BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Alignment] [Repertoires]

157 sequence(s)

>gnl|bykdb|A0A015VNG0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3996 ] (length=702 residues).
MAEVVKRLNLDMSYFQSGKFHRQVAYGLTLPVTVSMNDFPENESAEFILEVKPDRTVILSDFTRNDETLDSDEIKGILLD
TIATPLGKIIVEPTLNFNEEKTCLLHVFRNKLYDAINNYSENLSVTLNNEKASVIDLSFKDYSIQRAEDVLSMLISVYNE
NWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQSSQTNAQILALNNQLYMTRYIRS
YLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQALASMRGAIIKSIDNQIVTLNAQI
KSLQQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTRIVTPSHGSMLPTSPVRRNIF
MVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFARKKKGLFGKKPQEVKAIVVKEGSRDIINEAFRVL
RTNLEFMTGKDKRSNVIVVTSFNPGSGKSFLTMNMAVSFAIKGKKVLVIDGDLRHGSASSYIDSPAKGLSDYLGGRIDNL
NEIIVADSKHESMDILPVGTIPPNPTELLFDERLKQVIDTVRERYDYVLIDCPPIELVADTQIIEKLADRTIFVVRAGLL
ERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGYGYHYGSDEKRGG
>gnl|bykdb|A0A069ZM60 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. KLE 1280] (length=796 residues).
MSTQTNRSNQAGEKAAEVNLLDIFFYLLRFWWLYLLSVGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDTEMLRY
ARAARLNMDNEHVQLVSRRVLERTVKMANANVFYNVKSGLRTLELYSDAPFSMKFLDTTERKSTYEVAFQDAGHVRVTPV
HTGKSQVVPLNVPVQLGDERFIIEPHQNFNTPWEYKHIEVNRMPFTQTVRYYQHAILVAEPENRASTLTLRLQDRTKKRA
LDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDIQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPISPNTLRVVLIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPREEKRGGKKSQPRGVREQGGD
ETSEAFRVLRENMRFMIGTGGKKAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|A0A076IRY8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A078PL82 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3725 D9 ii] (length=789 residues).
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A078QKV9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides ovatus str. 3725 D1 iv] (length=789 residues).
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A081PBV5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter antarcticus 4BY] (length=794 residues).
MDNLNNINLMPKAKEEKSINLLDILKYLLFQWKWFLLSIFIFGGYYLYQYSKTPFIYSRSETIMIKTPLNTMPGTRITRA
NYYNTVNVASEILQLRSKELMRKTIDRIEGDISYTVKKGLREYELYKDAPVKVQFIDAKPEVGFSLQIEAVDQDHVALSS
FSKGNTSQVLKIKLNQTVRTPIGLLKVTRSPGYKVSDFDKPVIVRKYPREAMVGYYMANLKIQQMEEDASLLQVFVEDSS
LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQSELGSVESNLENLKVSNQGIDVNAASQMYVSEGMMHES
AGNDVQTQLKLVEMMQNYMRDADKKDDLIPNNTGLVDVNIENRINEYNTASLRRNRLLEGSSSENPIVQDLNITLAAMRK
NIYRAMENAVSGLQIKINNLKKEQTQARNKAMAVPAKQRMMLSVERQQKVKEELYLLLLNKREENAINQAMTEDNVRIID
PASGSDAPIYPSRIKKLALGVGIGIALPAIVFLLMLMLDTGVRSRKDIEEVLSVPFLGEIPFTLKDKGGEAVVEEKGRDY
TSEAFRILRTNIGFMAAGKEQRVITFTSFNIGAGKTFTAINLAASFRYLNKKVLLLDLDLRKGTLSNRVNAQKEKGLGVT
NFLANPKVTVDDIIYQGLVGGIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYDYIIVDNVPVNLVADASIVDRISEL
TIFVVRSGKMDRRQLPEIQSLYDQRKISHMAVLLNGVRLNKGGYGYGYGYGYGYGYGYGNETKKTIWDKLFGKR
>gnl|bykdb|A0A0A2DQN2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. COT-239 OH1446] (length=789 residues).
MIRQVSDVNLLDVLRYLVSYWKWFVLSVLICAGYMYYRSAQQPYTYMSEVTVIIQDPSQRTSIDFDFINPRQRGRANIEN
ERLILRSQRIIENALKKIDAQVSYKYKKEFRMIELYKASPIRVSFVDSLELYDSFFVSYKDENQVSVSYNEEEHIFLLGD
TISIGKNRLIIEPNPNYTSPWIARQIQVSRVPVPALAVAYQGSLSIGQPEGRATILSLSITEASKQKATDLLGALVEAYN
EEVNTLRTQISVNTTEFINNRLISLEEELESMENNREELLIENQFINPASLAESYMNRTQTNQNGRIELEAQERLIAYMQ
SYLKDASKTNEFLPLNIGIMSPALDESIGQFNQIKQERDLWMQATGASQDNPIVERYNQSMHVARAAVARALKDAAAAIS
IKLKEMRYQDNQAYAELVTLPPKERQWLDAERQYKMKEALYTQLLSKREENLFAQTITNNNAYILDLGVGTSAPISPVPS
RSILLGIVLGLFIPAAYAILKLLTDTKIHSRRDVVDQVSLPFLGEIPLNTTKKGGEGIGVSEQGTDLTSEAFRILRSNMD
FMGQNGVMPKRIVLTSFGAEAGKSYISYNLAKSLVFAGKSVVLIDIDIRKRTLTRKLNFEHNMGLTSYLSGMDVSIDELI
QQDPNCEMLSIIPAGTIAPNPTELLLSKRLDSLIDELGRRYDYVIMDNVPFGVVADASIVNRAADLTLFIIRAERMDRRM
LPELERLYQEQVLTNMAIILNGVNHNSSSYGYGYSYGYGYYGYGYGYGHLGKKSLRKRFVERMKMFFVS
>gnl|bykdb|A0A0A2EYC8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium COT-184 OH4590] (length=813 residues).
MENTNNIPNIQTFSEEEASSFNLMEWVMRFLKYWYLFAIGVVIALTIAYYQNRSFVPIYNSSLRLLLKQESGSFLSMQNF
NSGFSRQDQTNIENQILLLQSQDLIGRTIDSLPNFKIDFYRKLKFKNRPMYGRSPIDIEIISTPDAGFWQYYLYQKQNDN
EFTIKIFDNEDVELETVKGRYNEPVGCKYFLIKVTKNSNYHSANSVNFVFRNRDNLVMEFASKLQINLLPNTSVLNISVA
SDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVISDSLSRSESNLNSFKIANKMYGQNNSILLTNKMEAL
EEQGKIIKLRDEYFKYLRNYLKNNIDSESLASPTTIGIQEPRLIALVDKYNELQIKLLDLGVKNPQYDIVFNQISQTKAQ
LNELISSVSDIYKIESDAYQKDLNELNNLLIAAPNKELRMLDYERRYKINDSYYTFLLQKRSEAQIRKASNSPDNAVMQK
ARTMSLINAKEKQNKYIVFLLIGLAVPAALIILKELLNNAIRTEKDIEKAIKNKFQIIGTVRHTKHKADEKVIAAKYPNS
YFVEQLRVIRTKIELILKRKERITMLVSSTESGDGKTYISLNLAGVFALQKKKVLLIDFDIRKPNLTRNLGDIIKTKSGF
VNYMIGDCTIEEAIESTPYGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYDYVVIDSSPLGLVADAYALFSTVDIKL
LIVRSLKTNKVEFTDLAKRLYADNVEDIYVILNDVDKSKVGYGYGYSKYKKMGNYYVTEEFEQDDISMLEKIIDKIGEKT
KRIRNIHSSRLFK
>gnl|bykdb|A0A0A2F2N5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. COT-290 OH860] (length=792 residues).
