BYKdb

Dataset for cluster orphancd of phylum armatimonadetes

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A3C0CSI4 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Armatimonadetes bacterium] (length=450 residues).
QEIDKLNSTRAELLQEYIPSSREVKKVDGQIEDAEQRLKKVAQTVLSTTTNSRNPLWENLLKDFSGSIAESSALDTKVQV
LNRCLVQREMDFKVLPELERELTTRIQNIAILERTYDMLSQKYYTLLLSEQSMLPNGILISKPRVPEAPSYPRTDRNIAL
FAMLGIMLSVVVAIVVDRMDIRVHDPSVMAGIADLPSLASIPFMDNEDAAYKQIGKLKHNSIFLESFRILRNNIMFSAID
NPLKVLAVSSPGPGEGKSTLAVNLAIAMAMDGKKVLLVDCDLRRPSIHNWMSLSREIGLTNVVKGLSNIKDAVCSTDIEN
VFCLPSGPLPPNPTEFLNSKHSRNIIKELSGMYDMLILDCPPCTGLSDVQVISTMADGVLLVVTINRTLKTYLHMALSTL
SQVKAPIIGYVLNMVDSRRQGYGYYYNYDYDEQGGRNKSKRRCCMPKSKN
>gnl|bykdb|A0A402CP56 [Bacteria] Bacterial tyrosine kinase [Armatimonadetes][Capsulimonas corticalis] (length=713 residues).
MQSEPLLIESEESQPVMSPQDYVSILRRRRNTIVTTWILISAFGIIVTMATRNVYQATAKLLVDGPSMMVSQVESDNNLA
SLFNIGSEQTVDTKVEELQAGPLINTVDKLSNHAKLTVTAVKGTNVIDIVGESTDKVAAAAAPNTLIQLYLQTTAETDLQ
EVHKAQKFAQKQMTDAQARLDKANRALELLKQKHGFVDIAKSRDDQIARVSSLTQQLQQARAELAGARAQVSGLSNLVSA
EPATLDVQLRQTNTEIAEIKSKITQRELDRRQMTLPGGFTAKAPQVRALDSEIAGLKSQLAALPAVSTTMTSNPNTVREN
LRAKVASSEGDVASLEARVLETQTLLEQAKSELATYPSLEAPAEQYQNEHDTALASYQMYATTLQNLNLREQARHVSAHV
IEPAVVPTEPIRPKRLLNFLFAIIMGGVIGILMALLQEYLDDRLNSTEDAERLLGLPSLGRVPQLSRDDALLLSNMSGPH
PELEAYKTLRTNIHFAAIDTPFRSLQVTSSSPGEGKTTTATNLAYAMAADGKRVILIDTDLRRPSVHKHLDLAQTPGITE
LLVGDATLHEALQVSPNFPNLSVLAAGTIPPNPSELLNSQKFRTLVDQLSARFDIIIFDSAPVLAVADAQIVASQADGVV
LVVANGETRKAAAKQGLNLLRRARANVIGVAFNKMNVKDNMYYYRYTAETSTEALPGRNGHSTRQIETEGTKK
© 1998-2019