEALRELRTNLQFMNVDSPPRIIVVTSPLPSDGKSTVTANLAVTLAASGQRTVVVDGD
LRKPTVAKSFGLVPGVGLTDLLIGKAELQDVLQPWGPSGNLWILGAGSIPPNPSELLGSNGMDMLLHEIAREAIVLVDAP
PLLPVTDGAILTARTDGALVVISAGRTTTDELGKAIQNLERVSGHTLGVILNRVPPRGQVGRGYGYYYTSYYGSQKSGAR
PDAAAAPAPAPAPSAV
>gnl|bykdb|A0A401UV75 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas sp. TKZ-21] (length=523 residues).
MELQDYLRVLRKRWVSIVAITALCALGAVGASLAMTPVYQATTQLYVSVQGGASTSDLLQGANFTRQQVTSYAQLVNSPS
VLGPVIDDMGLDVRAESLAGRVQADSPLNTSLINVTVTDENPAVAAATADAIAGQFKDVIGELETPADGGPSAVKVSVVR
EATAPTDPSSPNLKLNLALGLLVGLALGVGIAVLREVLDTRVRTEDDIARVTETSVIGTIPYDEDAPKHPLIVQSSPHSH
RAEAFRRVRTNLQFLDVADRPRSIVITSSLPGEGKSTTSINVAITLADAGTRVVLVDADLRRPAVARYMGLEGGVGLTTA
LIGRADVTDVIQPWGNGNLHVLPAGQVPPNPSELLGSQAMAQLLATLTSRYDVVLLDTAPLLPVTDAAILAKLTGGALLV
AGSDKLHRNQLAESLSSLETVGARVLGIVLNRQRRKAGEQYTYYDYSPTPAVDGRARNGRRRKARSGPSAPATTPTPATT
TGAVPVSTNTGSIWPGDALSESRLRGAAPTQPQPQHQRGGPRA
>gnl|bykdb|A0A401Y7Z0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides sp. LS1] (length=489 residues).
MVLLMELRDHLRMLVLHWMGVLVITALVVGGASAYTFTRTKVYAADANGFVSTGGNSNAALGSINDELAKSRATSYVDIA
KSRATAQQVIDDLHLDADPASLVGQISVEQPLDTVLIKITAQDSTPVGAQKLADAWVDALATQVQEIEDPRNTQRAGVPR
VISIESAELPSTPVSPKPARNLALALLLGLLLGYGYALLRHNLDRRLRTAKAVEDRFNVPVMGSVPMAGVLGRNPGERAL
LAVEGLEGGGAERQREASEAFRKLRTNLIFMNVDSPPKVIVVTSPQPGDGKSTVAANLAAAVAVSGQPVVLVDGDLRRPT
VAGSFQADEEIGLTDVLVGRLSVADALQPSGVTDNLKVLAAGRIPPNPSELLGSKAMRALLEQLAEHAMVIVDAPPLLPV
TDAAILTAAADGALVVISAGRTVDAELTQALGHLSAVNGRALGIIMNKSSRRSTGGYYYYEASYYGEDSSSRRRKRGWRA
KGRKAKALA
>gnl|bykdb|A0A410YJ27 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Salinibacterium sp. UTAS2018] (length=463 residues).
MELRDYIRILRKSWLLIVVLMLVGVASSATFSILQTPKYSASSKVFVSTASDGGSVSDLQQGNSFTVQRVKTYSQLAITP
IVLQPVIDSLNLDTEVDALAANVSVSAVLDSAVLEVSVVDADPANAAEIANGIAESLTTVVQLIETPETEGAVSPVKLTT
VQIAEAPSAPVSPRVPLNIALGFLVGLALGVGIAVLREVLDTRVRNERDLELISDAPIIGGIAYDPKAAERPLIVQSDPR
SPRAESFRTLRTNLSFIDFGERDRAFVITSSVASEGKSTTAANLAISLSDSGVRVLLVDADLRRPKVGEYMGLEGAVGLT
DVLIGKADLKDVMQPWGRNKLFVLPAGRIPPNPSELLGSIAMAKLIEVFNREFDYVIFDAPPLLPVTDAAILAKRVGGAI
LVIAAGKTHKGQVQGAVAALANVDAPISGLVLTMLPTKGPDAYGYGHYGHSYGYGYEIDEAKK
>gnl|bykdb|A0A412K6M4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=501 residues).
MAAAESTAPQNGQVVVEPTETEDNGITLMDLFRIVRKHIVVGIITFVVVFAAVCAYTFLVPPKYSATSQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVAGLAGQLTVTNPTNTAFVNITAQSGDAKQSSDIANA
VAESLSNVVEKSLYASGKESPVKLSIVQRASVPVSPSSPKVALYLAVGLVGGLILGVFATLIRDLMATRVEEASDLQDII
NAPIMGRIPTDESLQSNKPIIVSSPAGRVSEEFRRIRTNLSFTSTVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVADRLGLEGGAGLAHVLSGQATVKDVVQRYWKPNLHIMPAGPKPPNASMLLNSKTMTEMLDMALQT
YDYVIVDTSPMVVANDAAVFGAKSDGVVLVSGRDVTMKRDLKDIAVQLENLNVPVVGFVFNFEKERKVSNNDNYYYYYYY
DEDGKKSHKAHKSRSKAKRKK
>gnl|bykdb|A0A413KCG4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudocatenulatum] (length=491 residues).
MRGSVTSAENTNVQQVAVEDGSEDGITLMDLMRIIRKHLVTAAIVFVMVFAGVTAYTFLVPPKYTATAQAMATYNASQGD
DAGISQQYTGGTYIAGQITSYTTLATTETVLEPVIKDLGLDTSVKSLAGQLTVTNPTNTAFVNISVEDGDAQQASDIANA
VAASMQNVIQNDLYSAADKSPVKISIVQRARVPESPSSPNKPLYLAVGVVAGLVLGVFAALLKDMLNTKVEETSDVRSLV
GASSLGSVPQDNSLGEKRPVLISQPNGPIAEEFRRIHTNIEFLQTDKVAGKGQLLVITSAQPSEGKTTTSINVAAALAED
GARVLLIDADLRHPSVAHHLGLEGSAGLAHVLSGQMSPKDVVQNYWKPNLHILPAGKRPANAGVLLGSDTMRIMVEQALT
QYDYVIIDTAPLSVSNDGVVFGRWAKGLVLVTGRGVCEKKELKEVSESLHVAKVPVLGFIFNYADLKKTHSNSNYYYYYY
EDAPRKKSHKK
>gnl|bykdb|A0A413RMG9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas sp. NEAU-TCZ24] (length=565 residues).
MRAVELDEYLLALRKRWLVIGVLGIIGGLLGYGYAQSITPAFKATANVFVSVNQGDTAGDLVQGSTFVQNSIASFGKLAS
MPVVLDPVIADLDLDVSAKALGRQVSADNPLNTFILAISTTDANPQLAADVSNAVALQLTKTVQDLSPRTAKGASAIDLT
VVAPAATPKVPFKPNTKFLTATGLALGLAAGVAFALLLTVLDKRVRTTGDLERISDVPLLGSITRSRSSSLAYTTLLNAP
TTPRAEGFRRLQANLQYLETGASLNSIVVTSAVPAEGKTSTTLNLALAVAEKGGSVLVIDADLRRPAIGSSAGIESAVGL
TTVLIGHASLEDVVQTWGNDNLHLLPSGALPPNPSQLLDSPAMHSLLDEAVKLYDLVVIDCPPVLPVIDAPVLGRHADGV
LMVVALRRTRKHQLRSALASLDTVGASVLGVVATNVVDKGMDGTYGYSYQPVKKKRWSRRRKSTGAPHHVAQPPTAPAEK
VEHVADTRADEQPQAPVAETVDTTSAAAETIDEVSRPTSVDGDDDTDDDGADDAGPDDDGAHDLDPDLTTASSSSKDVPA
PRAST
>gnl|bykdb|A0A414FCG0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILNDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|A0A414V4B5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSEFLATYRSSAAASGASSNASELSSG
ANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAESVTASNPDGTMLVDISVNDPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTAVIDAPVLGS
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDT
APMQVANDAAVFAKEGPELLLVTGLGVTEKKLLRQTGHELSTLSIDPVGLAMNYGEAEKPQKGGYYYYGDESDDNGKKRQ
IQHKKSEKTKKD
>gnl|bykdb|A0A415AYL8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=494 residues).
MTSVENANVQQPTALQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNG
VDINQQSAGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSV
AESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRSIVRA
SSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYYYYYEDG
APRSSHRAKGKKRH
>gnl|bykdb|A0A415BXP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=495 residues).
MTSVENANVQQPTAPQGVVEEADDGITLMDLLKIIRKHLVTAIIAFVVVVAGVSAYTFLAPPKYTATAQAMATYNASQDG
ESISQQSTGGTYISNQITSYPTLAATEKVLKPVINELGLDETVDDLAGQITVTNPTNTAFVNIAAVDGDPKQAADIANAV
AESLKTVIENDLYTGDTSPVKVSIVQKAQTPLTKSSPKTVLYLAVGVVLGLIVGVFAALIKDLLNTRVEEPSDVRGVVRA
SSLGSVPVDDSLESKRPVLVSRPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGA
KVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLNSETMKLMVEQALTQY
DYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEASDTLATAQVPVLGFIFNRADPKKVNSHSNYYYYYEDG
APRGSHRANGKKKRI
>gnl|bykdb|A0A417XT21 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioides immobilis] (length=471 residues).
MDFKQFLQVLRRHWLGVVLMFLLSVGAASGISLAQTPTYESTAKVFLSVNTRNATDASAVSYFLTTRAQSYASLAKSAEL
AERVIEVLDLDMTPAQLSSRISTEVVEETSLITITVSDEDPYDAQKIADVVTNELQVYTEELETVGGGGEPQVAVHITDP
PEYNGTPVSPNWAINLLAGGLIGLLIGLALAVSRELLDRTVRTADHIAEVTDAPVLVSIGFDSDIRQAPLLTDLSGFAAR
TEAFRLLRTNLQFIDIDHHARVLVVTSAVPGEGKTMTSTNLAVALAQTGRTVLIIDADLRRPRVAAMLGVDPAIGLTTAL
VGKTDIEDAIQVHDPSGLHVLASGAKPPNPTEILQSRVTRDLILRLRQSYDMIIIDAPPLLPVADASVLTTIADGAVLVV
RHGQTTRDQVAEALNRLSQIGGKVYGIVVNMVAKRSIGSYYYYYYEETAPADSASRRKEKASPQAKGSRRL
>gnl|bykdb|A0A417Z5F8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Dermacoccus abyssi] (length=538 residues).
MSLDDLWRIARRYWAILVAMSLAGVAIAWLFLLTQPERYTATTTAYVTAGATNGGNSQADKQAQAAMAYSNSMLAKQKAQ
AWLPVFKTTPVMESVINKLKLDTSPAALASTVSTTMDEEAPVITVSATASTPVQARDAANEIVKATADQVTKLEGSGAGA
EIRLVSNAELPGSPSYPNPSRILPIGLIAGLALGMLFALAQARRDTRVRSEEDIERASGTSVLAAIPDSKGLASDGREAE
REDFRTREALRQLRTNLRFVDPDNPPRAIVVTSSRMGEGKSSIASNLARVLAESGERVLLIDADLRRPMVSAILDIEPEV
GLSQLIAGSVEASDVIIPTTHRNMFAVPAGQIPPNPSELLGSRTMKRIIEELRQEYFVILDAPPLLPVTDAALLLPSTDG
ALLVVDSMSTRKEHVEQAVRNILAVNGHVLGAVMNRAKSDKNGRYGYSKYGYGGAYTYQAYTADTSGGKGNRKVSRERTT
SEAALPADTIQREGHSARDVAAQLPGRDRSRDDVPMTRGIRRARAESAARSDTLNNGE
>gnl|bykdb|A0A418N1I2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Jishengella sp. AZ1-13] (length=483 residues).
MDLLRQLRLVRQHWWIVLVTLMVALGVTALVTVRAQPRYVASVTFFVTTPSQGVSDAYQGGLFLQQRVKSYAELLTSDRL
AQSMVSERQLGLTADEVQRRVSTSTETGTVLLRASVTDTDQARALRITEALAANFVELVQKVETRPDGSAGPIKIEVVSG
PGVSPTPVSPQPVRNTVIGALLGLLAGVGLAILRGMADVRLRDAAGLQRVTGSPLLGEIPLDPSARVAPLIVGEAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMSCNLAIALAEAGWRVLLVDADLRRPKVGDYLGIDSGVGLTDVL
VGDVHVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRTQVAAAARALHSVSVRLLGCVLNMARVPKTEAYQYEAYRVVAGTASTDGIPAGRHAERDAAADKVDHTQELTR
LSR
>gnl|bykdb|A0A420F753 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora globbae] (length=484 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVSDAYQGGLFLQQRVRSYADLLTSDRL
AQSVVAENPVGLTADEVQRRVSTSTESGTVLLKASVTDTDQTRALKVTETLSAQFVDLVQKVETPPEGKAPIKIEVVSGP
RVSSSPVSPQPVRNLLLGGIIGLVVGVGLAILRGVADVRLRDAAGLQRATGSPLLGEIPYESGAKSAPLIIGDAATSSRA
EAIRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGIDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALMVSQ
QGRTSRTQVAAAARSLHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVAATELPAVPSDRASAARHAEGGAGVSDLTQELT
RLPR
>gnl|bykdb|A0A420X5L5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. OV430] (length=466 residues).
MTLAEYLLALRRHWIVIAALTVICGIGAFGYAQTLPEQYRSVASVMVIPERGDNASELVQGSSYVQNIVQSYAVLAASPA
VLQPVVEDLRLSTSASQLANQVSINTPLNTVVIEIAVVDGDPEMAQKIAAGAAESLSDRVAELSPQGSDGTPAVRIETIA
PARLPTYPIAPNVRLYTALGLGAGLVLGLAYAILRRVVDSRIRESSDVTGLSDVPVVGEIPILKRDSTLPGTALLNPSGH
MAEALRTLSVNLTFVSLDSPLNVIVVTSSTTGEGKSSVTLGLAVALSESGKRVIVIDADLRRPAIGSLTELEEAVGLTNL
LLGDGSLATTVQSWTGDGLDVLTSGSLPPNPGQLMASSQLEAVIAEARAAYDVVIIDSAPVLTVSDALWLTKQADGVLVV
ARSGMTRRRQLQRALAALESTKTGATGIVLNAVRGDPRSPYYVHENPAPEPYSGTSNEVASTSSPV
>gnl|bykdb|A0A420ZV92 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. M321 24_2] (length=478 residues).