MTPQSSSKQTKSAGTVVADINLIDLFFYLLGYWKWFLLSILLCTGYMYYKSAKQAYTYESVVTVIVRDPAQRTSIDLDLV
GRRSRVNIENERLQLRSRVVIANAIKAINGHVHYGIIDGLRPIELYKSAPIQVTFADSLDQYHQFEVTYKDASSIVLSRE
GGETKQVQLGEEVTYEKSRLIVVPSKGYNEPWPNKAIKITRLPVKDLAASYQGRLFIGQPENRATVLSLTLTDNSKQRAT
DLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLSEELDALASNIDSFQRANNFIAPEVVAGAYTSRAQTGHEASFEI
DAQKRLARYFLDFINNPSKRSEYLPQNIGLNNAALETAITAYNQVKPEYDRWLATTGGMEDHPMVQKYAKAMEQTRMSIS
HTLEGYIKSLDLQLREIEIRNRQGLAEMMAVPNKQRQWLDIERQQRMKEALYTQLLSKREENTLAQTAQSNNAYVMDFDT
GSNSPISPNTTRTLLISFAIGLFIPTAFFLLKLLADTKVRTRKDVLERVSIPYLGDIPQSDTNLFVAVEPQGSDAITEAF
RVLRTNMGFMKKYGRTSGQRIMCVSFGANAGKTFTTYNLARSLIFADKKVVIVDLDLRKGMMSKRLEMSGRGMTNYLSDD
SIKIEDVLRQDKNCPSLHVIPIGSSAPNPAELLMSERLDALMDELSARYDYVLIDGVPFGIVADATIVNRVVDLTLFILR
SGTVDRRVLPDLQLLYDEKILNNMAIVLNGISSQNKGYGYGYGYGYGYGYGYGYGYGNKKERSGIFSRFRKS
>gnl|bykdb|A0A0B8T471 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium deserti] (length=795 residues).
MDNTNYNPYIESREKEGKSLNLIDLIKYLLLHWYWFVLSVLLFGGYYYYQYSKTQFLYSRSQTVMIKSTTNTLSVSRATR
LNSYYNTVNVAGEILQLRSKELMRNTISSLRSDVSYSVQHGLRTVELYRNSPFEVKFLNIKPESNFSFTLTAIDSTKVRF
ATVDGDVENYTTIPIGKEIKTPFGNMVVDTTAKFTSSYYGEQVTVSKNAMESMVGYFLSRMRIEQMEDDASLLQMSLEDV
SAERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIETELGGVETDLEQMKARNEGMDVNTATGVFWGESREYQ
STTRGIETQLRLVELMRQRIDNTESRNDLIPSNTGLVEDNIEAQITEYNEVLLKRNRLVGGDNSANPIVKDMDAALRAIR
DNISRSVDNAAMGLRIRIRNLQQEEAASRAKAQSLPAKQRMMLSIERQQKVKEELYILLLNRREENALNQAMTDDNLRVV
DPPSGSEAPIYPSKARKVMTGVGFGVVLPTVVLLLLLLLDTKVNGRKDIEEAVSVPFLGEIPFSKQTIRANDDVVVNEQG
RDPATEAFRILRTNIGFMSSAEREIRVITFTSFNVGAGKTFTAVNLAASLTFLLQNVVLLDLDLRKGTLSDHLKLGSVKG
VTHFLADPAVSLDHITYKANVGNGVDVIPIGVIAPNPVELLLSKRLDVLIAQLKERYRYIVVDNVPIDLVADAAVVNRIS
ELTVFVVRAGAMDRRLLPEIEKIYRKGKLNNMAILLNGIRKLKSSYGYGYGYGYGYGYQKEKAGLRGFFNRLFRR
>gnl|bykdb|A0A0D5BSQ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=787 residues).
MINQNKQNVQKDGIINVLDILKYFLFHWKWFALSVLIFGGYYYYQYSKTPFVYNRSEVVMIRTPSNTPTTARITRSSSAN
VISVKDEILQLKSKELMRQTIDRIGADISYKIRKGLRDYELYKKSPVQVKVEGKSSEDNYAFTVIPVDMKHVVIKNWSNT
NKNEEFKVVLNQSVVTPIGKVLIKPSKFYKKDYYGTEIQVTKSPRESMTGYFVGNLVVKQMEEDTSLLQITLSDNSSERA
SDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIEAELGAVESNIENLKVANQGIDVETAGSMYLAEKNQYKTDRTK
VETDIRLAEMMRSYLGSRDQKNALIPNSTGLVDANVETQITEYNTALLKRNRLAEGGNTSNPVVLDLDEALKAMRNNIGR
AVDNTLRGLNVRLNNAKQEEATAQSKTLQIPQQERAILSIERQRKIKEELYLFLLNKREENALNEAIAESNLRIVDPPTG
LDFPVSPNKLKKLSIGVAIGAVLPAVVLLSMLMLNTGVRGRQDLEDVLSVPFLGEIPLMRSRKQGKSDVLVSKSGRDPLT
EAFRILRTNINFMAKNGEPPRVITFTSFSAGVGKTFSALNLATTLSYLEKKVVVIDLDLRKGTLSSRIDLLHGKGVSHYL
SSPSVSVDEVLHKSEVANGVDFVPIGAIAPNPVELLLSKRLDELINELKERYDYVIIDGVPVGIVADASIIDRVADLTLF
IIRVGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGYGSYGYGYGEEKKKSVFDWFKRS
>gnl|bykdb|A0A0K2HKS3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDA
RVLDPAGGGDTPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|A0A0L8VEV2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sunxiuqinia dokdonensis] (length=793 residues).
MKTMEDFSKSLEREDMLAIKKFFHKLKRNWYWFMIAGIIGGAGGYLLTQVTPPSYELNSLFLIKKKDNAQVQLDLPFSNA
MGGNINLLNHIGILTSHSINRQVLENLDWTTSWYEELLLRDDEMYGNEPFEILYDRQAMNLEGIPIHIQMLDTSNFQIEV
KGKKMVYGKEVEIEFSQKGKFGELFSNDYFNFTLYPKYAKRGNQYYFTFNNFENQVKKYMNRLVIEEPEDKADLIYLSLI
DQVPQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVIDTLQVAGNKFTSFRSQNQIVDIGQEGGIIVQRLVD
LDKERSLAQSHLDYYRNLQKYLSDTEKMQEVVAPSVVGIVDESLNNLVTQLSDLYRQREVFSYTVQEKNPKLILVNNQIE
MVKRNLQENLKNLINNAIVQIQGLDRRVDQVNRQLSAHPKTEQQMMNMQRMYDLNNELYTFLLKKRAEAAITHASNVSDT
EVLDEARPELAELMGPYLTFNVAGGLLAGLFVPFMVIMLATYFYDRIKSAEDIEEYTDIPVIGNIVNSGIGSEYLAAIDN
PRSAIAESFRELRTNLQFIVPGLKNKSLVIGVNSVIPGEGKSFTAANLASMIALNNKRVLLIDCDLRKPSLHNRLKYKNK
EGLSTYLTDFSSFDDIFRQTRVENLQFVSAGPIPPNPSELLENGKFEELIERCRDMFDYIVFDNPPLSLVSDGIVIGQKV
DINLFVTRQDYSKKNEVRFIDHVNKKKAMKNAGIILNDIHLSKHAHVGAYGADYSHRKNSSYYYFDSSPSYTG
>gnl|bykdb|A0A0M1W1I6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 9_1_42FAA] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRIQNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDVVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|A0A0W8EPA0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=794 residues).
