BYKdb

Dataset for cluster cd of phylum bacteroidetes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|B7B947 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=406 residues).
SSSKNPVVQDLNNSLIAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLN
KREENELTQRMTESNARIIDPAAGSNAPVAPKAMMILLASVVLGCAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEI
PMRDKKDKNEVVVHENGRDSVSEAFRIVRTNMDFMRVKEKNMQVVMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLD
IRKGTLSSHVQVSDMGVTNYLSGRIDNVDEIIQKGELYDKLDIIHAGPVPPNPAELLLSDRLEALIAELRERYDYIILDN
VPAGVVADAVIVNRVADLTIYVVRAGRMDRRALPEVEKLYREGKLRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGY
GQRKKK
>gnl|bykdb|B7BDT8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=535 residues).
NQIAVSTSAFISDRLGVIEQELGNVDENISSYKSEHLLPDVQAAASMYMEQSSATNAQILALNTQLSMARYIRNYLTNST
SKNQLLPANSGIESPGIEQQIANYNTAQLRRNDLVANSSERNPLVIDMDQSLENMRHAIITSIDNHITTLNTQIRSLQQS
ERQTTARIAANPTQGKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTRVITPPSGSMIPTAPVKKNIALVAFAL
GLLIPVVIIFIRENMNSKVRGRKDLESLSVPFVGEIPLVGSGKKKKKTANTAKEIVIHQGKRDIVNEAFRVLRTNLEFIL
DAKEDKDKASVTLITSFNPGSGKTFLTMNTAATFAMKGKRVLVVDGDLRHGSASAYVGSPKKGLSDYLGKRENNCEDLIV
EKENYPGLFVLPVGTIPPNPTELLAEPRLAELIEKMRCRFDYILIDCPPVDIVADTQIIEKLADRTVFIVRAGLLERDML
PKLQSDYEAKRFKNMALVLNGTIGGSSRYGYRYGYRYGYKYGYAYGYGSKSYYNN
>gnl|bykdb|C2MBF8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas uenonis 60-3] (length=244 residues).
MIDQASRTFVVGRHRRSLVSEAFTVIRSNISFLAPDNGAPVKRILVTSAIPGSGKTFTSSNLALSLAQSGKRVLLIDCDI
RKNTLSKAIGMHCRGQLGLSSYLSDARITPEQIMSPSLQTESLIFLPSGPIPPNPTELLMSPRFEELLQYADEAFDYIVM
DTIPVLNLADTRVISHLTDITIMVVRENHLPRRLLHELEALYRDKRLKGLCVVLNDAGIGASAYGYGYGSYGYGSYGSYG
SEKE
© 1998-2019