MELRDYITVMRKGWVLIVILALAGVAVAAAFSVLKKPDYSASAQVFVSTQSSGTVADLAQGSTFTQQRVKTYADLVKTPI
VLLPVASSLHLKMTSDDLSTLVTADAPLDTSLISITVTSTDPVEAANIANATSQSLTNVVQQIESTGATKEPQVKLTRVT
EAEVPNAPVSPNVPLNTALGLLVGLAAGIGLAVLRHALDTRVRNEQDVEQIDSAPIVGGIAFDPKAAQRPLIVHADPRSP
RAESFRTLRTNLQYLDLEGRARSFVVTSSIQSEGKSTTTANLAIALDTAGSRVLVVDADLRRPKLADYLGLEGAVGLTDV
LIGRAQLKDVVQRWGRNSLYVLPAGHIPPNPSELLGSHTMASLIETLEKQFDYVLFDAPPLLPVTDAAILARKASGAIVV
VAAGQTHKSQLSGAVSALHNVGATVSGFVMTMMPTSGPDAYGYGRYGYASGYGYTQDTPAKKTKPKSRRRAPAGAAAR
>gnl|bykdb|A0A420ZVG0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Leifsonia sp. M321 24_2] (length=513 residues).
MNSRQYGQAFRRFWYVVVIATVAGALLGFGLSQLATKSYTATSGLYFSLNFGGSANDLSQGSTYTQNQMLSFAQLAESPV
VLKPVVDQLDLAITPSQLADAISVSTPQNTVILELAVTDTSARQAADIANAVAASLSSTVEQIAPKTAQGTATVSVRVIE
HASVPKFASSPNTRLNVLSGLLLGLIVGALIVVLRATFDTRVHNAETATEVAKAPLVGSIQRERSKDGVPVLVAAPLSNA
AEAYRQLRSNLEFVTLGSPTRSFVITSSIPSEGKSLISSNLALALSETGQRVLLIDADLRRPAIAGYTGLPGNAGLTSVL
AGRAQFEDVVQRWGAGDLDVLAAGPIPPNPSELLSSRAMSDLLERLRARYDVIVIDTAPLGAVADASILARQVDGALVVV
DRTRVRKQQLAQTVDSLQKSGASVLGIVLNRVAAGKERNAYYVAEQPQRRIGLPGRRVSGSSGETQGPDGKPPKTPKAPK
APKDTAPRDEDTPEEPVADDTGSTPTAHSHSAT
>gnl|bykdb|A0A423UFR1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium mongoliense] (length=473 residues).
MTIADLLHVLRKHVVTVVTAFVVVFLAVAAFTFLSPPKYTATAELFATYSGQSDGTQNSNEMNSGASYLSTQIKTYPQLI
KTQAILQPVIDDLSLNMSVKDLADTVTATNPTNTFMVDIAVETGDAQQSAQIANSVSKNLAKQISSSLYSNDAGKSPIQL
SVVQEAQTPTAPSSPKIPLYLTAGFVLALIVAVGAALLRDVLNTRVDSLEDAKTLTDASSLGTIPRSSRMEERKPVVVAE
PSSHEAEQIRRIRTNISFLSPNTNGHGHLVVITSTEPLEGKTTVSVNVASAIAEEGKSVLLIDGDLRHPSVARALGLEGH
VGLSHILSGQASPREIVQQYWKPNFHILPAGKRPGNASILLNSVIMTELIDQALTQYDYVILDTAPLSVANDAAIFGKQA
DGVVLVVGKGVADKKELHATVESLHTSEVPVLGFILNFADPKRINASNYYYYEEDGKSHGKARRSARGRDKRH
>gnl|bykdb|A0A430F4X9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2020B] (length=492 residues).
MAENIIEQQAPGAVAAKPESDGMTLSGLFGIIRKHVITIIVTFAVVLGAAIGMTMMSPVKYSTTSQLFATYNDASDGTAN
SSEQNNGSSYIMSQIKSYPALTTTQSVLQPVIEDLGLQMSVGQLKGEISVTNPANTAFVNITVTDGDPARAADIANAVAK
SLSSVVENTLYASGSRSSVKLSIVQPATAPSSPSSPKWKLNILIGIVGGLILGVFAALLKDVLSKRVQDDDEVGEYLDAP
IIGRIPEEELLKGTKPAVVSEPGSPVAEDFRRVRTNLTFMAPVDGTNCRLIVVTSTGASEGKTTMSVNVAAALAENGAKV
LLIDADLRHPSVAKKLDLDGSAGLTHVLSGQASVKDVVQRYWKPNLHVMPAGPKPPNASTLLNSPIMEELLNNAMEQYDY
VLIDTAPMVVANDAVIFVRRGGSLIMVCRRDQTLKRDLRDISEELTTLDLSTTGIVFNCARDSKKSLEHTNYYYYYSSRS
TDHRKKRRFSLK
>gnl|bykdb|A0A430FBN0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2028B] (length=479 residues).
MTILGLFKAIKRHIIPAVIVFAVVAAGMGVYAFTRVPMYSATATVFASYKSDAGAGGDAMSQRYSATSYIDTQLKSYPNL
VKTEAILQPVIDELGLHVTVDELAANVEATQPDETYMVDITATDPDAQQAAKIANAVAKSLKDQVSTTLYSSDSSVTSPI
NLSIVQSAQVPKWPSSAGKKNLIAAGAALGIIMGALWAIILDFLDKKIRQASDLQEIMDVPILGSLTRNDVYAGKAPVII
SRPASREAEEVRRLRMNLTYVMPDNGEHPNLIVITSAGVSEGKTTTAVNLAAAYAEAGKKILLIDADLRNPSVAKALSMN
GAVGLSQLLTYQVKSTDAIQQYWKENFHVLPAGKRAPNPGILFNSKAMKSLLDQVSGLYDYVIIDTAPLKVANDAAVFVK
EGATMLFVSGLGHGEKNDVRAAVEELETLDVTVAGAVLNFSEEEKPDDNYYYYYGDSEDGKSRRNKRKSSQKKRKNTQK
>gnl|bykdb|A0A430FEG8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2028B] (length=470 residues).
MTVSDLLRALKRHWLLEIILFVVVVGGMAGYTFTVTPMYTTQAQLMAKNSDGAMTTGAASGTASPLTGYAQLVQSDAVLE
PVVDNLGLHTTVTNLRNNVSAYVSDGSAFVNMTVTYTDPNDSVAILNELVKQLNKQITSDGSSGIQLSIIQKPVVPSAPS
SPNVKGNMVIGVVAALIVAAAGAVIREMSDNSVRTKADIQAIITAPILSSVPKSPTLAGRTPAVIVKPRGHAAEEFRRLA
TNLSFVRDNRGTRSNVLVVTSAMPGEGKTTISVNLAAAFAEKGESVLLIDADVRHPSVAKGLGVSNGVGLIQMLTNQVDA
QTAVQKYWKPELQVLPVEDNEAAASVILSSSVMENMIDQAAKHYDHVIIDTAPIQVSNDASLFARNGATLLLVVSQTVGS
KKVLRDVARELKVSRAKISGVAFNRVAHEHSRKGNYYYYEESEKQAKSGTKDVKAKSDGKRSARTTSSNK
>gnl|bykdb|A0A430FFY5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2034B] (length=492 residues).
MEETQQVRDDGVTIIDLLNAVRKHVITAVVTLVIVLAAALAYTFLQTPQYTATSELVATYRASANMTTNSGGDLSSGANY
LSSQIRTYPQLVKTEAVLQPVINDLGLNTTVKDLAATVTATNPTNTMLVDISVENSDPKAASNIANSVANSLKKQVTSTL
YNDAGDKLTSPINLTVVQQAYAPVSPSSPKIGLNIAIGIVGGIILGIFAALIKDLLDTRVRQESDITAIINAPVLGTLSR
NEVYEDVAPVIITRPASRDAEDVRRLRTNLTFVLPKDKPKGNVIVVTSAGPSEGKTTTSVNLAAAFAEQGSKLLLIDADV
RNPSVSKKLGIEGSIGLTHLITSAVSSHDAIQRYWKPNFHVLPAGKQNMNPGILLNSQTMKAFIDQVAAAYDYVIIDTAP
MQVANDAAVFAKEGPQLLVVAGLGKAEKKQLKETEKELETLGIKTAGLSVNFAEVDKMHKSGYYYYYGEEEDKKNSKRQM
RHRKDGEGSDAE
>gnl|bykdb|A0A430FR71 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2033B] (length=492 residues).
MTVADILEALKKHLIVELVVLLAALAGGFLYVNQQTPQYTATAQMFASFNRNPTEAGTETDLGTPSYSEIQSQSSYVTSQ
LGTLPTLATTPAVLQPVIDELKLDTTVSALAGSIGISTSSTYFVNITATNTDPQTAADIANAVGRSLKEQLSSDSYSSER
TYVLSYLNLSVIREASVPGSPSSPNVKSFMFKMLLIGVVAAVFAGLVAEMLDQRLRQMADLQRIAQSPTLGIIGKDKAFQ
EGAPVVVSAPSSRAAESVRRLALNLSFLAPDRTDRSNVIVIASSGPSEGKTTIATNLAAAMAENGERVLLVDTDLRKPST
AKTLDIDGKVGLTHLLAGKVTFADAVQRYWKENFHILPAGEQTTNPSILINSRAMQEFLEHAAAHYDHVIIDTTPMRVAN
DAAVFAKDGARLLLVASQGVTFKRQLRDAVQEFRMIGVEPVGTVFNQEQAKKAKNGYYYYYYYGEGKRRRSGRGSHSGSA
RAASAVRSGEDR
>gnl|bykdb|A0A430FRP4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2036B] (length=493 residues).
MEQVREILSSENLDGNQGASMSAMDIFRIIGKHIITMIISFIVVFGISCVYLVTSKPVYSATSQTYATYGDASIAPDNYT
SLSTASSYISTQIKSFPSLIKTTLVLDPAAQKLGIPTSMLNSVTAVNPDGTSFINITATSNSAQQAADIANTVAESFQTV
VQTSLYMHEQQSPIKITMVQPASAPSKPTSPKSAMVLAIGVIGGLVVGVLAALIKHLFSREIQDETELSDYISAPVLGRI
PETDDIAGNTSVIINAPSSPEAEEYRRICMNLSFIAPVSGTNSRLIVVSAVGANEGKTTTAVNIATALAENGAKVLLIDA
DLRHPSVAKKLDIDGSAGLAHVLSDQASVRDVVQPYWKPNLHVMPAGPKPPNAGQLLNSPLMTELIAQALHQYDYVIVDT
TPMVVASDAALFAKQGGGLVLVSRRGLTLKKQLAETAQLVKNLNVEVTGFVFNCIKDDSRKSLYGSSYYYYGGSNARGKQ
HHDDQPKHGSTKR
>gnl|bykdb|A0A430FVU4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium sp. 2033B] (length=490 residues).
MGLENTGSVDNDVITIDVLGALKKHVVTAVITFVVVVAGVCAYTFTRTPMYTASAQLFATYRNTAADSSNANSYNAGASY
ISSQIATYPDLVKTEAVLQPVIDDLGLDTSVGALSRQVSASNPTDTMMLKVSVSDADPEMAAKIANAAAASLRDQITGSL
YSEGGSELISPVNLAIVQKAGTPGSPSSPNVKMNLAVGLAGGLVLGVIAAVLKDLLDRRVRTVADVQAIVDETPILGTLT
QGEVFTEKAPVMVGHASSREAEDLRRLRTNLTFMENGEGLSNVIVVTSSSPSEGKTTTSANLAVAFAENGAKVLLIDADV
RNPSIAKSLDVENSVGLTHLVSGEVSSRDAIQKYWKSNLHVLTSGQQTLNPSVLLNSMAMKALIHQVADNYDHVIIDTAP
MQVSNDAAVFAKEGAQLLMVAGLGVVEKRRLTTTMDELETLDIEPVGMVLNFAEQEKAKDSYYYYYYGEKDGKRQGRRHK
KKGSKTGSQA
>gnl|bykdb|A0A433BLH6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium sp] (length=462 residues).
MNLQNILRILRTRWIPVVAAVVVALLGTVIITATTTPLYKSSTRLFVSTYAGTSLTDAYQGNLFSQERINSYTVLLTGEV
LAQRTVDALHLDMSPQALRKEVTARSKAGTVLIDVDVLDPSPVRARDIANTLSNEFVAMVKELETSGDGNLPDTRVVVEQ
PASVSSSPAVPKLVRNLVLGLVAGLFLGVALAVVLDVIDSTVKKREDLEGITGVSVVGEIPVDKPRRTAPAITFNNDNSR
IAESFRKLRTNLSFLAVDNPPRVIVITSSIPNEGKSTTAINIALALAEAENKVLVVDGDMRRPMVHQYLKLDGAVGLSTV
LSGAVSLPDALQETQFEGLTVLAAGTIPPNPSELLASQAAKKLLAELRGQFDYVIVDSCPLLAVTDATLLAANADGALLL
ARYGKTRRDQLAHASDALENVGATLLGTVFSMTPPRNRSPYADSYYYYYHGKSRSVGRHGQA
>gnl|bykdb|A0A433IPI0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. HSID17227] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGFLAARAADQSLITSNLPAESRAQAYVALINSEAVR
ERVAQDTGQDGDGSLSAVLVPESSMIKVTATSTDPETAAQLANSALQATADVAADVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHELFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKARTRS
>gnl|bykdb|A0A433JWV9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Labedella endophytica] (length=484 residues).
MHGATGPSTGRLTRGGLMNIHDYIGAIRKNWIVITALTLLGAGAGYGYAQTMPDMYRSTAQAYASTVTGETTGELVQGSS
LVQGLVQSYATMATTDYVLGPVIDDLDLDTSVKDLASAVSVDTPLNTVVIEISVVSGDASEAQEIASAVTRRLAEAVAEI
STRGVETDSPVELTIISPATAPVAPFSPDTRMIVAIGAAIGLLLGLAWGVLRELIDTRIRTQKDIELVTDSPILAEIGRG
PRDRSLAQIISTNPNGATAESFRSLCMSLAFADVDKPVSAVVVTSAMPGEGKSSVSVGLALALAESMGRVLLVDADLRKP
SVADYTGLDGTVGLTSVLLGGSTIEEAVQPWGTRGLDVLTAGTVPPNPNQLLASDTMRATLAELKKRYDFVVIDTSPLIP
VTDPLWLVHETDGAIVVARSKKTKRPQLSKAMATLGSVGARVLGVVTNDVTGHERLTYYTESEKAPTRRVADPRVAASSR
PDDV
>gnl|bykdb|A0A443JMZ6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium enclense] (length=550 residues).
MDMQRVARILRAYWKTILALTLAGGLAGLGWSALQPRIYTADASGYVASVSTDGSTGSALAGDSLALSKVKSFIDMGYWR
AVAETARDQLGLSDSPESLVQRVRVSNPVDTVNVRVEATGSTPEAARDLAQAWLQGMTVQAEQLETTGGGQAAVRLVAGD
SARLPTAPTSPNVRLAVAVGALVGALAGVVFALVRRTFDRRVRSAQDISDATDASVVGILPVDKALAAGRAVFSFDDIRD
GRGSFAHKEAMRELRTNLQYVDVDRPARVIVVTSPLPGDGKSTTAANLAVSIAATGQSAILIDADLRRPVLGATFGFSDD
VGLSDVLAGRARIEQVAHQVDEHGRLFVVAAGRTPPNPSEMVGSQRMQQLARVLADEMVVVIDSPPTLAVADAAIIASWA
DGAVLVVTAGRTTDDMLRRAVGNIAKTRGRLLGVVLNRVPLRGADSNYYGSQYGGYYGYGVESGRSDRSSWWRRWRRPSE
DAAQEGEDAPGPRRRSAEPLPANVRGLRTLPPLQNSSSAPGESTDEGAGAVVAPVATTEGDARPRRRQRG
>gnl|bykdb|A0A444BN88 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Phycicoccus sp. CMS6Z-2] (length=502 residues).