MDTINQKNQVIGNKKEHSVNVLDILKYLLHNWKWFALSILLFGGYYYYQYSKTPFVYNSSEIVIVKTPSNTPTTARITRS
FGANSISVKDELLQLKSKELMRLVVDKIEADKSYKVHKGLRDYELYKKSPVQVKVEGKSSEDSYNFTVVPVDANNVIIKN
WNPASKDKEIKVALNSLTSTPVGKVLITPSKYYKKDYYGVEIQVTKFPREAVMGNFVGNLSIKQMEEEASLLQVTISDDS
PDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKSQYKS
EGAKIETDIRLAEMMRSYLTNKGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNSSNPVVLDLDDALGAMRT
NISRAVDNAVRGLNIKLNNTRQEESIAQGKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAIGAVLPAVVLLSMLMLNTGVRGRQDLENVLTVPFLGEIPLARGRRQGNGDVLVSQSGR
DPLTEAFRILRTNINFMTKDEHPPQVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNSSIKISDILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKIYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGSYGYGYGEEKKKTIFNWFKRS
>gnl|bykdb|A0A134B4F8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium KA00676] (length=796 residues).
MSTQTNRSNQAGEKTAEVNLLDIFFYLLRFWWLYLLSIGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDADVLRY
TRSTRLNMDNERMQLVSRRVMERTVKMANANVLYNVKSGLRTIELYTDAPFSMKFLDTLERGSSFDVAFQDASHVRVTPA
STGKSQVIALNVPVQLGEERFIIEPRQNFNAPWEHKHIEVTRMPFTQTVRYYQHAIMVAEPENRASTLAIRLQDRTKKRA
LDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDAQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPVSPNTLRVVLIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPREEKRGGKKSQPRGVREQGSD
ETSEAFRVLRENMRFMIGTGGKVAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|A0A134B8C7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas somerae] (length=796 residues).
MSTQTNRSNQAGEKTAEVNLLDIFFYLLRFWWLYLLSIGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDADVLRY
TRSTRLNMDNERMQLVSRRVMERTVKMANANVLYNVKSGLRTIELYTDAPFSMKFLDTLERGSSFDVAFQDASHVRVTPA
STGKSQVIALNVPVQLGEERFIIEPRQNFNAPWEHKHIEVTRMPFTQTVRYYQHAIMVAEPENRASTLAIRLQDRTKKRA
LDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDAQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPVSPNTLRVVLIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPREEKRGGKKSQPRGVREQGSD
ETSEAFRVLRENMRFMIGTGGKVAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|A0A136LSC7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium OLB12] (length=772 residues).
MLQPKEIGPQVQSIDTEKLSAVIRKNLVWIVLIFIAVNLAAYLTIRYTKDLFESESEMKLDIKRDATELGIKTYMEDQNV
NQVSGEIEQIKSKIFFNQVLDSLDFEVSYYSLGKVLTDEMYKRSPFRIKASHINPKHYDQPIYFDFLDNNEVSLRLKGAV
STRGSMGNPVEFDGTVLTITKTNYFTENDGNNYYFVLNSRKSLIEYLSKNIQVDPLNFNANTIRVSFRDHNAHKAYDVVN
KIDSLYIVYSNQQKNLANKQKIEWLNNELVQVEEKMEGYENYFESFTLQNKSSDLTLDLKKTIAAINVVDSQRYSLNKQL
AELNTLIDQITASDFANAIRPANSFPESILQRIEELHKKTRERDKLALAYNENTFAFRQKEREVSLVKDELFNQLSTLKK
EWLADMAELGKRKEKLERAFAEMPDKNTQFSKNQRYYKLYEEFYLTMMQSKAEFEIAQAGSTPDFKILSPATLPIKPISP
SKVMVLGIGFVAAIVLCLFFIGLVYLLNNKITSVKEVERGINLPMLGAIPASHHTVQSLFHVIDNPKSIVSEAIRTLRTN
LEFFNTGEKCKVITITSTVSGEGKSFLAMNLGGVLALSRKRVILVDLDMRKPKSEKYPTGNDSSMGMSTILIKKNNWQEC
VLKTSLENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYDYVVIDTPPVGLVTDGVMAMKRSDLSIYVFRANYSHKDF
LQNLARVVTLNKLTHVSSVLNAIPLSGNYYGYGYYEDKTPRRKRWIKIFGLK
>gnl|bykdb|A0A139L1N2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVNAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A142HHS5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. PAMC 26554] (length=831 residues).
MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLSTLVLVARRSLPWVIFLLTLGITSSWLYMRYTKPIYE
ATSILKIDDHSDASALGLGMAMGGAENNQASQLAGEVELIKSGLTYKRLKQTVPLDINYYTQGTVLETELFGNCPYRVTY
VISDPAYYNHKFDVEYIDAKHYRLNVTVGNAKLGGNYEFGQLVKLPGISLRLLSASSPAELDAIYHFVIVDDNTINSYLD
HNLKAEVLNPIANTIQISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENGQNLAKAEDNLKIFVQ
QNGTYDAKGELGTITNKLEKIEEDRFKLEQKLTLLADVSQRAAAERLTPSDEVTVDQTIPGLALLEDPALSQQLNNLNAL
QQNLRRIRRSYQDRLEAVQGPLAQLKFAQATLQHQLVQAQKQLRGQIALLDTQQGKLSNELQLIPGKETELERLKRPLGL
YGNSYQMLLEKKVEYNIKNAGTTADFQILSPAFAPEEPISPKKLLVYAIGLAGGLILGLGLIGTRYLMHNTITSVNELER
NTKASVLGVIPTYDKEQLNISRLIVDKNPKSSVSEAIRSIRTNLDFISPSNKKRLISVTSTISGEGKTFVTVNLGGIIAL
SGQRVVILDLDMRKPKVNLAFDAENVRGISTILIDRHTVAECIQHTSIESLDFISAGPTPPNPSELILNPRFDLMIQELY
RTYDVILIDTPPVGLVTDGILIMRKADVPIYIVRANYSRKTFLKNMNRLMRNNQFTRMTTILNDAKAQGSYGYGYGYGYG
YGYGYGTKGMGYYDETEQKPTLGKRIKSLFS
>gnl|bykdb|A0A161LWY6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter jiangxiensis] (length=796 residues).
METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFKILRHWYLFVIALAISLSISFIANRTWKPSYQVSARVILGGGQASAS
QQMVMQGVNLNMAYKNNDNQMIMFTSNDLVERAINKINANVDYYTTGHFKVSNLYGYAPIEIKGDNISDAVSGLEFDFRD
IDGVTYEIAHQKDKQLDELRYTGRYGSLLNTPYFSVVVNKTDNFEPRKKINFAFLSNAYLIDYFTPRISLSFVTQNSTVL
AVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDISDSLRTSESHLQHFRKANQILDLNAYGSTIL
GHLTSYDEKRLQYNLKESYLNYLADYIKKNVNNQELLTPSSLGIVDPVLTGLLTQYNETIRKLLQTTPQNPFYAKYQEEL
NKLKGSLTDALRNVRAAFSIEKKDIDTQSRKASGQLATLPDIETQMNSFERQFKMNDTYYTYLLQKRAEAQIQRASNVPD
NTILERARMISITNGGDKKKSMMMALALGLIIPLLIIILKEYLKTKVMDKRDIEKLSPFPYIGSLPHATHDDATITVLKR
PKSAIAEAYRMVRTRIKFVSRQMDASCVIVTSTESGDGKTHFCLNYASMCAMTGEPTILVDMDLRKPSVSKRLSLENETG
ITNCMLGQVSLDDAIIKKSPEINFDLLLAGTIPPNPGEMIRSPKLLELINELKMRYHYVIIDTSPVGIVSDAYPLAPISD
CVIYITRSRKTNKKFFKSVINQLKTDRMQHVGVVLNDIDANTGGYGYNYSYQRYGYGTYGNNPVTKDYIKDYYEEE
>gnl|bykdb|A0A174C2Q8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides xylanisolvens] (length=781 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINLLPERHISFVVTPKDDATVTLSGFGGL
PAAGESYEVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|A0A174SDD8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFIYLLVHWKWFVLSILLFGGCFWYIYCKTPFEYSRVAIVMIKTPANSRSTMQLNNSDFA
GQVNVASEILQFKSKELMRKVIDRLQANICYTVHEGLRPVELYTESPVRVAFLEAGTDEAHSLSVTPKSNVQVELSDFSR
GMEQRKVVKLNDTIQTALGKLVVFAAENYGESCFGKPIVVTCKPLEEMVSFWLNNLSIRQMSGDAALLRIAMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKKANNGVDINMAAGMYIQDSRQYESSIKE
LDTQLQLVTFIKQYLQDSSKDDELIPSNIGLEDLNIESQIARYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKQNIYR
ALDNLSTTLRLKKQDYSLQENQVRQKVQAVPRKQREMLSVERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLMLGVGCGVIVPSVILLLMLILDTGVHNRKEVESIVSAPFLADIPQTPKAMANVHEVVGRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMSHCTQVKGVAHYL
SNPSIEVNDIILRDAFGEGLDLVPIGVIAPNPTELLLSKRLDELVDKLRERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A174TVL8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A1A6CF06 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=789 residues).
MNQYSKNSVQKENTINVLDIFKYLLFHWKWFALSILIFGGYFYYQYSKSPFIYNRSEVVMIKTPSNTPTTARITRSFSGG
GVSVKDEILQLKSKELMRQVVDKVGADKSYKIHSGLRDYELYKKSPVQVKVEGKTQADSYGFTVTPIDTRYVLLKKWNET
SEEELKIELNRWVVTPAGKVFITPTKFYNKDYYGKDIQVTKSPREAVMGYFIANLKIKQMDEDTSLLQVSIEDVSSDRAD
DMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIEGELGAVESNIENLKIANQGIDIATAGGMYLSESSQYKTEGTKI
ETDIRLAEMMHSYLNNKNKRNALIPNNTGLVDTGVESQIADYNTALLKRNRLAEGGNSANPVVLDMDEALNSMRNNISRA
VDNALKGLNIKLNNARQEGRTAQAKVLQMPQKERTMLSIERQHKVKEELYLFLLNKREENALNEAITEANLRIVDPPVGD
AYPIYPNRLKKVFTGVAIGTVLPMIVLLSLLLLNTAVRGRQDLENVLSVPFLGEIPLARSRRQGKGDILVSKTGRDPLTE
AFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVIDLDLRKGTLSSRVDLLHEKGTSHYLS
NSSISVDEILQKSELLENVDVIPIGAIAPNPVELLLSKRLDELINELKNRYDYIIIDGVPTGVVADASIIDRVADLTLFI
IRIGKMDRRQLPEIEKIYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKRKSIFSWFKRS
>gnl|bykdb|A0A1C5XJA7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Bacteroides sp] (length=778 residues).
MQNNIQSNKNDQNINLLDLLMYLASKWKWFIMSVLIFGGIAWYKYATAPLVYFGSATVIIKDPSSKTTTTGLDRFDNFIN
KVNVANEMLQFNSKRLIREVVSRTHADVSYKMKDGLRNVELYTKSPVAVSFADMLPEQYVAFTVTLLNKDSVEITDFSMA
ENGERQVVELNDTISLNEGKVVVVPTNYMTESWIGVPVKVSKMPLDAVVSVYRNSIAVKQEEEESSILTLALKDNSSERA
EDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIGQELGDVESDLESFKRENQTLDISSSASMYMGESQKYNSSALE
LETQLRLAQYIKEYLTDPKKEADLIPSNTGISDMNIENQIGMYNAAKLKRDRLISDSSDKNPVVEELNSSLRAMKQSIIR
AVDNMIVSINVKRNDAQNREMRVQERLSAMPTKERQMLSIERQQKIKESLYLFLLNKREENALSQAMADNNARVIDSAEA
TKYPISPNRNKILALGILLGLALPTVSFLVIMFMDTRIHSRKDILGAVSVPFLGEIPLDKNYKSSRKGAANAYGYGDNVV
TEAFRILRTNMSFMAKKDRPLQVITFTSFNSGAGKSFVAFNLADSLAYTKKKVILIDLDIRKGSLSHRMHKHGVGMTNYL
ADETIALDDIIHDCGKDYDFINAGTSAPNPAELLMDSRLDSMMEELRKRYDYIVVDNVPVGLVADATIANRIADITIFVV
RAGRLDKRQLPDIEKLYQEKVLNNMALILNGADLERHGYGYGSYGYGYGYGYGNNKNK
>gnl|bykdb|A0A1F0I8C4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. HMSC073E02] (length=789 residues).
MEKQRKLALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDF
MGQINVASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFS
KGTELRRVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVR
AADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIK
ELDTQLQLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIF
RALDNLSASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVS
GSNIPISPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPL
SEAFRILRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHY
LSNPLVSADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTL
FIVRVGKLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A1F3D6P8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWA2_40_15] (length=787 residues).
MTKETDSGIALIKHYLQDIAYFKYFYIICLVILLTVAFLFNKYSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN
RNLESGISNFISFPTVSSTISSMNLEIGYFREKHHLFRQVSELYLRSPYVVIMDKSHIQPIDVKLRVFILSDTTFRLVID
QNTVSLYNYLDNQIVIENVPLKVDTICRFNETIRGKTFKFSVSFNRDFYTRETNMEDFYYFSFFHLDYLTKDYLKKLEVE
PISPKTSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQVMD
LSFQGKSLYEKLEQIETERANLQIQERYYNYIINNFKSSNDMSGVVPPSAMNVADPIMNQLITQLLLLYSQRSGIASNNA
EKNLFLGQIDNKIKVQKQAIIETVTNNLNTLNLSLNELNYRADKLSREISQLPRTELNMVGLQRKFDLSDVIYTYLLQKR
SEAAITMASNYPDFEVIEPAREFTKKIIVPRPKLSYLLAIFFGLAIPTTFIFIRNFFNNKISSIYDLESLINQSGMGVIF
NNNYKSEAVVLEAPKSAIAESFRNLRSSLFLKLKSEKSKVIVITSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKP
TLHEKFKEDNSSGISNFMVKNATVTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGL
VADATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSYYLKK
>gnl|bykdb|A0A1G1TG88 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter coccineus] (length=624 residues).
