BYKdb

Dataset for cluster tadcd of phylum aquificae

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A432EZU1 [Bacteria] Bacterial tyrosine kinase [Aquificae][Aquificaceae bacterium] (length=791 residues).
MTVPVIKAVGNLSAATHDTAIPLSNIQMVDASASPDIKRELSLSELFSIIWRRKWLVIFSVILSLVVALLFTLSAKSTYR
ANATIQIERQGVEVVNFGKTDNLGGEVDSLNDPFFRTRYETLKSRKLLSKVIAETNLYQSLAGTNDKPSLLKQGLIALGL
AEASKKRNKGVEDYPKLLLDRLLVQPIDKTHLVEIYYEGNSPEEAKNVVTSLVDNFIRSQLDSRSETGDFAKRFLNKQVE
EARERLRLSEEKLVAYSNEKGILGIDENQTRHVTKLNELNAALVHAEIARSAAESQYRAMQGRGSTSSALTNPVIVGLKS
RLVDLEGQYQEKRKLFKPTYPDMRRLNQQIVGVRTKLNRELQLIKGAAGRSLKATYLAAKAQERRLRSELSRFNKKLKTL
QDSGVDYNKYKREVESNARLYKNLLQRVEEVSIASSVNTSSIKVVDPAITPVKKYRPRPSLNMIVGLLSGLFLGLALAFL
REALDQSVRSTEDLQRITGLPVLGLVPKPKRISNKEIAMATVLKPSAIFSEAYRVLSANVRFTLARERGKVLLVTSSSPN
EGKTTTACNMACAYAQMGMKVLLIDADLRKPSIAEKMRIYNKRGLSNFLGEDDGLLEVTQQIKGVSGLYVIPSGSNDTDS
MRLLSSERMQFLIAQAEQKFDFIIIDSPPVGGFADTLILSSLVSSTLIVADEAKLQISKIRYTLEQLMRIKSTAVGFLLI
NSTNPLVTDTAYEKHYKRKDASRFDNMLPNAFSAKLLTKKKTDRIKKFKVRGVKKPLWGKPKKGINLGYMN
>gnl|bykdb|A0A432F1D0 [Bacteria] Bacterial tyrosine kinase [Aquificae][Aquificaceae bacterium] (length=753 residues).
MSSENSQIFPVKTSNANNQGRLVVPSNEIYPEEILEQRSGLNLRDFISTLARHKTLLIGFTLATLLFSIIVTLLMDPVYR
ASSTLQIERNAKKVVNIDMLSAQESRSDKDFYETQRQLIQSRALARRVINQLDLEKNVASSGIISRLKSLLGLGDNSSKN
NPSVIETIFLENLSVTPVSNSQLVQINYESTDPKLAADIANAVTKTFVRMNLERRFDTASYSKEFLTSSISKTKKDLEDS
EKRLNEYATKYGIIQGVEGEGSNTHSLKKMAEELITAGKERIEAESAYEQSKQTLNDENATSVRILKDPYIQSLKKTLAR
LEANSQEILKTHSPRSSKARRIRKQIDEVRSQINIESYAIKSALKSEFFAAQQKESMVKKQLELLKKETLEIQGKTIKYN
TLLREVQSNRDLYKNLLGQLKQVNIAGNVNSNNISIIDKAGIPYKKFKPNFKTNIAFGLLLGLLLGMAAAFLREFMDDSV
KNPDELEKLTGLPVLGMLPAQASQSPSSVALQTYNEPKSPLAEAIRSLRTSLRFSTQEGAPKSTFITSSAAGEGKSTVAI
NLATAYAQSGNKILLIDADLRNPSLHKLFKLENYSGLTNYLAGGGSSSDIYRPTMIKNLDVITSGPIPPDPVELLSGKRM
GTLLSNASADFDYIIIDGPPVLGLADALVISGLCDATILTIEAGKTRKVTLMKTLKRLERAHSNIVGLLFTRVNSSVDSD
YHEDYHYPYSGDNDKTESINSPVVTPLKLHRRA
© 1998-2019