MTLLDAVRVARRFWVSIAVCLLVGIGAGAGYAALQPRLYTASSEAYVQIEGGGRSVSEVSVGNNVASAKAAAYAPLTRSG
MVADRVVDELGLDVSPAAVAGSISYATEPDSPRIQVFATSTSPQRAKDVADAVVGATAEVASLVENGDTRGDTVVRLIPV
TSAVLPTSPVSPNVLLLLATGAAAGAVAAYLLVMARLRLDTRIRRPEDVTSLTDHGIIGTIPRSRDLRQRLHSQALLSGA
VGEALRHLRTNLVFADPDHAPRSVVVTSPQPGEGKSTVSALLARSLALRGEKVVLVDGDLRRPMVATLFDVSSGVGVTQV
LSGSVPLREAIVSTDTPNLFVLPAGRIPHNPSEVVGSDRMRQLLDHLSKSYVVVIDAPPTLPVTDALILSQRVDGVLVVT
LMGKTRKEQLKRTLELAAGVNARVLGVALNGIPQGRSAGVYGYETYGYETGGGASARDQKWSLRGRRGAKPVTREPEPVG
DPDDVSLDLDPFAADDADARVR
>gnl|bykdb|A0A444Q6M2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Labedella sp. 8H24J-4-2] (length=467 residues).
MTIHDYITAIRKQWIVMVMLTVLGAGAGYGVAQTMPDMYRSTASTYASTVNGETTSELVQGSTYVQNLVQSYAAMATSPY
VLEPVIEDLDLEMSVKDLARSISADTPLNTVIVDISVASGDPQQARAIASAVTRSLAEAVADISPRGVEDAPTVQLTIIS
PASTPATPFSPDTKMIAGLGAGVGLLLGLAWAVTRELVDTRIRSPKDIEMVTDSPLLAEVGRGPRDRSLAQVIRTNPNGA
TAESFRGLCMSLAFADVDKPVSAVVVTSAMPGEGKSSVSVGLALSLAESMGRVILIDADLRKPSIAEYTGLDGSVGLTSV
LLGGSTIADAVQPWGAPGLDVLTAGTIPPNPNQLLASDTMRATLAELKKRYDFVVIDTSPLIPVTDPLWLVHETDGAIVV
SRNKKTKRPQLSKAMATLGSVGARVLGVVANDVKGHDRLTYYTESEKAPSRSAREGRVPAATAADDA
>gnl|bykdb|A0A444QGJ0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Labedella sp. 8H24J-4-2] (length=471 residues).
MELRDYIRILRKSWILITVMTLLGIAAAAAYSLLQTPQYSATSKVFVSTQSGGTVSDLAQGNTFTTQRVQTYADLVATPA
VLLPVIAELGLDVEAGGLGRTLTSSAPQNTSLIEITAVNSDPVLAAEIANGASESLTSVVDNLERPLEEGAVSPVKLTLV
QQAAVPNTPVSPNVPVNLVLGLLVGLALGVGFAVLRDVLDTRIRTERDVKSVTEAAIVGGIAFDPKATSRPLIVQDDPRS
PRAESFRSLRTNLQFLGAGQRHHSFVVTSSIESEGKSTTAANLAIALAAAGSRVVLVDADLRRPKVADYMGIEGAVGITD
VLIGRAELQDVLQPWGRSTVTVLPAGRIPPNPSELLGSPAMEALVEELNREFDHVIFDAPPLLPVTDSAILGKLVGGALV
VVAAGRTTKHQLEGAVTTLEHVGAPVSGIILTMLPTSGPDAYGYGRYGYGYGYGVEDENALAEPTRSAARP
>gnl|bykdb|A0A448NYH5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium jensenii] (length=534 residues).
MTMRDYARVLRAHWAGVLGIFLLGLAIAAGVTVLQPKEYTATTSGIVTATSDSSDTGMSLAGSSLAQSKVKSYVDMGSWR
TVAEYAIGKLKLHDSPEALVGRVTVTNPVNTTILQVSAKAPTPYAARDLAQAWLQGLVRQVAQVETSGGGKASVKVIAGD
SARLPGSPSSPSWNVNLLVGAAVGLIVGAAYALIRDRSDQRIRSTTDVQRVTGQAVVGALPVEASIAKNPRLLPVDGSND
EELTILAEAFRSLRTNLQYMSVDDPPRSIVVTSPAPGDGKSFTAANLAVALSATGQDVILIDGDLRRPRIADLFGIVGDV
GLSDVLAGRASYDDVVQSISGTTTLHVLASGAIPPNPSEILGSAKLRDLIKILSRRSMVIVDAPPLLAVTDAAILSTRTD
GTLVVVRTGSTTREMLGLAMGALAAVKGKVLGIILNRVPTKGSGKIYYGYRYTGEYYRDENGAKHRKHHTSAHREARTHT
PSAPVAGGPLGTAQSDGDVEQEANVVTTEMPIVTDPRSEPVGSGSARVPRRLKG
>gnl|bykdb|A0A448R4J3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kocuria rosea] (length=566 residues).
MTTPSFETEETMDRTEPAHKPPSFDGTDLLRLLRTYWRGITLITLAAAMVVVGVSLLQPKVYSTTASGLVVATGEQDLAS
ALAGDSLARSKATSYESLATSRPVAETVIAVLDLDTTPEALLERISTDVPNNTVEIQITAEAPEPAQAAELANAWVIALA
QQVNELESSVDAEDTSSRVTVQPLSNASLPLSPSSPNLQRDLVLGALGGLLLGALYAFVRYRMDRRIRSIEEVRDELGVT
VLGVIPQDDRLADGRAIVDVRGSNGHHYDEFVEAVRTLRTNLNFVSVDDRPRKIVITSPTPGTGKSSVAAHLAMSLASTG
QNVVLVDSDLRRPVLTKLFGLVPGPGVTDLLVGDADVDEFLQTYDPYPSLRVLGAGSFAPNPAEVLSSRAMQRLLDHLAE
DAIVLIDAPPLLPVTDAALVTTSSDGAIIVATARGTTKDEFAESLESLHNVHGKVLGAVLNRVPTAGADASYYGYYGYHG
KGYSSPEGGSGKVGSESSEAIGDNEVPQEPVDDLVRAPVQRQNNERATVTDSASARERAPVHGEETVELDAWEASGWRTK
PPSTRP
>gnl|bykdb|A0A454U3A0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus sp. RIT608] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGLLAARNADQSLIAGNGPAESRAQAYVALINSQAVR
ERVAQDTGQDDDDSLSAALVPGSSMIKVTATSTDPETAARLANSALQATADVAAEVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEAAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFKVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYAYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKARTRS
>gnl|bykdb|A0JZX7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter sp.] (length=529 residues).
MSVNIAAGAEAPAGLDLADYLRVVRVYWKAIVAFTLLATLTAFGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAK
AKVKNYESVAKSRLVADRVIASLELKTTADALLGTISVKVPLDTAEIRVTAQSPDPATAQRVADAWVNGLAAQVEAIETA
TPGTATPDAGTSPDAATAPAATASAVRILPLGKAVLPTSPVSPNVKLTLALGALIGLALGVAYALVRRHLDRRIRNATEI
ERLFDVPVIGTLPVDHRLDEKSTILDAGAAAQLHDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSMQAEGKSTVTAN
LAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGVGVTDVLTGTAELEDVLQPWGALPNLSVLGSGRIPPNPSELLGSKAM
KNMLNALAENAIVLIDAPPLLPVTDAAVLSRVADGAIVVIRTGRTTQEQLGQSLGNLEKVKGRILGAVLNYVPTKGTDAY
SYYGTYTSAPETQDLPELAHPDAVAHEPQWDTEHDDVLEPAAAGRRARA
>gnl|bykdb|A1A356 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis] (length=498 residues).
MAAAESTASQNGQVVVEPTETEDNGITLMDLFRIVRKHIVVGIITFVVVFAAVCAYTFLVPPKYSATSQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLVTTESVLKPVIDDLGLDTTVAGLAGQLTVTNPTNTAFVNITAQSGDAKQSSDIANA
VAESLSNVVEKSLYASGKESPVKLSIVQRASVPLSPSSPKVALYLAVGLVGGLILGVFATLIRDLMATRVEEANDLQDII
NAPIMGRIPTDDSLKGIKPIIISSPAGRISEEFRRIRTNLSFTSKVEGSNARMIVITSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVADRLGLEGGAGLAHVLSGQATVKDVVQRYWKPNLHIMPAGPKPPNASMLLNSKTMTEMLDMALQT
YDYVIVDTSPMVVANDAAVFGAKSDGVVLVSGRDVTMKRDLKDIAVQLENLNVPVVGFVFNFEKERKTSNNDNYYYYDEG
GKTSHKAPKSRSEAKRKK
>gnl|bykdb|A1RC29 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Paenarthrobacter aurescens] (length=560 residues).
MSGNDLLSVVRSHWLGILLITVLMVGGSLGWYVLQPKVYAAESSGIVVTAGAENLGMSLAGDSLAKSKAKGYQSVGESIL
VAESVIKTLALQQSASDITRSISVSVPLDSVEIRITARSSDPQTAQNVADAWVAALAAQVYELDKENASPGTEPVTKIVP
LAKATLPSAPISPLLTATLGIGLAAGLLIGLGYALARNHFDRRIRASGEIERLFGLAVVGTLPLDKRLSQKSSVLENTSG
IHRVPGGHAMAEALRELRTNLTFIDVDNPPRILLITSSLPSEGKSTVTSNLAATIAAAGNDVIVIDADLRRPTVHQVFGV
LPDVGVTDVLSGRASIDDVLQEWGPNPRLRILTAGRIPPNPSELLGSRAMEHLLKDLSQRAIVLIDAPPLLPVTDAAVLS
RVADGTLVVARARKTTRDTLYRALGNLTRVRGRVLGVILNCVATNGPGDLNYGYYGAYGSADDAQAPSPRSLGTSRMSGP
GPAQPALGGQGFEASSTWPDPVESAEVTSQATLSGLDGTLTADHASSLIESPDASAFLDPVSQWRSPADGARGRRSAPPR
>gnl|bykdb|A1UBH0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp.] (length=497 residues).
MNLREFVRLLRARWMAVCVTTLITFLGAVAVTMLTTPLYQSSTRLFVSTTSGSTLADTYQGNRFSQERVISYAELLMGET
LAQRTIDKLGLDMTAQALQENVKAGAKPDTVLIDVAVLDQSPVRARDIANTLSDEFVAMVRELETPEDGSSPDARVVVEQ
RASIANKPVIPKTARNIVFGLGLGLLLGVGLAVLRDTLDNTVKDRQALEDVTGAGVVGNIPLSKDRRKQAAIGFESDNSG
IAEAFRKLRTNLQFLAVDNPPRVIVLTSSVPHEGKSTTAINIALALAEAEHNVVLVDGDMRRPMLHKYLGLVGPVGFSTV
LSGGASLSEALQNTRFPGLTVLTSGAIPPNPSELLGSQSARRLLNELRAQFDYVIVDSTPLLAVTDAAILAAGADGVLIM
ARFGHTTHEQLTHAVGSLESVGAALLGAVFTMIPTRNNASYSYGYYGYGEEATGQQARHGLPTETRVEKSSPSSATSAQG
DSEVAEPAGTRQTRETD
>gnl|bykdb|A4TF38 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium gilvum] (length=508 residues).
MNLQDFVKLLRSRWMTVCVTMVFAVMGAIAYTLLITPQYQASTRLFVSTSSSSSVSEIYQGNRFSQERVVSYAELLMGET
LAQRTIDKLGLDMSASSLRENISASAKPDTVLIDVAVRDPSPVRARDIANTLSDEFVAMVRELETPDGGATPDARVVVEQ
RATIPEHPVVPNTTRNIAMGLALGVLLGVAIAVVRDLLDNTVKDRETLEGITGAGIVGSVPLDKERRKQAAVAFDRDNSG
IAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPSEGKSTTAINIALALAEGEHSVVLVDGDMRRPSLHKYLGLVGPVGFSTV
LSGGTSLSEALQKTRFPGLTVLTSGAVPPNPSELLGSQSARKLLSELRAEFDYVIVDSTPLLAVTDAAILGAGADGVLVM
ARFGQTKRDQLAHAVGSLVDVGAPLLGAVFTMVPTRGSSSYSYSYSYYGSESAPQQARQDVPVAPTKPAALDAAPSQTGA
EPPDPDSSLPRADATPGASRRRRRQVSE
>gnl|bykdb|A5CNW1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. michiganensis] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSSNVQDLQQGNNFITQAVKSYADVVTTRA
VLQPVIDQFGLDVSSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGESLKTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGNKSKAPIEKIKA
>gnl|bykdb|A5CP66 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. michiganensis] (length=462 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVISRLGLDQTPQELARAVTVTTPQNTVIMEISVTEPSPAQAADIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPEFQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAEAVAHLTTAPLLGALERERGVTGLAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASSRMEDLVGLAKATYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAEAEQTGRAARAARKAHAAG
>gnl|bykdb|A7A7K6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis L2-32] (length=487 residues).
MQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTATAQTMATYNASQNGVDINQQSA
GGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAADIANSVAESLKNVI
ESDLYSGDKSPVKLSIVQKAQVPMSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDVRSIVRASSLGSVPM
DASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVALAEDGAKVLLIDAD
LRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLSSETMKLMVEQALTQYDYVIIDTA
PLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAVDTLATAQVPVLGFIFNRADPKKVNSHSNYYYYHEDGASRSSHRA
NGKKKRI
>gnl|bykdb|B0RG57 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. sepedonicus] (length=470 residues).
MLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSSNVQDLQQGNNFITQAVKSYADVVTTRAVLQPVIDQ
YGLDVTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGESLKTVVGTLVPETIEGTPQVQITQLEQAEIPESP
SSPNLPVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSPRAESFRSL
RTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDILIGRAEIE
DVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIIVVAAGRTHR
TQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYGYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|B0RH06 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. sepedonicus] (length=454 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDVTPQELARAVTVTTPQNTVIMEISVTEPSPSDAAQIANAVATSLRDTAEAYAPKGAEGSTTVSVRVIQ
EAPEPQSQSAPNSRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTSAPLLGSLERERGVTGLAMALRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLALSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASNRMEELVTRAKADYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKARPTKDKRAYYRAEAGQAGQAVTR
>gnl|bykdb|B6XVL3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium catenulatum DSM 16992 = JCM 1194 = LMG 11043] (length=533 residues).