MKVTPTQYFGPASLAAKYHFTIQDQGTVNAYLEKNLAVDISSADANTIQISFTDFNPRKAQRIVNKVDTVYQRAKVLREQ
ENTARTLRYLDQQLEVNYDNLERAENRYQGFVEQTKTYDVRSEVAALAAKGEDLEEQRLKLNQNLVLLSDISRMVQQTHI
TRNEEETVEQSIPGLGDINDPVLSQLLGQLNGMQWDQERVRRSYTGATEAVQQKNAQMDYTLSSILRQITQARKALANRI
ALLDRQQNKLDAKQQGLPSRATEQARLQRPLALAEGTYTMLMGKKVDYNIQKAGTTADFQILFPASEPRVPISPVRLMVY
AIGLAGGLFLGLGLIAVRYLLHNTITNTRELERSTQAAVLGVIPTYDKEKMEVSRLVVNDNPKSAISEAIRSIRTNLDFI
SSAKKKRLISVTSTISGEGKTFVTVNLAGIIAMSGQRVIVLDLDMRKPKVNLAFGAENVKGVSTILIDRHSVAECIQHTS
IDALQFISAGPTPPNPSELILSPRFDQMLNELYESYDVVMIDTPPVGLVTDGILIMRRADIPIYIVRADYSRKAFIKNMN
RLMRTNNLTRMCTILNDAQSKGAYGYGYGYGYGYGSGTYGQGYYEDHGSAPPPTLAQKLGRLFK
>gnl|bykdb|A0A1G9B1T9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Catalinimonas alkaloidigena] (length=779 residues).
METSRYSHTQALKSDPIDLSVITKKIIRKWYLLLGSLLLTLALAYVVILTTPEVYKVSSSMLVRDESATGNQQFMEGIGL
FEPQTKISDQTAMLTSFDIIRRTLEKLDFGVTYYKHDQFIQHEIYKRRPFDVELDSLSDQLIGVPIYVRFLSSNRYEISV
EADEASVYQMAEEKFAPTKARDVLIQNVQKVGQPVRTPYLNFTLIRNEQEPLDTLSQYSFMIHPLERVTEQYQKKLVVAP
FEEGSDILVLTTTGEIVEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVADSLSQVEQSLRSFRDRTRTVDI
GTTARDLNTKLDELQKTREDLLIDYRSYQNLFQYLEQNDYTEVIAPSVRNINDEVMSGLLRNLIELNQQRAQLKTSVRQS
LPAIEELDAKVKSIRAQLHENVNNLIATTKYKIESVENQIEELDSQINLLPKNEQELINIERKFQFSDNQYNYLLQKRTE
VGIAVASNASTKKVVEEARLDGRTPVSPNKILILLTAIVLGLALPVGALILADMFQDKISSREEVANIISMPLVGEVPRL
RRKENALVYSRPRSAAAESFRTIRSNLLLQNHVNGASKTLLVTSSVSNEGKTLCSVNLASSFAVANNRTIIIDADLRRPR
VHNILEKTNGVGLSNYLQGTADMSEIIQPTDQENLYVITAGKSDGHPGEILLSERLPQLINKLKMEFKFVVLDTPPVKIV
TDALVLSAYSDINILVARRGVTSKSQLMDVEELHQNNTLHNLYVVLNDVQATKGHGYYE
>gnl|bykdb|A0A1H6CKR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium lactis] (length=796 residues).
MNKDFLIKDKQTQSINVLDVLKYLLSNWRWYLLSILIFGGYFYYQYNKTPFLYKSSQTVMIKTASNTISSSRITRPNNIY
NSVNVNSEILQLRSKELMRNTIGALDANISYKRQNGLRTLELYKTSPFLVKFVDANPNMPQEFTLKSLGKNQLELSEFSN
QEEAGKPLVVALNQTVNTPIGKVIITPNPESKYRVNVSEPIQVSKTPIDAMVGYFLSNLEIVQMEDVAILQMTMEDTSPM
RAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIETELSGVESQIEGMKTSNQGLDVKSAGEQYWSDSRGYDASS
KEIETQMKLVEIMRQRLDDPSKRDELIPSNTGLVDQSIESIITEYNTLLLRRNRLTAGNSSENPIVQDLNTALNALRDNI
SRAVDNVLTGYRIKVRNLRQEENAAIGRARSMPAKQRMMLSVERQQKVKEELYIFLLNKREENAINQAMTDDNIKVIDSA
NTSNYPFYPSLLKKLALGIGIGLAIPTAILLLILMLNTKIRYRKDIEDNISVPLVGEIPFSTDLKTAKSDIVIKEQGTDE
VTEAFRIFRTNLGFMSAGDKSQKVITFTSFNVGAGKTFSVINLGVSLTYLKKRVVLVDLDLRKGTLSNITKFPMPIGATH
YLSDSAITVDEIIYKDRVDANIDIVPIGVIAPNPVELLLSERLDRLFVELKERYDYIIVDNVPLGIVADADIVNRITDVT
IFVVRAGKMDRRQLPDIQKLYSSGSLTNLAILLNGVKFTNTGYGGYGYGYGGYGYGYGYGYGNRKKKSFFQKLLGR
>gnl|bykdb|A0A1H6Z2F8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter sp. SG02] (length=506 residues).
MKQLISRYQKASIGEKNKVADNTIAFINANLARISSELVQVETRIEHFRKRHRVIDMAEDSRQALQNLNTNASEEKQLAV
HLKIVKLLEGHLRAKPSAAIPSALYPQEGNFEALIGKYNEMELSRTRALASLAPGHPDIRSIEKQMEVLRTNLFDAIQNQ
KQELALSISAIHAYGKGFEAEISRLPGHQRALLSQSREQGIQQELYLFLLKKRMETAISRSANIANARVIDPPKASPLPV
SPNRQLTILVAFLAGLLAPACVIYVGQIFNNKITSKDDISRQCDVTIIGEISQQSRADRLSRNNVRSLLREQFRSLRTNI
QFVVGERQNTVVLLTSSMADEGKSFVAMHLAHSLALASRKVLLVDFDLRKPTLASLLNLRPEGVTEHIALEKDLLIQQCA
NGPPFDFIAAGMQSMDDTMLSPKIAGLIPALKAGYDYVLLDSPPVGLVADARLLGPYADMTLYIVRQHFTFIHQLAELQK
ASEQLPDLQIVINGTRDLHRYQYNYY
>gnl|bykdb|A0A1H7RFH3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTTQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDTFGEGLDLVPIGVIAPNPTELLLSKRLDKLVAELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A1H8BJR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AR20] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A1I2A9Z9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sunxiuqinia elliptica] (length=793 residues).
MKTMEEYSNSLEREDMLSVKKFFHKLVRNWYWFMIVGIIGVGLGYLKTQVTAPAYKLESLFLIKTDNKGGLRMDFPLPSA
FGGNINLQNNIGIITSYSINRQVMENLDWSTSWYHELMFRNEELYKNEPYDVLFDRNAMNLEGIPVYVQMLDSTNYRIIV
DEKTMYYGREIEIKIDQRGVFGEIFENDYFHFTLYPKNVKRGETYFFTFNNFEGLVRNYSGRLMIEETEEQADLIRLSMV
DEVPQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVIDTLKVAGNNFTSFRSRNQIVDMSQEGGIIVQRLVD
LDTERSMIQSHLDYYKNLQQYLDDTEKMKQVVAPSVVGIVDDALNNLVVHLSDLYRQREVISYTAQEKNPKLILIGNEIE
MVKRNLRENLKNLINNAIIQVQGLDRRIEKVNQQLTAYPKTEQQLMNMKRMYDLNNELYTFLLKKRAEAAITHASNVSDT
QVLDEARPELASRLGPNLVINVAGGMLAGLFIPFVVIMLATYFYDRIKSAEDIEEYSDIPVIGNIVNTGIGAEFLAAIDN
PRSAIAESFRELRTNLQFVAPKKNNECTIIGVNSVISGEGKSFTSANLASMIALNNKKVLLVDCDLRKPSLHNRLKYKNK
EGLSTYLTDFSTFEDIFRQTRVDNLQFVSAGPIPPNPSELLENGKFEELIDRCRNIFDYIVFDNPPLSIVSDGIIIGQKV
DINLFVTRQDYSKKNEVKFIDHVHRKKSMKNPGIVLNDIHVSKHAHVGSYGADYSYKKKSSYYYFESSPSYTG
>gnl|bykdb|A0A1I2AN85 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter antarcticus] (length=794 residues).
MDNLNNINLMPKAKEEKSINLLDILKYLLFQWKWFLLSIFIFGGYYLYQYSKTPFIYSRSETIMIKTPLNTMPGTRITRA
NYYNTVNVASEILQLRSKELMRKTIDRIEGDISYTVKKGLREYELYKDAPVKVQFIDAKPEVGFSLQIEAVDQDHVALSS
FSKGNTSQVLKIKLNQTVRTPIGLLKVTRSPGYKVSDFDKPVIVRKYPREAMVGYYMANLKIQQMEEDASLLQVFVEDSS
LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQSELGSVESNLENLKVSNQGIDVNAASQMYVSEGMMHES
AGNDVQTQLKLVEMMQNYMRDADKKDDLIPNNTGLVDVNIENRINEYNTASLRRNRLLEGSSSENPIVQDLNITLAAMRK
NIYRAMENAVSGLQIKINNLKKEQTQARNKAMAVPAKQRMMLSVERQQKVKEELYLLLLNKREENAINQAMTEDNVRIID
PASGSDAPIYPSRIKKLALGVGIGIALPAIVFLLMLMLDTGVRSRKDIEEVLSVPFLGEIPFTLKDKGGEAVVEEKGRDY
TSEAFRILRTNIGFMAAGKEQRVITFTSFNIGAGKTFTAINLAASFRYLNKKVLLLDLDLRKGTLSNRVNAQKEKGLGVT
NFLANPKVTVDDIIYQGLVGGIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYDYIIVDNVPVNLVADASIVDRISEL
TIFVVRSGKMDRRQLPEIQSLYDQRKISHMAVLLNGVRLNKGGYGYGYGYGYGYGYGYGNETKKTIWDKLFGKR
>gnl|bykdb|A0A1J5HQM0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium CG2_30_38_12] (length=804 residues).
MEQNKPANPFSEEEESSFDIMEWVNIFLHFWYLFVIFVIISLGMAYLKNRTWIPSYKSAGTMLIEEYKITNNTQAMMQGF
GVDAGYKNTRNQIIMLSSYDLIGRVVDSLPQMRVDYISKGNFKTRNLYNASPIQINPDYIAPEAFNLTFKLDLNANGTFT
ITVDENKQYENFKLNGNIGEPISNNLFFITINNTNSYYAERELYFQFRSRESLISDFASRLTFNFVQEGSSVLEIAMNSE
TPERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVSKSLTVSQGEMTDFRQRNQIINVDTHAGELLGKSNSYE
SQFSTLKLKETYLDYLTKYLRTNMEDGSIIAPSSLGLNEPMLMGLVSQINDLNLKRSELSEKNMYYAKYTRDIDHIKVAI
NEVTKNMRASLEIEKNDLKEKNDKVNKEIEQLPSKEIEMTSIARKYKMDDNYYTFFLQKRAESEILKSSNTPDNNILDRA
RIIAVTNDGTQSKTTLTFLIIGLLIPAAFVALREFSNGTIRSNKDIEKNSKFTMIGSVRHTNSNDPLITINNPRSAFTEM
FRVIRTRIEFIVQRKKNIMVAVTSSESGDGKTYFSINMAGVYSMASKKVLLVDLDIRKPSIHERFNINPSQGITNFLVGQ
ATLDEVIIHIPELEYDFLPGGTVPPNAGELIRSEKLVEMFQELRNRYEFIVVDTSPIGIVADAYAIAHLSDINIFVARSG
KTSKSHFAKISKQLKSDNVEAYCILNDVMSEESRYSRYYSRRYGYGYGYGYGSGYGYGYGYGNTRKKKEASEKYFQYYQD
DREI
>gnl|bykdb|A0A1M3DPL8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium 36-12] (length=815 residues).
MNMEEENKDIKTSDFTDEESSFDIMEWVMLFVSHWYLILISVFVFMFLAYMQNRKWLPSFKSSATVIIDESRGSMNSAQV
LMQGFGIQESYRNVNNQVIMISSYDLMSRVVDSLPEFQIEYISKGRFKTRNLYEWTPISIDADFISPQAYDILFKLNIKP
DGTFTVTEDEESMPKGFNINGRIGYPLQHHLMFITINDISGNNSAKDLYFKFRTKESLIGEFSSKLALNFVMDGSSVLEI
SMVSETPRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVSKSLATSEDNLSDFRKRNQLINVSSLTDELLSK
AASFDEELNQIRLKETYIAYVEKYIQTNLNEGAIIAPSNIGLNEPMLMTIVQQINDLLLKRSELTEKNIFHSKYTREIDN
LKTAINEVIKNTKASINIQKDDLNTRLASVQKQIETLPEQELEMVGIERNYRMNDSYYTMFLQKRAEAQILKASNTPDNN
ILDRARTTSVTNQGTKSKTIMMYFLIGILLPSVFIILKELLNNTIRTSRDVEKMSAFPLIGLVRHTNSTDPYLIVNNPRS
SFTEMFRIIRTRIEFIAKRKTDITIMVTSSESGDGKTYFCINLACIYAMASPKTLLVDMDIRKPSVYQTIGCDNNMGVSN
FLANQCSLDEIIVRPDGAEFDFITAGTVPPNAGELIRSDNLKDMFDELRKRYEYIIVDTSPIGVVADAYSFAALSDINLF
VIRSNKTNKQFVKTLSNQLKEDTKSRFYSILNDVEIESASYSQYYSRKYVYGRSKSYGLGTYGYGYGYGYTSSGRSKHKG
NNTYFQYYQDDEKDI
>gnl|bykdb|A0A1M3LAG1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas sp. 37-18] (length=798 residues).
MDINNKPGADTDPYFEEIKAKTTLSFDFVLWFYRILKYWYLFVISIALFMAYAFIKNKSWVPFYGIQAMIILEDRGSSMI
SGAVPLGSILRNTENQQIVLESYGLTERTVKNLSKKMHIDYFIQTRFKYISLYTDSPIEIVIDSLETDITPQAYSKVFDV
AYVSDSQIRVSYKDGLDGEPEEAFNVVFDSPVENKFFKGTIRKTKNFKHDFLPFSFRFFTNSQLTGMYSGRVSTALKTEN
STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLERFQKETGVYEVSSAT
VRRELDVADVDRDQVAMREKTVLFTTQKIKEGIMGSAELIDPISIGLTDEIKLSRYVEEYNQELRKSKNLGPKSPIYMTA
INKLNESRVQILRELQLIQVKLQDQKDLLVKKYQNLDLKLDNLPPQERDLIKYQREYNVNEMYHQFLTQRQYEAKIQRAS
NTPDNFIWEYPRMVGGAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECEKISGLPVIGTIENISKKLAG
GVVLVKNFPKSSFAESFRNMRVRIEYMAQRENKITILVTSTEPADGKTFIATNVASVYQLMGKKVIIVDLDLRRPSVGKT
LQIDAQKGISNYLIGQVTLDEIIISHPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYDYVIVDCSPVGLVSDAY
ILSSMADTTLFVVRRAKTNKAFFKSVITQLGFDGVENIALVFNDVKGREGYYGTSRYYGDKTYYLKKNSYYHDDYFES
>gnl|bykdb|A0A1M3MEI8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter sp. 47-17] (length=816 residues).