MPSFLGTGHTIILSLGLQENTRSPLPILVGGNGKIAYEMAERFLASGVERSLQCENEREHMTISDVLRAIKKHWIVEIVL
FCVVVGVVAGTTFAATPIYTASTEILTQYDSASSSESSTTTNQQQYANGSSLASLYPDLVQSDEILQSVIDNLGLHTTPT
ALRSNVSAATNDSSPIVYIYATDSNPAQTVRIVKELVKQLKKQVSAMAGPDINVSFATIQAPVEPRVASSPNVQANLAIG
IVAGLIIAMLGAVLREMFDKGVNDVSDVQTVVRDPVLASVPKAHTVSNGVPAVITKPRGRAAEEVRRLTTNISFVTPKDL
KQQNVIIVTSTNPREGKTTVSVNMAAAFAEKGKSVLLIDADVRHPSVAKALGMNSGVGLVSLLAGEVSAKEAIQPYWKSY
LQVLPAEEQKTPSGIILGSDAMRQLVDQAAERYDYVIVDTAPMTVANDAAVFAEKGGVLLLVVGQGVAQKKALREVVKEF
RMSKTAIRGVVLNMVSVNNAGRSSYYYHEDHEDAGSSSKRKSKSGISRSKSKH
>gnl|bykdb|B7GUK0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. infantis] (length=472 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQVSSDLYNNSSSSDSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGAVPQAAILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSCNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELRSTATALQTAEVPILGFIFNFADPKKMHSKNYYYYYYEDGNKRRSHKGAKSKG
>gnl|bykdb|B8DWQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium animalis subsp. lactis] (length=498 residues).
MLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATY
NSSNDSANSSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAFVNIAVTDADPSTAA
RIANGVAASLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKQSSPKWSLNILVGVLGGLIIGILAALLKDVLSKKIQDESD
VTDIVDAPIIGRVVKDDILAGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLVVVTSAGASEGKTTISVNIAAA
LAEDGPRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKPPNASTLLNSPLMTTLVA
NAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCRRDQTLKRDLHEIADELETLDMPVTGVIINCAKENKKALENSNY
YYYSNSSPAEKNRKNRKS
>gnl|bykdb|B8HEG4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudarthrobacter chlorophenolicus] (length=484 residues).
MRATRKASILELSDYLRILRRNWMILVACTILGLLVAAAASLAIKPTYTAQTRLFVAIQSTGTAADLQQGNNFSQSRVQS
YVETVGTPIVLQPVIDSLGLTVSPAELSKNIQASADLKTVLVSITASDSSPVQAAAIAQATANSLVDVINTLEGATEGKP
SPVKLSVVTPASAPPLPSAPNTRLNIAMGLILGLIVGLVTTALRALMDTRVRGESDIRRVTQAPILGGISFDSDAKRKPL
LTQVLAHSPRAESFRQIRTNLQFAHVSHESKAILITSSLPGEGKTTTATNLAIALAQAGQSVVLVDADLRRPRVDDYLGL
DRNAGLTTALIGAAPLGDLVQRWGDDDLFVLTSGQIPPNPSELLGSASMKELIRSLEDTFDAVIIDAPPLLPVTDAAVLS
QQVGGVVLVVGSSRVKSSDLQKSIAALEMVDADVLGVVMNLLPNKGPDAYAYTYYAYEDTGGRKTSYASPERSAMRFPSS
VENE
>gnl|bykdb|B8HEH1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Pseudarthrobacter chlorophenolicus] (length=521 residues).
MSTPAAPAEASDGLDLRDNLQVLRTYWKGIVSLTLLATMAAMGWTILQPKVYASHSIGIVVTPGSDNVSLALADDSLAKA
KVKNYESVAKSRLVADRVIAALQLNTTADALLGSISVKVPLDTAEIRVTAESTDPATAQRVADAWVNGLAARVEAIETAP
PAEAGSDAASDAGTPAGATATAVRVLPLGKAVLPASPTSPNTKLNLALGALVGLALGVAYAVIRRYLDRRIRDAAEIEQL
FGVPVIGTLPVDHRLDARSTVLDAGMSANAHGGGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQSEGKSTVTANLAV
TMAAAGEKVVVVDGDLRRPTLVDVFNLVPGAGVTDVLAGTAELEDGLQPWSALPNLSVLGSGRIPPNPSELLGSRAMKNM
LTALAQNATVLIDAPPLLPVTDAAVLSPVADGAIVVIRTGKTTQDQLAQSLGNLDKVKGRVLGAVLNYVPTRGAGSYSYY
GTYTAAPDDAAGTSTPPLVAFQDEATDGTLEAALSGRRARV
>gnl|bykdb|B9TTI4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=456 residues).
MVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAGELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKG
LAASVTASNPDGTMLVDISVNNPDPKQASSIANSVAENLRKQVTSTIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKL
NLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTAVIDAPVLGSLSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFV
LPDEPLSNVIVVTSTGPSEGKTTLSTNLATAFAENGSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRY
WKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDTAPMQVANDAAVFAKDGPELLLVAGLGVTEKKLLKQT
GRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDESDDNGRKRQIQHKKSEKTKKD
>gnl|bykdb|C0BRP2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudocatenulatum DSM 20438 = JCM 1200 = LMG 10505] (length=506 residues).
MSRGNMAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYS
DSSVQDNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVNITAETGDAKQAS
DIANSVAESLSNVVEKSLYASGKESPVKLSVVQRAAEPISPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASD
LQDIINAPIMGRIPTDESLQSNKPIIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAA
LAENGAKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLD
AALQTYDYVIIDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYY
YYYYYDEDGKKSKHAHKNSRKKSKHN
>gnl|bykdb|C2GUY9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum ATCC 55813] (length=479 residues).
MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSNGSPI
KLTVVQKAQTPTSQSSPNIPLYLAVGLIFGIIVGVGVALLRDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVIV
AQPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVISSTNPSEGKTTVSANVAVALAEEGKSVLFIDADLRHPSVAHKLGI
EGHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVERALTQYDYVIIDTAPLSVASEATVFG
RMAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGKKKARK
>gnl|bykdb|C4FFN7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium angulatum DSM 20098 = JCM 7096] (length=532 residues).
MIETVRQERSVAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDLIRIVGKHMFTAILVFVLVVVGVTAYT
LTAQKKYTATAQLFASYNNTTADALDSSVSSQSTAGAYIATQLKSYPDLVKTEAVLQPVINELNDNSITTDDLATMVTAT
NPTDTYMLNVSVEATSPEQSAQLANEVSQSLSKVVSSELYASSKKSMVKLSVVQKAKTPTSQSSPNTKLNIAVAVVAGIV
LGIFAALVRDLLARKLQDLMDLQSIDPNGSIAGIIPKDEVLNVTKPVIVTKPDSPIAEEFRRMRTNLSFVTSKDGDKGRL
IVITSSMPSEGKTTVSCNLAAALAENGASVLLIDADLRHPSVAKRLGLEGGVGLAHVLSNQASVKDVVQRYWKPNLHIMP
AGPRIQNASVLLNSRIMHELVHQAVQQYDYVIIDTTPMSVANDAAVFGQMGNGVVMISARGVTYKSALRGAVNELRDLDV
PLLGYVFNLADEKRNRGYGNYYYYGSYYYKGEYGKEDSKKDRKRRRSHRRGK
>gnl|bykdb|C4FH22 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium angulatum DSM 20098 = JCM 7096] (length=492 residues).
MAEENENQESGQGISDGSRPSGITFADIVVIIRKHIATAAICFAVIVGVAGAYAFLAAPQYSATAQVIATYNAAQDGGNS
DDITQQNTGGTYVSNQIKSYPTLATTETVLKPVISQLGLDVSVKDLSNQLTVSNPSNTAFVNITATAGDAKQSATIANAV
ADSLRTIVEHDLYAKGAAAPIKLTVVQRAATPQEPSAPNKKLCIAAGVVLGLIVGIIAALLKDLLRTKVEEASDVRGIVH
ASALGSIPKNEALEGTRPVIITEPNGSVTEEYRRIRTNIKFLEVNKTPGYGQLLVISSTSPSEGKTTTAVNTAAVLAENG
AKVLLIDADLRHPSVAHHLGIEGNVGLAHVLSGQMAPVDVVQNYWKPNLHILPAGKRPANASLLLNSDMMKMLVDQALLQ
YDYVIIDTAPLTVSNDAIVFGSWTSGIILVTARGLCRKKNLEEVADSLRTAKVPVLGFVFNFANPKKSHNEAYYYYYEDG
AKRSAARRGRKH
>gnl|bykdb|C5C078 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Beutenbergia cavernae] (length=477 residues).
MEPVEYLDALRKRWYVIALLAALFGAFGFYQATTSVPLYRSSSSVYVTLSAAENVGELVQGTTYTQNLIQSYALLARTPA
VLDLVIDDLGLETTPRLLAGSVTADIPLNSYVIEITSVSDDAEEAAAISNSVAANLATTVARLSPQTAEGAQAVRLETVT
PATPPGYPFSPNTRLTVATWFAIGAAVGLVLALARAVLDTRLRRADDIARVTDTPVLGTIPRIRRGARGPMVVSDEPLST
GAEAYRKLRTNLQFLDAGQHVKSIVVTSSMAREGKSTTALNLALALAETNERVLLIDADLRRPSVAAQTGIVDAVGLTTV
LIGQATMDEVIQSFGVPNLDVLASGEAPPNPSQLIDSEAMVEVLADARARYDYVVIDAPPSLPVADPAIMARHADGALVV
VNSRATTRHQLQQSLSNLAAVDAVALGVVVVGVGHSDGLGYYGPATTRRGFLPERLVRPQREPEAVGHPAGHAAGVP
>gnl|bykdb|C5C9H1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus] (length=524 residues).
MDQPSTKDQPSANEHSRFTPRDVLRAVRDHWVLLASCTLVGILLAALWTLTQPQTYQSQASAVVTAGVNENLGIALTADN
LAKSKATQYQELAKSRSVAEGAVERAGLDISPDAALGSLTVAVPPDTAEVRLSVVQDSPETAQALADAWVASLAQEVSNI
ENQQMPGVADADEVTAQSVIKVLPLVEATKPSTPHSPNGRLALALGALSGLVLGLALTALRAVNDRRIKSSAALEDDFGL
TVLGTIPVMSRKSAKGKKGRDKQGSKADRSGRATLRDGLRGADASDATVTFHFAEAFKELRTNLQFIRPDNPPRIIVITS
ALPAEGKSTVAANTAITLAESGIPTVLVDADLRRPTVAGSFHVEGSVGLTNTVIGNAEVWDVLQPVPDVGDLKVLASGPV
PPNPSEILASARLESVLRSIAEDHVVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGQTTRDELAKALGNLAKVNGPVLGA
VLNRVPTTGPEASYYGFYGKSYYAYTSTTTAEPTDAESSPTARA
>gnl|bykdb|C5E898 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. infantis CCUG 52486] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTAISELLATYRSSAAASGASSNAGELSSG
ANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAASVTASNPDGTMLVDISVNNPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTAVIDAPVLGS
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAENGSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDT
APMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGRELGTLSIDPVGLAMNYGETEKPQKGGYYYYGDESDDNGRKRQ
IQHKKSEKMKKD
>gnl|bykdb|C7MGH5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Brachybacterium faecium] (length=453 residues).
MSEQKTSMRSLLAAIRKFWWLVAVLALAGGAASFAYAAAQTPLYQATSSLHFALDQGASAVDLNQGSAYTQSQMLSYAQL
VEGSRVLEPVIDELGLDTTPRELARSIQVTIPQDTVTLKITATTEGPESSAELATSISEHLIDEVQEIAPRNPEGGSTIT
VVVYDGAVAPEHQSSPDKTKAAALGLGAGAVAGIAAAFLVVAVDTRLRNEDQLASATGIPVLGAVSRSPLLAHRSIATIQ
QRLSRTTEEFLRIRSALTYVNVASEVKVLLITACKPGEGKSTISVNLAMALASEEDSVLLIDADLRRPRAHEYAGVDGAV
GLTNVLSGEVDLDVATYRFPGTALDLLPAGTIPPNPAELLTSAAMKDLVAAVSHRYRYVILDTPPVLSVADANLLSPLAD
GTIVTVDAQKTRRVSLAQTTKILTGGGARILGTVLNRARPVRDRDGYYSETRG
>gnl|bykdb|C7NFS0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Kytococcus sedentarius] (length=492 residues).
MTLDDILRLSRRHIITLVLSTLLGIALAAGWVALQKPVYTATATGVVQANAGTGTVGESLSGNSLAITKSKTYVTYFSSQ
PVAERVIEELGLDTSPSSLAGRVTAKVEEETPNITVSARGDSPERAKQLADTVVAETAEYVRELETQNMSAAPNQPEGEE
GQQQDQAPATSILPLANAELPSSPTEPQPARALVLGGLAGLALGYVIAWFRHRQDTRVRTQEDIEEAAGGAPTLGLIPAN
EALASPERAVRDSGEVDFSTREALRQFRTNLRFVNVDHAPKSIVVTSARMGEGKSTISSNLAYLLAEGGERVILVDADLR
RPSVAGIFDIDSSVGLTQVLAGSADLADAVQPTEHPNLMVLPAGTIPPNPSELLGSQRMRDLIATLTQTHRVILDAPPLL
PVTDAALLTTSTDGAVLVVAANDTRKEHVERATANLRNVNALLLGAVINRASVSRLNRILYGEGYGYGSYGYGYGNSYGD
DVKSKGKKHRKK
>gnl|bykdb|D1NRU2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium gallicum DSM 20093 = LMG 11596] (length=507 residues).
MVRSDDERREDARTTRAQGTKEGDNAALTLTELLRTLAKHWITAVVTAAIVLAGVITYLAVAPAKYSATSRLFATYSSTN
NTENYSSLNSAGSYISTQVKSYPDLVVTKAVLAPVVEQLHYQGTMQSLQSMVSASNPTDTAFINISATTDDPQLSADIAN
ACAESLKKLVETSLYPADQQSPVTISIVQPAVIPSAPSAPKKNLIIVLGIAVAIVLGVIAALLKNLFTRKIQDEEELSNY
IDAPVLGRIPEDTTLDDTVPVIKQPGSSLSEKYRRVCTNLSFIAPAAGTHARLIVISAVGVNEGKTTTSVNVAAALAESG
ASVLLIDADLRHPSVAKKLGIDGAAGLAHILSGQASVKDVVQHYWKPNLHVLVAGPKPPNAATLLGSPLMTELLTQALHQ
YDYVIVDTAPMIVANDAASFAKQGGGLVLVSKRGATMKHELADVAAELANLNVPVTGFVANFARENKKLLEGSSYYYYYY
YRDGESSDGSAKRKHRRKHKQVQSNRT
>gnl|bykdb|D2B1Z9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Streptosporangium roseum] (length=454 residues).
MELLHYVRLVRRNWLFILLALIISVATALVVTENTPPKYVASTSMLISGQDRKGSLSTAYQAGALSAQRVKSYASLLTSR
RVVGQITAEEDVERLQKNITAEAIPDTVLLRATVTDTDPARAAQLANALSITFTQLIDQIERPSPNSRATIKITVVDQAD
VPKEPVSPKPLINLALALVIWLFTSIGLLVLRDYLDTTIKTREVLQEASKSSILGIIGYERAARRHPLIVRTGGRSSRSE
AFRSLRTNLQFISVDRQPRSLVVTSCLPGEGKSSISANLAITLAQAGGRVILVDGDFRRPSIPGYLGIEGGVGLTDVLIG
KAELRDVTQPWGEAGLHVLPSGQIPPNPSELLGSYGMRQVLARLTDAYDMVIIDAPPMLPVADATTLAAICDGTLLVARY
GKTRREHLVRAVELLSSINARVVGTVLNFAPVKSSTYYGYGYESDAKVKVPANA
>gnl|bykdb|D2Q672 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium dentium] (length=469 residues).
MTISDVLRAIKKHWIVEIVLFCAVVGVVAGKTFTTTPVYTASTEILAQYSSALSSGDTATSNQQYSNGTSPTSLYPNLVQ
SDEVLQATIDNLGLHTTPSALRPNVSAVSNDASSIIYIYATDSDPKQTVRIVDELVKQLKKQADAMAGVSTNVSFAVIQA
PVEPTSASSPNVKANLAIGIVAGAIIAMLGAVIREMFDKGINDVADVQSIVRDPMLASVPRTHTVSDGVPAVIAKPRGRA
AEEIRRLTTNISFVTPKDLKQPNVIIVTSANPREGKTTVSVNMAVSFAEKGKSVLLIDADVRHPSVAPALGMNSGVGLVS
LLAGEVSAKEAIQPYWKSFLHVLPAEEQKTPSGIILGSDVMRQLIDQAAERYDYVIIDTAPMTVANDAAVFAEQGGVLLL
VVGQGVAQKKALREVVKEFRMSKTAIRGVVLNMVSVNNAGRSSYYYYEDHEDGSSSRKKSKSRAARSKK
>gnl|bykdb|D2Q677 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium dentium] (length=492 residues).
MISAENTNAQQVVVPQGASEETDNGITLMGLLTIIRKHIVTAIIAFVVVVAGVSIYTFLAPPKYTATAQTMATYNASQEG
ADISQQSTGGSYISNQITSYPTLATTEKVLKPVINELGLDETVAELAGQLTVTNPTNTAFVNISAVDGDPKQAADIANAV
AESLQDVIQNDLYSTSDKSPVKMSIVQKAQTPTSKSSPKTALYLAVGVVLGIIVGVFAALIKDLLNTKVEDASDVRGVVG
SSALGSVPQDESLTEKRPVIVSQPNGAIAEEFRRIHTNIEFLQTDKTSGVGQLIVITSTSPSEGKTTTAINTAAALAEDG
AKVLLIDADLRHPSVAHHLGLEGTAGLAHVLSGQMTPKDVVQNYWKQSLHILPAGKRPANAGVLLGSETMKLMVEQALTQ
YDYVVIDTAPLSVSNDGAVFGRWAKGLVLVTGRGVCEKKELQEVADTLHTAEVPVLGFIFNFADPKKVHSHSNYYYYYED
GAPRSTHKGKRH
>gnl|bykdb|D3LLI8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micrococcus luteus SK58] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGLLAARNADQSLIAGNGPAESRAQAYVALINSQAVR
ERVAQDTGQDDDDSLSAALVPGSSMIKVTATSTDPETAARLANSALQATADVAAEVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLLGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEAAVDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFKVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYAYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRKARTRS
>gnl|bykdb|D3R6R7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium animalis subsp. lactis] (length=515 residues).
MRLKRKPRDSSDLSGASMLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDLLSILRKHIITIAVTFVVILGVDILYT
AMSPVAYTTTTQLFATYNSSNDSANSSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTN
TAFVNIAVTDADPSTAARIANGVAASLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKQSSPKWSLNILVGVLGGLIIGIL
AALLKDVLSKKIQDESDVTDIVDAPIIGRVVKDDILAGSSPVVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLVVVTS
AGASEGKTTISVNIAAALAEDGPRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPKP
PNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCRRDQTLKRDLHEIADELETLDMPVTGV
IINCAKENKKALENSNYYYYSNSSPAEKNRKNRKS
>gnl|bykdb|D4BMS0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve DSM 20213 = JCM 1192] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|D6ZYB6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum] (length=477 residues).
MTIADLLQIIRKHLASAIISFVVVFAAVAAVAFIMPPKYTATAEAFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNSSSSGSPIKL
TVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQAAILDDSRPVVVAQ
PAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLVDADLRHPSVAHKLGIEG
HVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVGQALTQYDYVIIDTAPLSVASDATVFGRM
AGGLVLVTGKGIVEKKELRSTATALQTAEVPILGFIFNFADSKKTHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|D9TEP7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora aurantiaca] (length=482 residues).
MDVLGYLRLVRRHWWIVLVTVMLGLGTAALVTVRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
AQSVVADAPLGLTADQVRSRIHTTATAGTVLLQATITDTDQTRALKTTETLATKFTDLVRKVETPPDGKAPPIKIEVVSG
PRVTSNPVSPQPTRNLVLGGLLGLLLGVGLAVLRGVADVRMRDGAGLQRVTGSPLLGEIPYETGARSAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
VGDVQVGDVVQRWGEKSLLVLPSGATPPNPSELLGSKSMADLLVALRDSADIVVIDTAPLLAVTDGVVVAVQADGALLVT
QQGRTSRSQVAAAAHALSSVSVRLLGCVLNMAKVAKSDAYQYEAYKVVVPPAAPSVPADRAGTRRGAKAVGDRTQELTRL
SR
>gnl|bykdb|E0Q4N5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium dentium ATCC 27679] (length=496 residues).
MENPVISAENTNAQQVVVPQGASEETDNGITLMGLLTIIRKHIVTAIIAFVVVVAGVSTYTFLAPPKYTATAQTMATYNA
SQEGADISQQSTGGSYISNQITSYPTLATTEKVLKPVINELGLDETVAELAGQLTVTNPTNTAFVNISAVDGDPKQAADI
ANAVAESLQDVIQNDLYSTSDKSPVKMSIVQKAQTPTSKSSPKTALYLAVGVVLGIIVGVFAALIKDLLNTKVEDASDVR
SVVGSSALGSVPQDESLTEKRPVIVSQPNGAIAEEFRRIHTNIEFLQTDKTSGVGQLIVITSTSPSEGKTTTAINTAAAL
AEDGAKVLLIDADLRHPSVAHHLGLEGTAGLAHVLSGQMTPKDVVQNYWKQSLHILPAGKRPANAGVLLGSETMKLMVEQ
ALTQYDYVVIDTAPLSVSNDGAVFGRWAKGLVLVTGRGVCEKKELQEVADTLHTAEVPVLGFIFNFADPKKAHSHSNYYY
YYEDGAPRSTHKGKRH
>gnl|bykdb|E0Q4N9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium dentium ATCC 27679] (length=473 residues).
MRGNMTISDVLRAIKKHWIVEIVLFCAVVGVVAGKTFTTTPVYTASTEILAQYSSALSSGDTATSNQQYSNGTSPTSLYP
NLVQSDEVLQATIDNLGLHTTPSALRSNVSAVSNDASSIIYIYATDSDPKQTVRIVDELVKQLKKQADAMAGVSTNVSFA
VIQAPVEPTSASSPNVKANLAIGIVTGAIIAMLGAVIREMFDKGINDAADVQSIVRDPILASVPKTHTVSDGVPAVIAKP
RGRAAEEIRRLTTNISFVTPKDLKQPNVIIVTSANPREGKTTVSVNMAASFAEKGKSVLLIDADVRHPSVAPALGMNSGV
GLVSLLAGEVSAKEAIQPYWKSFLHVLPAEEQKTPSGIILGSDVMRQLIDQAAERYDYVIIDTAPMTVANDAAVFAEQGG
VLLLVVGQGIAQKKALREVVKEFRMSKTAIRGVVLNMVSVNNAGRSSYYYYEDHEDGSSSRKKSKSRAARSKK
>gnl|bykdb|E2SFH2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Aeromicrobium marinum DSM 15272] (length=470 residues).
MSVDLQQFVSGLRARWKFSAVTFILGLAATAAILAVWTPQYGSSVKLFISTPTGGQAEFAASFIVTQRVASYSDLATDPS
VLQGVVDRLDLDMTFEELAGRVTSSVVVGTQTIQIDTTAPTPEMAQQIAEAEAAELVDLVTRLERPADPNGVAAIAARVA
GEPSFSDQPVSPNIPITIGVGVLLSLFIAIAGAVLKDLLDRTVKSRHDVEAITGNAVLSTLPYDPQVKKDPLTAETEGPL
SEAFRVLRTNMQYANLDARRHAILVSSAVPNEGKTMVATNLALSMAQAGRSVLLIDADMRNPNVAERLGLENSVGIVTVL
VGRSTIDEAIQPHPSGVRFMGTGPMPPNPAEVLETQAMRDLLSTLRDRYDTVIIDAPPMLPVADASILITEVDGALLLVR
HGSTTREQLRLAVSRVEAVGGRLFGVVLNRTPRRSPDTYGYGYGYGYGYGVTEKEPPAPKFGGRGRRARR
>gnl|bykdb|E5Y0V8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=501 residues).
MNKEERSIAVDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGAS
SNASELSSGANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKELAEGVTASNPDGTMLVDISVNDPDPKQASSIANSV
AENLRKQVTSTIYNDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTA
VIDAPVLGSLSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSVNLATAFAEN
GSKVLLIDADVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSG
AYDYVIIDTAPMQVANDAAVFAKEGPELLLVAGLGVTEKKLLRQTGHELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDE
SDDNGKKRQIQHKKSEKTKKD
>gnl|bykdb|E6SEU3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Intrasporangium calvum] (length=472 residues).
MTIRDLVGVIRTRWRLIALCVLVVIGATAASTLMTTPVYEATARVYLSTVKPADDKSPGGTYAITQKDLNTYVAILGSPA
VQDPLRAELGLAPGTGIDISGTVSELTNVLDLQARSSDPQRAADIANTAGPVLADAAKKFSPLLANNNQVVEAEAITPAL
APAEPISPKVKTNLAMALLAGLVIGIGAALLRHVADTKVRGDEDIRKLSDRPILATIPFVKGSDGPVLTLADDPHTHHAE
AIRRLRTNILFVDVTTQGHSFVITSSNPGEGKTTTSVNLAIAMADAGSKVLLIDGDLRNPSVAKTMGLEGSAGLTTVLLR
RAEPADVIQAWRDTSLHVLPAGQIPPNPSELIGSEAMSQLFQKLAQEFDYILIDSPPINPVIDAVLLNQLTHGLIMVVAS
ERTRRRELEAALRSLETVEVPVAGFALNLATGARSAAYRYGTYGYGQTAAVHGSRAAKKSRRSDRRGLSRAR
>gnl|bykdb|E6TBM9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium gilvum] (length=505 residues).
MNFQDFVKLLRSRWVTVGVTLAATVLGAVAVSLLTTPQYQASTRLFVSTAAGSSLADTYQGNRFSQDRVVSYAELLTGET
LAQRTIDKLGLNMSASALRANVSASAKPNTVLIDVLVLDESPVRARDVANALSEEFVSLVRELEAPADGSDPDSRVVVEQ
RASIPQQPVVPKTFRNVVTGLVLGLVLGIGLAVLRDVVDNTVKTKEKLEEITGTGMVGSIPLDRARRNQPAISYEQDNSP
IAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPHEGKSTTAINIALALAEAEHSVVLVDGDMRRAMLHKYLDLVGTVGFSTV
LSGAAPIAEALQKTRFPGLTVLAAGAIPPNPSELLGSQAARKLLNELRGQFDYVIVDSTPLLAVTDAAILAAGADGVLIM
ARFGQTKREHLTHAVASLESVGAPLLGAVFTMTPSRGGSSYSYSYSYGYYGEDVGKRPSRTTPPPVEVLARRSTKITSDG
GVSASMQPPEGAARPGKRRKREAPE
>gnl|bykdb|E8MRZ7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. infantis] (length=478 residues).
MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLIITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|E8NEF0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium testaceum] (length=555 residues).
MDMQRVVRVLRAYWKAIVALTVVGGLAGLGWSALQPRVYTADASGYVAAMSSDNSTGAALAGDQLALSKVKSFIDMGYWR
SVAEAAKEDLGLSDSPESLVQRIQVSNPVDTVNVRVDAAGPTPEAARDLAEAWIRGMTKQVDGLNSAGSGQGAVRLVAGD
SARLPTSPSSPNVRLNVAIGAIAGAILGVVFALVRRAFDRRLRAARDITEAVDTSVVGVLPVDKELASGRAVFSFDDIKD
GRGSFAHKEAMRELRTNLQYVDVDHPAKVIVITSPLPGDGKSTTAANLAVSIAATGRSVILIDADMRRPVLGGMFGFSDD
VGLSDVLAGRAQIEQVAHQVDEHGRLFVVAAGRTPPNPTEMVGSQRMQQLARRLSDDMIVVIDSPPTLAVADAAVIASWA
DGAVLVVTAGRTTDDMLVRASDNIGKTRGRLLGVVLNRVPLRGVDSSYYGSQYAGYYGYGAASGARRSWWRRGWFGSAKR
RPDDDAEAVADPGPRRRAALPPDNVSGLRTLSQRRTAGGQSGDTTGEDRESAVVATKPAVSAQEAAVGVRRRRRP
>gnl|bykdb|E8NF39 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium testaceum] (length=474 residues).
MELRDYLRILHRNWILVLSLTILGGAGAFGWSLLQTPTYETSTELYVSVRSDSSGVSELVQGTSFARQAVVSFVDVVDSA
VVLDRVIDDLNLDTTPQQLARSIDASSPTNSVIITVRVSNTNAEQAAAIANSVGSNFADVVVNRLEKPDGDAASLVRVET
IAPALVPTSPSSPHTPLNIAIGIVVGLALGLGIAVLRSVLDTRIHSLHDIEAATEAPVLGGIALDPDAKKRPLIVHADPR
NPRAESFRSLRTNLQFIDVDGESRSFVVSSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGIEGGVGLT
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLEALAGAFDYVLVDAPPLLLVTDAAVVSRFTSGVL
MVAASGTTKKPQLTAAVEKLDAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPDEKTPAEPKTDRRSQRRGDAK
>gnl|bykdb|E9V2I9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Nocardioidaceae bacterium Broad-1] (length=473 residues).
MDLRDYVAALRKRWYIVAVLAIIGAGVAFAQAHASPPQYRAQSTVFVSIARGATTQELVQGSTFTQDIVQSYAKLATMPV
VLDQVIYDLDLDTTPKALAEQITAENPLDTVIIEIDAVATTSTGASDLANSVADELTTTITNLSPSSNKKAAVEVTVVAR
ADPPEEAFAPRTRLAALVGFTAGFGLGVAIAVVRALLDTRVRTAAEIEQLTDVGLLGAIPRRRGQRRSRGAVTAIDPHNV
AAEAYRRLQTNLQYLDASSPVRSIVVTSSIGGEGKSTTSINLALAIAEQGQRVLLVDADMRRPAVADYCGLEGAAGLTTV
LIGKAELDEVVQVWGDANLHVLTMGEIPPNPAQLIGSPRMADLLEEARASYDVVILDSPPLLPVADGAILSRLTDGALVV
ANCRTIHRPQVLEAIDSLETVDARCLGIVANQVRDTAAHTYYGQPEQGWLARLLSGFVRPREPRQQGYPAAGS
>gnl|bykdb|F4F8R2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Verrucosispora maris] (length=485 residues).