MEQPVKPRERVIPEEEESGFDIMEWVAHFIGHWYLFVIGLVIAFGLSYMQNRKWLPEYKSTGSVIIDDSRTMMNSAQVMM
QGFGIQDAYRNVNNQVIMLGSYDLLGRVVDSLPALSIDYISQGRFKVRNLYGQSPVVIHTDYIAPEAYGILFKLSISEDG
TFLITEEEENLRKGFALRGRLGKTFQHNLFFITVNMAEGVVHGKKEVYFRFRSRESLISDFSGRLRLNFVMEGSSVLEIS
LASATPARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVAEELSMSEDEFTSFRRRNQIIDVGSFSGDLLSKA
AAYDTEINQLKLKESYLDYLVKYVKTNLQDGSIVAPTNLGLNEPMLMALVQQINELIMKRAELPEKSMFHSKYTREIETV
KNAINEMVRNMQVSMDIQKKDLNRRYAEVQQEINQLPAKELEMIGIERRYKMNDSYYTLFLQKRAEAEILKASNTPDNNI
LDRARVINVVNQGEKSKTTLLFLLLGLVVPAGFVVVKELLNVRIMTNRDVEKYSSFPLIGMIRHTNSDNPFIVAANPRSS
FTEMFRIIRTRIEFITQRKDKITIMVTSSESGDGKTYFSLNLASVYGLASPRTLLVDLDIRKPSIHKRLGVENSLGLTNF
LVGQCKAQDIIMRPDGAGFDFIPAGTIPPNAGELIRSEKLRTLFAKLKEYYDYIIVDTSPIGVVADAYSFADLSDINLFI
VRSDKTHKLFLRTLTAQLKSDNVHDFYSILNDVELKSNSYSRYYSRKYAYGNSRRYGTKSGYGYGYGYGYGYTKVSDKKN
SDGTYYQYYQDDAHDI
>gnl|bykdb|A0A1M5DFS8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas macrotermitis] (length=797 residues).
MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVLWFYRILKYWYLFVLSLALFLGYAYLKNKSWTPLYRSGAVLMMESRG
NSGVAMGAVQLGSLVQNSVNQQMILNSYDMVVRTVAKLPQMRVDYFLKTKFKTENLYGVTPITIEAKYVAPSAYSIVFEV
EPIDSDKCRIFYPGSENTAPFSMEVPYNQYVQESRFYIKINKTDRFTPNFTPFSFRFISKEELIGRYTGRTSSGYQREGS
SALAISIYGTSPAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLISDSLEQSEQTFKTFQDETGLYRIQGGDQ
RADRDAVLQGIAENKAQEELILRLTDEINNSILSNTELIDPSAFGISDTKLSQSVGEYNKIVKKLASMGEAHPLYAKSEQ
SMNNLRIKILEDLRNAQDKVQEKKENLNSRLASVESEMSTLPAQEREYARYEKRYQVNDAYYTYLRNKRYEATIQKASNI
PDNFVLEEPRQLGGPVNGDEKKKTYTFYLAIGLAIPLIFVICKEELFNYAISTKEDCERLSGLPVIGTIENISKKMSSNS
TTLVKNFPKSSFAESFRNMRIRLEYMAQKETGISVLVTSAEPGDGKTFIAGNIASVYQLTGRRVVLIDFDLRRPSVAKLL
NLQSKKGVSNFLIGQVSLDEITVTHPEYEFDVITAGTLPPNPSELIKTKKTKDLIEYLKTKYDYVVVDCSPIGLVSDAYI
LSKYVDTSLFVVRRAKTNKAFFKSVVNQMRNDGLDHVAIVFNDVKGREGYYGTSRYYGDKSYYLKRNSYYHDDYFEK
>gnl|bykdb|A0A1M6B6D5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Aequorivita viscosa] (length=820 residues).
MSEEFETNEAGTTFDFKGFLIRLLRNWPLFLIFLAITFSIAYYINVRKLPVYLIENLVSIRDDQNPFFTSNTSLVFNWGG
TSDKVNTSVITLRSRSHNEKVVERTQYYLTYLRDGEYQQEDAYKQTPFFVEVDTAKSQMLNHQIKVVFKDSLTFNLSVSF
EEAKNINLQNYNSKEKKSLFVEAGDFSKDFKIGEPVNTPFFNGIFVPNPDVISKMGTPYYLVFSEYDATVKRYLDINIAP
LSSGSSVLQMRMTGHNKAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKSIELSLVEDELNDFRRNNVIFDL
NIEGAELNEKLNALDLRKEAAARELDYYNTLQEYLVTRSDYRDVPAPSVAGISESSVVAGVGKIVSLAEQRNKLQYSFKE
DAPVFNDIDRQIDAVKIVLLENIRSSKSLMNEEIRTINRDIGRYEAEIRKLPKEQQELLKIERRYNLSEGTYNMFLAKRS
EAGLVKAANVSDVLVIDPAKDTGGGQIGPNTQLNYMMAGLIGFFVPILLIFVRAFFDTKVESVKDLEAITPIPMIGVIGK
NHSETVLAVLSKPKSAIAEAFRSLRSSLQFLYKQQGITGAKTVLLTSSVSGEGKTFCSINLASIFALSDKKTIIIDLDLR
KPKVGAAFNIQNSMGVVNYLINEADLDGIIQKTEIDTLDVITSGPIPPNPSELLLGERLDQLLGLLKDQYDYIILDSPPM
GLVSDALVLTKHVDATLYMVRQNYTHKNMLTFVNEKFRRGEVKHISIVINEYVEKSGKGYGYGYGYGYGGSSYKSYGNGY
HEAIKKPSLWKRMKKSITKK
>gnl|bykdb|A0A1M6MYT6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tangfeifania diversioriginum] (length=834 residues).
MKKQQNDKDILNFYGQLEEESLISKKTLFKCFRNWYWYVVAVIVAGALAWLYVQYTTSVYEIKSSMLVEEGKSGSPLGSG
GANSENIFLGLGMMNSMRNIHNQIAVLSSTPIVSRTLDELDFSVNYYSIGRFAATERYQDVPFMVVWEEDHPQIINADFY
LTIQPDGKLELKIEEEDEVMVFNYKDKTVLDELDSYSYSEEATPGTRISTDEFAFKILLNEHFNPESDNEFKFRFHSPQE
LIRQYQNQLEVALKSDETTILDLTLRDRNVRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASISDSLSVSESR
MEDFQSEHQIVNISAQSEQLLERMRELDQERIAMETQNKYYHYLRDYINTTASRELETVIAPSAMGIEDPLLNNLILQLN
DLINERLSQTSIRQNSEHPTIVRLNAQIASVKNSLRENVDNIISQSDMALENLNQRIRQFEAQVRRLPATERNYVNIERK
YKLNNETYIFLMQKLSEAQIAKASNIPDSQMIEEAKMAGTGPVEPQKRKIYALALLLALAFPTGIIILLDLLNTKILSKD
DVEALTDYPIIGHVFNNRKESESHTLVLDKPNSPASEPYSAIRTKLELITKGKEHAVIAVTSSFPSEGKTYNAINIASSV
ALSNKTAVILDLDLRKSRINEDIGLKIEKNVVDYILGKATLEEITHKTKHPRLKVIPAGPHPPNPLQMLTDKNLSGLIDQ
LKKQYDVVIVDTPPVGMVADFFLLRDMFDAAVFIVRHKSTPKKPLKDILEELESHQIEELGIIVNNVYRTKSNRGYGYGY
GYGYGYGYGYGHDTDSNQKKGKTKTKGRSIFKPS
>gnl|bykdb|A0A1P8E011 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp. B29] (length=798 residues).