MDLLRQLRLVRQHWWIVLVTVMVALGVTALITVRAQPRYVASVTFFVTTPSQGVTDAYQGGLFLQQRVKSYAELLTSDRL
AQSAAADRQVGLTAEEIQRRVSTSTENGTVLLRASVTDTDQARALRVTEALSANFVELVQKVEAKPDGSAGPIKIEVVSG
PRVTPSPVSPQPVRNTVIGALLGLLAGVGLAVLRGMADVRLRDAAALRRVTGSPLLGEIPLDGSARVAPLIVGDAATSAR
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVGHYLGVDSGVGLTDVL
VGDVHVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMSDLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVS
QQGRTSRAQVAAAARALHSVSVRLLGCVLNMARVPKTDAYQYEAYRVVTDTASTAAARSSAGRHAERRGPAEPVDHTQEL
TRLSR
>gnl|bykdb|F4GZE0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cellulomonas fimi] (length=521 residues).
MELQDYLRVLRKRWVSIVAITALATLGAVAASLATTPMYQATTQLYVSVQGGASTSDLLQGANFTRQQVTSYAQLVNSPS
VLGPVIDEMGIDARVEQLAGQVRADSPLNTSLINVTVSHENPAVAAAMADAIAAEFKDVIAELETPAGGGASAVKVSVVR
EAAAPTSPSSPNLKLNVALGLLVGLALGVGIAVLREVLDTRVRTEDDVARVTDTSVIGTIPFDEDAPKHPLIVQTSPHSH
RAEAFRRVRTNLQFLDVADRPRSIVVTSSVPGEGKSTTSINVAITLADAGTRVVLVDADLRRPAVARYMGIEGSVGLTTV
LIGRADVADVVQPWGNGNLHVLPAGQIPPNPSELLGSQAMAQLLETLTSRYEVVLLDTAPLLPVTDAAILARLTGGALVV
AGSDKLHRNQLTESMSSLETVGARVLGIVLNRQHRKAGDQYTYYDYSPTPAVDGAKGRAGGRRRRSRTAPTAPTAPVNGT
PTGAVPVPTTTGSIWPGDALSEARARGLQPGPQHQRGGPSA
>gnl|bykdb|F8ASQ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum KACC 91563] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILNDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQTAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKHSSHKGAKSKGEKKARK
>gnl|bykdb|F9Y1Z6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQITTYPELV
KTEAVLQPVIKDLGLDMTTTDLADVVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLADQVSSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|G4CXH7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium avidum ATCC 25577] (length=525 residues).
MTVVDVVRILRRNLALLIICTVIGGLIGAAYQLTRPEVFTAKATGMVVAGDSASVGGAMSGNTIAQQRATTYTKLVETRT
MAQKTAEILKKQGMSEAASGQLTASAPSDTAFIEIKATGGTAKNAQALANAGLEALISEALRMETYGQTAGSGNKSDAQL
AKMTSVHVLGYESAGLPTGDRGKSLALFLAAGLVIGFLIGAVIAVVRKQFDVRVRDQATVEELTGSGTLAVVPDDKKLAE
QRERSIVHISGVTGEAFRQLRTNLRFANVDNPPRSVVITSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
FGTEAGVGLSQVLAGDVSLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLAELRRRGYFVVIDAPPLLAVTDAG
LLGTIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLARVPRKKMGDVLYGYGASTYGYGSYHGDYGKYGYYSSY
GTEEQDSQESIAVVKDDRQPKERLVRAQKTERVDTDSEITPRRAK
>gnl|bykdb|G4HWY2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium rhodesiae JS60] (length=470 residues).
MLRTRWITVCVTTLVVVLGAVAYTLLTTPLYQASTRLFVSTNSGASVSDLYQGNLFSQQRVLSYAELLRGETVAQRTIDK
LGLDVSAKALETKIKASVKPDTVLIDVQVLDESPVRARDIANTLSDEFVALVSELETPAGGGRPDARVVVEQRASIASKP
VVPDPVRNIAIGLGLGVLLGIGLAVLRDVLDNTIKSQQAVEEITGSSVVGFIPLDKEIRKAPAVSFVSGNSGTAEAFRKL
RTNLQFLAVDNPPRVIVVTSSSPAEGKSTTAINIALALAEAEHEVVLVDGDMRRPSLAKYLDLVGEVGFSTVLSGAASLT
EVLQPTKFPRLSVLAAGPVPPNPSELLGSLAAQKVLSELRAKFEFVIVDSSPLLAVTDGAVIAASADGALIAARFGKTKR
DQLAHAIGNLNHVGASVLGAVMTMMPTRGSGSYSYNYYYGQAHGDQQPNEAAVLPKTSQRHAETKPASDG
>gnl|bykdb|H0E7B2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Patulibacter medicamentivorans] (length=578 residues).
MALAGPGVEQLGARRRARATAMNPEPQEQTGLDDLWSLVADNRWLIILTTMIAVGASLFVSLRAVPQYEGTAKLAFSDPS
SDVSLTGVPVAPTQQPAQVAAAGVAQVQRSGVLVRVARLFGDQPPGVSRQLPPLVRQQRFIDRLRDNLSVSVEPDSNLVA
IKVRWPDALLAAQLANRVGEQTVELVTSQERRQYEARAGELKLRLDALPRSGPQTAAGASRKELQDQRSRLLALSTLARP
VQQATRAEPAADPVSPRPVFLAVLSAVIGLLAGLLLAALRRAFDRRIRDVTDLERVLDLPTIGHFAVATLGIDAPMVRDH
SSRGEMAADAGRVLRNNLGFVHVDAPHQVVVVTSGLEGEGKSTVAASLAVASAYAGDRTLLIDVDLRRPIVAHRFGIADE
PGLSDYLARRVEPADVIRSIALPDLDRDAPGGLTVIPAGRGVPRPADLLESARFADFITEVREAYDLIVLDTAPLLPVPD
TTALVPVSDMVLLCCRIDRVDRDVFVAARDALRRLRENGIATVATGITRRHAGRRGAYSYRDANYYYGYANHGEAKPRRR
RERPGRRHGRGRWRWRRR
>gnl|bykdb|H0QNF6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter globiformis NBRC 12137] (length=534 residues).
MDWGTIMSVNSTPAEQAPAGLDLADYLRLLRVYWKAIVAFTLLATLLAFGWTVLQPKIYASESSGIVVTPGSDNVSLSLA
GDSLAKAKVKNYESVAKSRLVANRVIASLGLETTADALLGAISVKVPLDTAEIRVTAQSPDPGTAQRVADAWVNGLAAEV
RAIETATPPNNSAASPGAPPGTAASTPAPAVSILPLGKAVLPSTPVSPNVRLSLAVGALTGLALGVAYALVRRHLDRRIR
NATEIERLFGVPVIGTLPIDHRLDGKSTILEEGAGAGPSPAGATGGAMGEALRELRTNLSFLDVDQPPRIIVVTSSLPGE
GKSTVTANLAATLAAAGENVVVVDGDLRRPTLADVFNLVPGVGVTEVLAGTAALGDVLQPWSALPNLSVLGSGRIPPNPS
ELLGSLAMKKMLSTLAQTAIVLIDAPPLLPVTDAAVLSRVADGAIVVIQAGKTTQEQLGHSLGNLDKVRGRVLGTVLNYV
PTRGTDAYSYYGTYSSEPAPAAARAPLGGRRAAQADGAGENVPVPVPAGLQAKN
>gnl|bykdb|H0RH30 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia polyisoprenivorans NBRC 16320 = JCM 10675] (length=468 residues).
MLDAVRRGWWIVLACGIVVALCGFGYSMLQSPVYRATAAVYVTSGSEASAQTAYQGSLASQQRVASYAELASSDEVIDRA
ISQGNLGMSRDEVREALQTSAKPDTVMLNISADAGSSEKAAQIANAVADSLSGYVATLESPAAGGQPLAKVTPVTHAESK
TQAVSPKPVRDTLLAFLIGIVLGLIVLFVKNRFDRTVTSTADLEDIGSSLIFGSLPFSADLRDTSLVPFNKGASALAEAF
RMVRTNLAFANVDDPVRAILITSGGAAEGKTTTAVNLARCLAEAGKTVILVDADLRRPAVATALEINPHVGLTDYLGGEG
SIMEFVQPSGTERLSILAAGSVPPNPAELVGSRRAADGIAELRERFDFVIIDSPPVLPVTDAVVMSQWVDCVALVVRSGK
TLAPDLRAVTSQFEVAGVALLGFVLNGVRRGTSAYSGGYTYYSNDLGKPNSTASVEGSTPRGRLGARR
>gnl|bykdb|H6N1H1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia polyisoprenivorans] (length=462 residues).
MSAGRLSIRGIGSVFRRGWWLVALISAVSCVGALLFSLASERIYESSVSLYVTAAGDESAAAVYQGSLAAQQRAVSYAEL
VKSDVVVNDAIKRSGLNISTSEARARLESVAQPDTVLLKITAKSGVPGDAAALANGAANSMVNYVRVLEQPSEGSAALAK
LTIVSPASVSDTPVSPNVSRNLGVAVLAGLLIGACVVVLRERFDSRFRSVSEIEQAVGSSVLGAIPSSDVVSSVGVLDFS
SGGDSVCESFRHVRTNLEFANIDSEVRKILVSSPSASDGKSTTSSNLAAVLAENGSSVVLVDGDLRRPSIASRFPVNGDV
GFTDFLRGDASLGSLIQASGVENLSILSAGKLPPNPAEVVSSQRAETCLAELGQMFDYVLVDSPPIMPVSDSVILSKFVD
GVVLVVRSGVSKRVEVERTLRQLEIARVRVLGVVANDTARSDQVYGYAHYSGYSQVASQRLD
>gnl|bykdb|H8E5G6 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium laevaniformans OR221] (length=463 residues).
MTLHDYFSALRKRWALLLVLTILGAALGYGYGTLQTDTYRAQSSVVIVPARGDTTSELVQGSNYVQGLVATYTVVATSPV
VLDRVIASLSLDTTSRDLARIVSVSSPLDTTVLEIAVTGADPGQITRIANAVSNELADAVENLSPRTTSSGPAVRVEQIS
PASEPRSPIAPNTRLLAVIGALIGLLAAAVIAILRQVLTTRLVSRADIAEVTDIAVLGQIPVNTTGVPLAVAVRDTASGS
LAEAVRTVAASLRFANVDGEAKVVLVTSPESGDGKSSIALTLAAIAAEQDQRVLLIDADLRRGTVADVTGFEGAVGLTTV
LLGDVTVDDAAEAWGESGLRVLTSGATPPNPGQLLASGHLRQLLAQVREEFDLVVVDSPPVLAVSDALWLAPAVEGIIVV
ARSRRTKREALARTLAELEATRTRIMGIVLNDVKRVASSPYYERAEVPHAGRSTWFLRGRRRG
>gnl|bykdb|I0L4P4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Micromonospora lupini str. Lupac 08] (length=486 residues).
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLSSDRL
AQSVVAETPVGLTADEVQHRVTTSTETGTVLLRASVTDTDQARALRVTESLATKFVELVQKVETPPEGKAPIKIEVVSGP
RVSASPVSPQPTRNLTLGGLIGLVLGVGLAILRGVADIRLRDAAGLQRATGSPLLGDIPFESSARTSPLIVGEAASSARA
EAIRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDEYLGLDAGVGLTDVLV
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVSQ
QGRTSRAQVAAAARALHSVSVRLLGCVLNMAKVAKAEAYQYEAYRVVASQATPSVPTDRATAARHSEGAGVNGVSDRTQE
LTRLPR
>gnl|bykdb|I3AR06 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum 35B] (length=492 residues).
MDEAEQVQDGNGVTILDLFNAVRKHVITAVVTLVIVMVAICAYTFTRTPQYTATSELLATYRSSAAASGASSNAGELSSG
ANYINSQIQTYPQLVKTESVLQPVIDDLGLDTTVKGLAASVTASNPDGTMLVDISVNNPDPKQASSIANSVAENLRKQVT
STIYSDEGDKIISPVNLTVVQQAYAPASPSSPNVKLNLAAGLAVGVILGIVVAFIKDLLDTRVRRDSDVTAVIDAPVLGS
LSRNEAYAGTSPVIISRPASREAEEIRRLRTNVMFVLPDEPLSNVIVVTSTGPSEGKTTLSTNLATAFAENGSKVLLIDA
DVRNPSVSKALGIEGAVGLTHLITNRVSSHDAIQRYWKPNFHVLPAGKQTMNPSILLNSRAMKALVEQVSGAYDYVIIDT
APMQVANDAAVFAKDGPELLLVAGLGVTEKKLLKQTGRELSTLSIDPVGLAMNYGETEKPQKGGYYYYGDESDDNGRKRQ
IQHKKSEKTKKD
>gnl|bykdb|I3BG34 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum 44B] (length=486 residues).
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE
EFRRLCTNLSFVENGNEDRPDNDHSNVIIVTSAVPDEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKGNYYYYEESEVKNRRAKASTGDSSQNSASRNARRGRR
TTADGR
>gnl|bykdb|I4BFP2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium chubuense] (length=482 residues).
MNLQDFLKTLRSRWLTVCLTIVVGVLAGVAITILTTPMYQASTRLFVSTSAGSSLAEVYQGNRFSQERVISYTELLKGQT
LAQRTIDKLGLDLTAAQLRGRITASAKPETVLIDVQVRDESPVRARDIANTLSDEFVVMVRELETPEGGRTPDARVVIEQ
RASVPNEPILPNTKRNLALGLTAGVLLGIGLAVLRDALDNTVKSRESLEEFAGVGLVGSIPMDKARRTQAAISFDRDNSP
SAEAFRKLRTNLQFLAVDNPPRVIVVTSSMPHEGKSTTAINLALALAEAEHTVVLVDGDMRRPMIAKYLDLVEPVGFSTV
LSGMASLDDALQKTRFRGLTALTSGAIPPNPSELLGSQAARKMLAELRARFDYVVVDSTPLLAVTDAAILAAGADGVLLM
SRYAHTKRDQLVHAVGNLRGVGAPILGAVFSMTPTRGTSAYSYQYNYYGDSKPQHEAPAASDAGPAIPVSGESTSTASKR
RA
>gnl|bykdb|K0VJQ1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycolicibacterium vaccae ATCC 25954] (length=495 residues).
MNLQDIVRLIRARWLTVCVTVVVALLGAVAITLFTTPLYQASTRLYVSTSGGSSVAEMYQGNRLSQERVVSYTQLIMGQT
LAQRTIDKLGLSTSAGALQENVTAKAKPDTVLIDVTVLDASPVRARDIANTLSDEFVTLVRELETPESGARPDARVVVEQ
RASIPNGPVIPKTARNIGVGLALGLLLGFGIAVFRDMLDNTVKNRENLEEITGAGIVGNIPLDKDRRKQPAIAFDRDSSG
TAEAFRKLRTNLQFLAVDNPPRIIVVTSSMPSEGKSTTAINIALALAEAEHSVVLVDGDMRRPALAKYLDLVGQVGFSTV
LSGGASLEEALQKTRFSGLSVLTSGAIPPNPSELLGSQSARKLLSELRTEFDYVIVDSTPLLAVTDAAILAAGADGVLIM
ARFGHTKREQLVHAVGSLESVGAPLLGAVFTMLPSRGNSSSYAYSYKYTYAGSETEGRTATGETTWQQPPDRIAQPASRQ
LADWAEKRRRRETLE
>gnl|bykdb|K7S215 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Acidipropionibacterium acidipropionici] (length=486 residues).
MTSEPSGWTLSRIWGALRKLWVVIVASMLIGGVVTFGVTSVMTPDYESTSTLAFSAGRGSTSKELADGSTYTQTQMPTFA
QLASSSAVLQPVIDDLGLGMSVNALKKQMVVTIPQNTLVLEIQVSWTSAQESATVANAVAQSLTTVVRQVSPKPSAGQQS
AVNVTLVDKAVAPDHPTSPDKVKDPILGGLAGFVIGVLIVLLWSLLDTRIPTVGALRAMTGSPVLGSVSRTRSTARLWTV
ADPAGQTAEEFRRISSALTYATFGRQAHSIVVTSAGPGEGKSAVSANLALTLAGLGSKVLLIDADLRRPRVAANFELVDV
VGLTTVLMGRTSLQQAIQQHPGSDLDVLTAGALPPNPAEFLTSERMHALLEETVAGYDFVIIDTPPVLSVADAGLLAPIT
DGALIVVDAKHTRQAALTSAMTGLEDAGGRITGMVLNRARIDRMGAARYGEYLAPASRHSRRTDAVAQDAAPASPDTPVQ
AARRGR
>gnl|bykdb|L0IR94 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Mycobacterium sp. JS623] (length=480 residues).
MNIHEFLRLLRSRWLIICATTAVAVGGAVALNALTTPLYEGSTRLFVSTTSGASASEAYQGTLFSQQRVLSYTKLLMGET
LAQRTVDKLQLDMSADSLRAKVKATSAPDTVLIDVSVLDPSRVRARDIANALSDEFVVMVSELETPAGSEKPDARVVVEQ
HASLPASPVVPKTTRNILIALALGVLLGIGLAVLRDRFDNTLKDRQSLEETTGVGLVASIPLDRDRKKDPAISFNSDRSA
IAEAFRELRTNLQFLEVDDPPRILLITGSLPSEGKSTTAINIALALAEGDNSVVLVDGDMRRPTLAEYLGLIGNVGFSTV
LAGRATIHEVVQKTTFPGLSVLTSGEIPPNPSELLGSLAAKKVLSELRADFDYVIVDSSPLLAVTDAAVLAAAADGVLLI
CRFGKTKREQLAHAVGNLRNVGARILGAVFTMTPARGNSSYNYSYYGGVDNSPAILSRPKNGKRHRREVGPSNRISGATS
>gnl|bykdb|L7K558 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia rubripertincta NBRC 101908] (length=464 residues).
MSTKNAFVRRSGSFGESVAVLKRDWWFAVVSALVLALLALGFSLMQSPVYQSSATLYVTSGADGNAVSALQGSLASQQRV
ASYAMLVRSDSVLSDALESSSLPMSVEEAQGRVAASSTPDTVLLSVEARDTNREHAYVLANAVADSLVAYVASLEEPAAG
GVPLAKLTVVTPASIAESPVSPRTYRNVALGFLLGAFLGVLLILARARFDTKVRSTDDLEILELPALGVIPRDTDLEGRG
ALDFSVGSSVTAEAYRSLRTNLSFSNVDAPVKVIIVTSPSSGEGKTTTAINLAAALAEAGNRVVIVDADLRRPTLALRLS
LNGEVGLTTYLAGSAQLSDLVQETGMSDLDALSSGSLPPTPAELLGSQRAGLCFSELASIYDYVVIDSPPVLPVTDAVVL
TQWADGVLLVARAGRTTRPNLTAATENLSKANATPIGVVLNDASSSSGAYSYAYYGESRESELV
>gnl|bykdb|L7KXD3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia amicalis NBRC 100051 = JCM 11271] (length=459 residues).
MLGCLGLGYCLVQTPMYVSSATLYVTSGTEADAQSAYQGSLASQQRVASYAELVDSDVIIRNALDDSGLQISVDDAREAL
SAASNPDTVLLSISAENSDPAIATTLANSVAEAMTAYVTTLEQPNEASQPLAKLTVVSPAVQPQDPFSPRTARNTVLAVL
VGFVLGVLIAVLRERFDTRLRNGEEVQRTVPSAVLAEIPSENTLDGHPVIDFSVGSSRAAEGYRRLRTNLAFVSVDQPPR
CILVTSPGPGEGKTTTSLNLAAALAEDGNRVVLVDADLRRPSVARRLGLTGAIGLTSFLRGDGVISDFVQSGPVEQLDVL
VAGALPPNPAELLGSQRAKDGMEALQASYDFVIMDTPPVLPVADAAILSQYVDGALVVVRAGRTRSQDLATAFDSLLAAK
ASIAGVVLNDVSAHDSRYVYYSYEQVSSPGRSVGQSSVADTANVDGGNLRVGSAPGSLT
>gnl|bykdb|L8TVZ5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter nitrophenolicus] (length=525 residues).
MTTPAAAAEAPPGLDLTDYLRVIRAYWKGIVALTLLATLSALGWTVLQPKIYSSDSSGIVVTPGSDNVSLSLAGDSLAKA
KVKNYESVAKSRLVADRVIAALGLDTTADALLGSVTVKVPLDTAEIRVTAQSTDPATAQRVADAWVNGLAAQVEAIETVP
PAQAAVESGAAATPDAGTPAGATATAVRVLPLGKAVLPTSPSSPNTKLNLALGALVGLALGMAYAVVRRHLDRRIRQASE
IERLFGVPAIGTLPADRRLEGRSSVLDTGTTEQIHDAGGAMAEALRELRTNLSFLDVDQPPRIIVVTSSVQAEGKSTVTA
NLAVTMAAAGENVVVVDGDLRRPTLVDVFNLVPGAGVTDVLTGTAELDDVLQPWGALPNLSVLGSGRIPPNPSELLGSRA
MKTMLNTLAENAVVLIDAPPLLPVTDAAVLSRVADGAIVVIRSGRTTQEQLAQSLGNLDKVKGRVLGAVLNYVPTRGTDA
YSYYGTYTSAPAAVPAAAPQPARPVVDSPEESAVEAALSGRRAKG
>gnl|bykdb|M0QJM7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Gordonia soli NBRC 108243] (length=493 residues).
MAPETVRVEATPTSSVRATIAVIARNWWVILLCAVIGAVLGMAASLAQQPVYRSTATLYVTSGADANSQSAYQGSLASQQ
RVASYAELVTSDAVVTKGLRDGGLDDLSPAAAKEALDAMSTPETVLLRISADSTDEQVATRLADAVAESLTEYVTGLERP
SSGGAPLAKLTVVNRATPESGPVSPKILRNTVFALLAGVAVGLVIVFVRRKLDVKVRSQSDVTALSGAPAVLTTVPSESV
LKDHYVIDFRSGSSPAAESYRRLRTNLGFVSVDRPLRTILVTSAGQGEGKTTTAMNVAAALAEAGQRVVVVDADLRKPTM
AARFGVSDSIGVTDYLAGNAEIVDLLQETGFPNLAILASGALPPNPAELLGSERARTLMEDLSRRFDHVVVDSPPVLPVT
DAAVLASLVDGVVVVVRAGRSRLPELADALERLRTAHAPLAGVVVNDERPSGSSYRYAYYRSSPPSASEDLALATPVAPT
DVTAAHGSNSRGG
>gnl|bykdb|M4RDM8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium thermophilum RBL67] (length=466 residues).
MTIADLLQAVRKHLGAAVATFVVVATAVAAYTFLTPPKYTATAQLFATYSSQGESQNSSEMNSGATYLSTQIKTYPQLVK
TEAVLDPVIKELGLGVTADELAEEVTATNPSNTFIVDVSVVDADAGQSARIANSVAKNLAKQVSSTLYTDESAKSPIQLT
LVQKARTPEAPSSPKVGLYLASGVVLGLILAVGVALLLDVINTRVEGSSDVRELTKASSLGSVQRSELLSKPRPVVISQP
SSKEAEEFRRIRTNISFLAPSEKDRGHLLVFTSTRPSEGKTTTATNTAAAIAEIGKSVLLIDADLRHPSVAKEIGIEGHV
GLSHILSAQATPRDVVQKYWKQNLHVLPAGKRPANASVLLNSEIMVDLVEQALTQYDYVIIDTAPLSVANDAAVFGRMAH
GIVLVVGRGVAEKKDLQDQATALKEANVPILGFILNYADAKKHSKKNGNYYYYYEDSKGGHSHSHR
>gnl|bykdb|M5BCU5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. nebraskensis NCPPB 2581] (length=470 residues).
MALRDFIRMLRRGAVLIILTLLVGVGAAAAFSLLQTPEYEASTKMYVAQSSSGSVQDLQQGNNFIQQAVKSYADVVTTRA
VLQPVIDEFGLDMTSRELAESVRASAPLDTTIIDITVKDQSRQDAATLADAIGASLTTVVGTLVPETIEGTPQVQITQLE
QAEIPESPSSPNLTVNIIVGALIGLLIGVGVSLLRETLDNRIRGERDVELVTTKPILGGIAYDPKATERPLIVQDDPRSP
RAESFRSLRTNLQFLEFGGRSRSFVITSSIQGEGKSTTSSNLALALADSGIKVVLIDADLRRPRLASYMGLEGAVGLTDI
LIGRAEIEDVIQPWGSGMLSILPAGQIPPNPSELLGSQGMARLLQDLEARYDVVLIDAPPLLPVTDAAILSKNAGGAIVV
VAAGRTHRTQLKSAIANLTNVGADVLGLVITMLPTKGPDAYGYGHYGYGYGYTEDEDGQKTKAPIEKIKA
>gnl|bykdb|M5BCW7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Clavibacter michiganensis subsp. nebraskensis NCPPB 2581] (length=468 residues).
MTLHEFTALLRRLWYVVVAATLAGGAVAFGLSQLATPVYTAQSRLYFSLSSGSSASDLNQGATYTQSQMLSFGELAESPA
VLEPVITRLGLDVTPQELARAVTVTTPQNTVVMEISVTEPSPSEAAEIANAVATSLRDTAEAYAPTGAEGSPTVSVRVIQ
EAPEPEFQSAPNGRTNTLAGLLLGLLAGLLGLALVRLLDTRVRSAETVAHLTTAPLLGALERERGVTGVAMAVRPLSTAA
EGFRQLKANLRFVLLGDRSSSIVVTSSIPGEGKSTVAANLAMSLSEGGRRVLLVDADLRRPVVAQYLGLEGDAGLTTVLV
GQALLEDVVQPWGDGTLHVLTSGEIPPNPSELLASNRMEDLVARAKADYDVIVIDTAPLIAVADAAFVARMTDGAIVVAD
QTRVHRAQLSEALDAVEKSGGSVLGVVLNKVRPTKDKRAYYRAETEQVGRAPRGAGKAHAAGKARAAG
>gnl|bykdb|M7MWW7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Paeniglutamicibacter gangotriensis Lz1y] (length=545 residues).
MEQLEENVADGPDLRQYLRTFRTFWRSITSIVLVAVICAFGWTLTQQPLYSASASGLVIATGADTAALALSGDSLAKSRA
ISYKSIAATRTVAERVREELKLDASAEQLLGQLEVELPTGTAEVRLKIINADPVLAQKTANAWVDALAEQVTEIESGFAS
GSSNDESIVQLVPLVDAEVPTSPVSPNTKLALALGAVLGLALGAGFALLRQHMDRRVRSVEDLEKLGTSVIGTIPLDPRL
VKNRTTVETGALDHDDRASHPYAEALRELRTNLTYVDVDKPARVILVTSSVPGEGKSSVAANLAIAIASTGRPTILIDAD
LRRPVVTDIFGLPGGAGLTDVLSQQATLDDVLQPYGPIPTLSILAGGRIPPNPSELLGSQAMLSLLDDLSRDALVLIDAP
PLLPVTDAAVLANFVDGVLVAVKADSTSTDEVAKSLGNLDKVGANVLGFVLNQVPTKGAGAANYGYYGQYYYAAALPEKG
KGKKPKTSRRLKNAVPVDAPRRVGERQQYSYNGETVQDADTTHIQADAHFDDVLATRADMRHLRR
>gnl|bykdb|N1V0H1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Arthrobacter crystallopoietes BAB-32] (length=526 residues).
MEINRTEEQPQGLELRDYLRVLHTYWRGIVAIALVVTLLAFGWTFLQKPVYEAQSTGYVIANAGKDINTTLAADELARSK
VKSYASVATSRPVAQAVSDELGLNLAPDELIERIEVETPLDTPELQITASAGDPAEARNLADAWVTALAAQVEEMETAGS
DAKAAVRVEPLAEAALPTSPVSPNIQLTLAIGAVLGLMLGLAYALIRNHLDRRIRSAEMIEKQFGVPVIGTIPVDKRMQD
HRQVVETGAIESSSDRTAHAMSEALRELRTNLNFVDVDNPPRVIVVTSSVPGEGKSSVTANLAVTIAASGKRVVVVDGDL
RRPVVTGMFNLVPGAGVTDVLSGQAELEDVLQVWGQVPNLAVLGAGRVPPNPSELLGSKAMSDMLKQLAEHATVLIDAPP
LLPVTDAAILSKISDGAMVVINAGKTTLDEIDKAFGNLVKVDAHILGAILNRVPTQGADAAQYGYYGQYYQQDEVEPVRR
GSRRKQPRRTAAPEPAAEFQLESEDEFKALLSGEPMPARRTPPTRR
>gnl|bykdb|Q1AYJ4 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Rubrobacter xylanophilus] (length=492 residues).
MRDENHLRQRRSTNGPEAGPPPDDEIVISLDELLRVLWRRAWIIALVAGLLTAAAAGFSLLRTPIYEASIQIVIGQREGA
APTNLGSDVMGLQQLTRTMAEVLESRTVANAVIREMNLPTDAETFLENMTVEPVTETQVIEVSYRDPDPERAQQVANTIG
RVFSEQVSDLSPSANAVTATVWERAQLPDEPVSPQPLRNAAMALVLGLMLGTGAAFLVEHLDDRWRSPEDAEQVSGVPTF
GVVRQFDTSGGKRRRGRLLRRRGDKKEDMLDLAGRLVTLVDQDGLAAEDYRSLRTNLFYAFVDAPPRAIVTTSPGPREGK
STTCANLGVALAQAGRSTLLLDCDLRKPVVHEIFGLRNIRGVVDVLAGTRELREVWHSPVPNLRVVPTGPIPPNPAELLS
SRRFQQMLEEARGQFDYVLMDAPPVEAVSDPVILATHSDGVLLVIDAQNTRKGAVRRAMRSLEAVGARVLGTVLNNAGET
EGGYYYYRRYGY
>gnl|bykdb|Q8G4Z0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum] (length=478 residues).
MTIADLLQIIRKHLASAIISFVVVFAAVAAVAFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTAANPTNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGTRPANASILLNSDLMKEMVEQALTQYDYVILDTAPLSVANDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|R5H175 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium adolescentis CAG:119] (length=500 residues).
MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDLFKIIRKHLVTAIIAFVVVVAGVSAYTFLAPAKYTVTAQTMATY
NASDGGESIAQQSTGGSYISNQITSYPTLATTSKVLKPVIDDLGLDETVTDLAGQVTVTNPTNTAFVNIAVVDGDPKQAA
DIANSVAESLKNVIESDLYSGDKSPVKLSIVQKAQVPTSKSSPKTALYLAVGVVLGIIIGVFAALIKDLLNTKVEETSDV
RSIVRASSLGSVPMDASLDDKRPVLVSQPNGAIAEEFRRIHTNIDFLQTDRTEGVGQLLVITSAQPSEGKTTMAINTAVA
LAEDGAKVLLIDADLRHPSVAHHLGIEGAAGLAHVLSGQMGPKDVVQSYWKPNLHILPGGKRPANAGVLLGSETMKLMVE
QALTQYDYVIIDTAPLTVSNDGAVFGRWAKGLLLVVSRNVCEKKSLQEAADTLATAQVPVLGFIFNRADPKKTNTHSNYY
YYYEDGAPRSSHRAKGKKRH
>gnl|bykdb|R6NVA8 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium pseudocatenulatum CAG:263] (length=501 residues).
MAAAESNVPATNQVVVESNDTEDDGITLMDLFRIVHKHLLVGIITFVVVFAAVCAYTFLAPPKYSATAQVFATYSDSSVQ
DNNISNINSASTYITNQIQSYPTLATTESVLKPVIDDLGLDTTVANLAGQLTVTNPTNTAFVNITAETGDAKQASDIANS
VAESLSNVVEKSLYASGKESPVKLSVVQRAAEPISPSSPKVALYLAVGLVAGLILGVFATLIRDLMATRVEEASDLQDII
NAPIMGRIPTDESLQSNKPIIVSNPAGRIAEEFRRIRTNLSFTSKVEGSDARMIVISSVGPSEGKTTVSVNVAAALAENG
AKVLLIDADLRHPSVAERLSLEGGAGLTHVLSGQATVKDVVQRYWKPNLHILPAGPKPPNASMLLNSKTMTELLNAALQT
YDYVIIDTSPMVVANDATVFGSKSDGIVLVSGRDVTMKRDLKDIAVQLDNLNVPVVGFVFNLEKERKSSTNGNYYYYYYY
DEDGKKSKHAHKNSRKKSKHN
>gnl|bykdb|S2ZR30 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium breve HPH0326] (length=478 residues).
MTIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEVFATYAGQSGETQTTNDMSSGANYLNTQIKTYPELV
KTEAVLQPVIKDLGLDMTTTDLAGVVTATNPTNTFMVDISAEVDDPQQAADIANSVAKNLSDQISSDLYNNSSSSGSPIK
LTVVQKAQTPTGQSSPNIPLYLAMGLILGIIVGIGVALLEDILNTKVDSTDDVRELTHASSLGTVPQATILDDSRPVVVA
QPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEGKTTVSSNVAVALAEEGKSVLLIDADLRHPSMAHKLGIE
GHVGLSHVLSRQASPADVIQKYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVASDATVFGR
MAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYEDGNKRSSHKGAKSKGEKKARK
>gnl|bykdb|S3BBS2 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. oral taxon 186 str. F0373] (length=463 residues).
MTLHDYFSALRKRWALLLVLTILGAALGYGYGTLQTDTYRAQSSVVIVPARGDTTSELVQGSNYVQGLVATYTVVATSPV
VLDRVIASLGLDTTSRDLARIVSVSSPLDTTVLEIAVSGADPGQITRIANAVSNELADAVENLSPQTTSSGPAVRVEQIS
PASEPRSPIAPNTRLLAVIGALIGLLAAAVIAILRQVLTTRLVSRADIAEVTDIAVLGQIPVNTTGVPLAVAVRDTASGS
LAEAVRTVAASLRFANVDGEARVVLVTSPESGDGKSSIALTLAAIAAEQDQRVLLIDADLRRGTVADVTGFEGAVGLTTV
LLGDVTLDDAAEAWGESGLRVLTSGATPPNPGQLLASGHLRQLLAQVREEFDLVVVDSPPVLAVSDALWLAPAVEGIIVV
ARSRRTKREALARTLAELEATRTRIMGIVLNDVKRVASSPYYERAEVPHAGRSTWFLRGRRRG
>gnl|bykdb|S3WQQ9 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium sp. HGH0353] (length=525 residues).
MTVVDVVRILRRNLALLIVCTLMGGLLGAVYQLTRPEVFTAKATGMVVAGDSASVGGAMSGNTIAQQRATTYTELVETRT
MAQKTAEILKKQGIPEAANGQLTASVPGDTAFIEIKATGDTAKNAQALANAGLEALISEALRMETYGQTAGSGKKSDAQL
AKMTSVHVLGYESAGLPSGDRGKSLALYVAAGLVVGFLIGAVIAVIRKQFDVKVRDQATVEELTGSGILSVIPDDKKLAE
QREKSIVHISGVTGEAFRQLRTNLRFANVDNPLRTVVITSANPGEGKSTVSTYLAVVMAQAGEKVVLVDADMRRPVQHKA
FGAEASVGLSQVLAGDVSLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLAELRKRGYFVVIDAPPLLAVTDAG
LLGTIADGTICVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLTRVPRKKMGDVLYGYGASTYGYGSSYGDYGKHGYYSSY
GTEEQDSQESIAVVKDTQQPKEGLVRVQKTERADADAEITPRRAK
>gnl|bykdb|T2HZI3 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Bifidobacterium longum subsp. longum CECT 7347] (length=499 residues).
MEERRRTVNEIGQVQNDGITLLDLLKAVKKHTITAVITLVAILVAVAAFTFLSTPKYTATSELLATYRSSSGAAGSGTSS
VAGELSSGASYINSQIQTYPQLVKTESVLQPVIDDLGLKTTVKELAATVTASNPSDTMLVDISVENVDPKVASSIANAVA
ESLKKQVTSTIYSDEGDKIVSPVNLAVVQQAYAPATPSSPNAKLNLAVGIVGGVILGVIAALIKDLMDTRVRQDSDIAAI
TDAPVLGSLTRNDSFGESTPVIIAHPASREAEEVRRLRTNLSFVLPDEHLANVIVVTSTGPSEGKTTVSVNLATAFAESG
HKVLLIDADVRNPSVSKKIGIEGTVGLTHLITNQVSSRDSIQRYWKPNFHVLPAGKQSMNPSILLNSRAMKALVEQVAES
YDYVFVDTAPMQVSNDAAIFAKDGPSLLLVAGLGATEKKLFRQTVSELDTLDIHPVGVATNYTEPEKSHSNTYYYYGEDN
GKGNYKHKRQGKTADETQK
>gnl|bykdb|T5KGY5 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium maritypicum MF109] (length=450 residues).
MGESRVSLRVIASSLRKFWWMVVLFGVVGAAGSYGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDAKAAAELADAVAEQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAALIGVLDTRMRTEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPSEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSVKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|U1F9K1 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Cutibacterium granulosum DSM 20700] (length=472 residues).
MKFTNFVKLTRRRLVTILLCTLLGVAAGVGLLLTTPATYTASATAYVRVSVASSTNGSTDNYYSASQLASQKAKAFVTVF
TSQTVAQQVIHDLGLSMTPDALASNITASNEANSLTIKVTATADSADTARNIANSVISESAKQVKNLEGEKSPVQVVMMT
PADLSQVKKAPSPAKYVIAGLLAGILLGYVVAGIRQLTDRRVHTVHDVTDRVDKPILATIPASSTVAAISTDSTDDFRAA
EAIRKLRTNLRYAMIDNRSKVILVTSSVQGEGKSSVAGNLAKVMALAGEDVILVDADLRRPGVQRSFDLEDGLGLPEVLI
GAAPLEQALRTTSTAGLSILPCTDTPPNPSELLGSQHMSELVSFLAQDHVVIIDAPPVLPVTDSVVLSRLADNVIVVARV
GRTTVDQVENTVSAIEDAGGLVSGIVLNRTDSSKLSNLRYGGSAYGYGYSKYDSKLPGIHRQDAADRLHHES
>gnl|bykdb|U1MWX0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Agrococcus pavilionensis RW1] (length=491 residues).
MGFLEYARLLRKHWFLVIFAAVLGAAAGLLISFVQTPSYRASTEVFISTQAADTSSDLVQGNAFTLSRVNTYARLAGSEE
VLERVADQLELEVPVRDLMEQVEAMPVTNTAILEISALSDDPALAADLANATAASLAEAVEELETTGSTSPVRLATIVSA
DVPAEPESPRPVLQAILGALLLAVAALAFIVIRDLVDTRIRTERDVKAVTSVPLLAAVHFDPKAASRPLVVHAEPLSPQS
EVFRTLRTNLNFVEVDGKSRLFVMTSSIPGEGKTTTAVNLALAIAGSGQSVLLVDADLRKPKVADYMNLNGAVGLTDVLI
DRVAPADAVQQWGTSGLYVLPAGAVPPNPSEMLGSRAMHAMLEELRAEFDWVLLDAPPLLPVTDAVVLAQHGADVLLVAA
ADRVNAPQLKRSLEMLETVEASVAGLIMTMARLDSSESYRYAEYGYGRSERAEPEVPAPPRAKTAEHARPAEEAPSRRRR
GRGGKRSRAHR
>gnl|bykdb|U2XQ67 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. TS-1] (length=507 residues).
MELRDYLRILRAHWIALSLCLILGVVVAFAWTLIQPKVYTADASGYVTPVKAEGQNDSSSEYVSDNLAKSKVKSYVDVGT
WRAVGEHAREELGLNVSPESLVRRVSVSNPLDTVVIKVDATGPTPEAARDLAGAWIRGMQIEIENIESGGTGVNPGITLV
TADSARLPTTPSSPNVRLALAIGGLVGLVVGIGYALLRFTLDRRIRSAEGVERETGLNVVGAIPEEKSFTAENRLIPFDG
ANTSSSRNVHLYAVSEAVRELRTNIQFMDVDNPPRILVVTSPLPGEGKSTTAANLAITLSASGQRVVLIDGDLRRPMVAT
IFHLIGDAGLTDILAGRATFDDVAQPVGRSGSLRVVAAGKIPPNPSEILGSQRMRDLMETLSRDAVVIVDAPPLIPVTDA
AVLTNRTDGAIIVTTVGRTTFDALKKAQQNLERAGGRALGVVLNRVPRKGSGAAYYGYQYTGAYYRTEDADTVPDLAPTP
ATAAVSRVVTVGGQVLPDGRRARRARR
>gnl|bykdb|U2YPH0 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Microbacterium sp. TS-1] (length=456 residues).
MELHDYIRILRRNIVLIIATTLIGIAAGAASALLTPPRYDATTQLFVATQSSGDASNNELRQGTDFARQAVQSYVNIIPT
ALVLDPVIADLGLDESAAQLAERVSVSATQNTVVISITVSDPGPEGAARIANAIADSFTTVVSEQLERSTAERPSPVRIE
TVQPAQVPVDPAAPNMRLALALGALVGLAAGVAVAILRAVADTRIRTVEDVEKIVPAPLLGGIALDPESKKRPLIVAASA
RDPRAEAFRALRTNVQFLTTTGGPLAFVVTSANPSEGKSTTAANLAIAFAEAGSKVVLVDADLRRPKTAEYFGIEGGVGL
SDVLVSRASLLDVLQRWGQGTLFILPSGAVPPNPAELLGSTTMSKLLDELRTAFDVVIIDAPPVLAVTDAAVVGRAVDGV
ILVAAAGSTTRARLTSAVKNIETAGSRIAGTVVTMLPTAGADKTSYGVYAYVAKGD
>gnl|bykdb|U7IS15 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium sp. KPL2005] (length=525 residues).
MTVVDVVRILRRNLALLIICTVIGGLIGAAYQLTRPEVFTAKATGMVVAGDSASVGGAMSGNTIAQQRATTYTKLVETRT
MAQKTAEILKKQGMSEAASGQLTASAPSDTAFIEIKATGGTAKNAQALANAGLEALISEALRMETYGQTAGSGNKSDAQL
AKMTSVHVLGYESAGLPTGDRGKSLALFLAAGLVIGFLIGAVIAVVRKQFDVRVRDQATVEELTGSGTLAVVPDDKKLAE
QRERSIVHISGVTGEAFRQLRTNLRFANVDNPPRSVVITSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
FGTEAGVGLSQVLAGDVSLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLAELRRRGYFVVIDAPPLLAVTDAG
LLGTIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLARVPRKKMGDVLYGYGASTYGYGSYHGDYGKYGYYSSY
GTEEQDSQESIAVVKDDRQPKERLVRAQKTERVDTDSEITPRRAK
>gnl|bykdb|U7J8K7 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium sp. KPL2000] (length=525 residues).
MTVVDVVRILRRNLALLIICTVIGGLIGAAYQLTRPEVFTAKATGMVVAGDSASVGGAMSGNTIAQQRATTYTKLVETRT
MAQKTAEILKKQGMSEAASGQLTASAPSDTAFIEIKATGGTAKNAQALANAGLEALISEALRMETYGQTAGSGNKSDAQL
AKMTSVHVLGYESAGLPTGDRGKSLALFLAAGLVIGFLIGAVIAVVRKQFDVRVRDQATVEELTGSGTLAVVPDDKKLAE
QRERSIVHISGVTGEAFRQLRTNLRFANVDNPPRSVVITSANPGEGKSTVSTHLAVVMAQAGEKVVLIDADMRRPVQHKA
FGTEAGVGLSQVLAGDVSLDDALMRTETKRLQMLAAGRIPPNPSELLGSQRMKDLLAELRRRGYFVVIDAPPLLAVTDAG
LLGTIADGTIYVAVVGKTHRDQVSLVAKRLEQVGAPLLGSVLARVPRKKMGDVLYGYGASTYGYGSYHGDYGKYGYYSSY
GTEEQDSQESIAVVKDDRQPKERLVRAQKTERVDTDSEITPRRAK
>gnl|bykdb|U7JI33 [Bacteria] Bacterial tyrosine kinase [Actinobacteria][Propionibacterium sp. KPL1844] (length=496 residues).
MKFTNFVKLTRRRLVTILLCTLLGVAAGVGLLLTTPATYTASATAYVRVSVASSTNGSTDNYYSASQLASQKAKAFVTVF
TSQTVAQQVIHDLGLSMTPDALASNITASNEANSLTIKVTATADSADTARNIANSVISESAKQVKNLEGEKSPVQVVMMT
PADLSQVKKAPSPAKYVIAGLLAGILLGYVVAGIRQLTDRRVHTVHDVTDRVDKPILATIPTSSTVAAI