MKTTHYNQLQKDKSINVLDVLAHLLYHWKWFALSILLFGSYYYYQYAKSPFIYRSAETIIIKTPMNTPRTARISRTNEAY
NSISVASEILQLKSKELMRQTVTRIGAEMSYTVGDGLRRKELYTASPIKVIVPQTKPEDSFSFTVTPVGGKEVVLSNWSE
GDAALEVDATLDKPVNTPFGQVIVQSALKPNKALPQQEVKVEKFALEGMVNYFISTISITQMEEDASLLQIVAEDTNPLR
ATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIEQELGSVESSIEDLRTQNQGMDASTVGTAYFEDSRLYQSERN
KVETDINLAQMMRGYLSDGSKKNELIPNNTGLVDASVETQINDYNTTLLRRNRLIEGSSDANPVVQDLDRALQAMRGNIG
RAVDNAIGGLKIKAGNMKKEENVARGKAMQVPQKQRVMLSVERQQKVKEELYLYLLNKREENAINQAMTEDNIRVIDPAI
VSFDPVAPSRMRKLGLGMAIGFILPAIVIMTLSILDTGVRRRQDIEEAIDVPLLGEIPLATNKRTSQNNILVSAMGRDPL
TEAFRILRTNMSFMAREGKHPQTITLTSFIPGVGKTFTSLNLSSTLSFLNKKVIVVDMDLRKGTLSERMGIIHGKGLSHY
LSDVNLELEEIIHYNLHGKNVDYISIGMEAPNPVELLLSKRLDQLISDLRNRYDYIIIDGVPTGIVADATVVDRVSDLTL
FVIRAGKMDKRQLPEIQKIYAEKRLSNLAIILNGLKLGQSGYGYGYGYGYGYGREEGQNSWRKIARSIRTIFTRKIKH
>gnl|bykdb|A0A1T3D6S8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis] (length=786 residues).
MNQYNKHSVQKENTINVLDIFKYLLFHWKWFALSILIFGGYFYYQYSKSPFIYNRSEVVMIKTPSNTPTTARITRSFGGG
GVSVKDEILQLKSKELMRQVIDKVGADKSYKIHSGLRDNELYKKSPVQVKVEGKTHADSYGFTVTPVDTRYVLLKKWNET
SDEELKIELNRWVVTPVGKVFITPTKFYSKDYYGKDIQVTKLPREAVMGYFIANLKIKQMDEDTSLLQVSMDDVSSDRAD
DMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIEGELGAVESNIENLKIANQGMDVATSGNMYLSESNQYKTEGTKI
ETDIRLAEMMHSYLTNKNKRNALIPNNTGLVDTGVESQIAEYNTALLKRNRLAEGGNSANPVVLDMDESLNAMRNNISRA
VDNALKGLNIKLNNARQEGRTAQAKVLQMPQKERTMLSIERQHKVKEELYLFLLNKREENALNEAITEANLRIVDPPVGD
AYPIYPNRLKKLFTGVAIGTVLPMIVLLSLLLLNTAVRGRQDLENVLSVPFLGEIPLARNRRQGNGDVLVSQSGRDPLTE
AFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGTSHYLS
NPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVADLTLFI
IRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGEEKKKSVFDWFKR
>gnl|bykdb|A0A1T3EDR4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis] (length=786 residues).
MIRNSKYINIRGTWGENFHILDLFKYALGYWYWLVLSCIFFGGYYYYRYSKSLYVYRDKEVVMIKKQSSAPITSAFLQSA
ESPVNIKDEMLQLQSKELLRQVIPYMGGDKSYKISKGLRDYELYTDSPVEVILLGETSLSGYSLKVEPLDGGSVLIREWQ
SKKLEKPFKLSLNKPTRLPFGELLVKGSPHYGTPYYGKSIRVEKLPLERSVVYFLGQLKIKHLGEDTSVLELSIEDSSSK
RGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVEGELSGVEQKIEDFKLSNQGMDAQSLKSLSLSEQGENKSQG
MKIDMDISLLEMLSSYLKDADKSKGLLPSNMGLSGGNIEQQIQAYNSFFLKRNRLMEGGNNKNPVVRDLDASLVSLRQEI
QRSLDHSIRGLVQRRRQASALEQRALGQMLKVPSKEREQYSIYRSHAVKENLYLYLLNKREENALNAAIGEAKLHVVDHA
VISHVPISPNILISVFTGLGIGFLVWVALLLLRLFLNTTVKSREEIESALNIPFLGEIPYSRSKSESGMGVFVYHTGKDA
LSEAFRILRTNITFMVNSGISPQVITYTSFSAGVGKTFNTLNLAASFSYMKKRVVLVDLDLRKGTLSTRVGLEGKAGVSH
YLSGLLRDINTVIYHREIGLGVDVIPLGAIAPNPVELLLSKHLDELIEALKLKYDYVIVDGVPMGIVADANIIDRISELT
LFIIREGKLDRRMLAELENIYQERKLSNLGIVFNGVRIGAFGYGYGYGQELKGGLWSRFLRMFRRV
>gnl|bykdb|A0A1T3F6P5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia ursingii] (length=794 residues).
MDTINQKNQVVGNKKEHSVNVLDILKYLLHNWKWFALSILVFGGYYYYQYSKTPFVYNSSETVIVKTPSNTPTTARITRS
FGANSISVKDELLQLKSKELMRLVVDRINADKSYKVHRGLRDYELYKKSPVQVQVEGKSSEDSYNFTVVPLDANNVIIKN
WNPSNKDKEIKIALGKLTSTPIGKLLINPSRYYKKDYYGVEIQVVKSPRESVMGNFVGNLSIKQMEEEASLLQVTITDDS
PERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKNQYKT
EGAKIETDIRLAEMMRSYLTNRGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNTANPVVLDLDDALAAMRT
NIGRAVDNALRGLNIKLNNTRQEEGVAQSKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAIGTVLPAVVLLSMLMLNTGVRGRQDLENVLTVPFLGEIPLAKGRRQGNGDILVSQSGR
DPLTEAFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNSSIQISDILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKRS
>gnl|bykdb|A0A1T4NDR5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Anaerorhabdus furcosa] (length=237 residues).
MTNVENKMLKDLISIYDSSNPATEAYRALRTNIMYKNFDAPIKVINITSATQGEGKSTTCLNLAVVFSQLNKKVLVMDLD
LRIPTIHKKLRIRNTMGITDLLNGRATVDNVVKPVFKNIDVITTGTKIIYHSEFIQSTALMNFIERMKDEYDIILLDCPP
VGIVTDALIVSKYSDGTILVCESDKNDKKTLIRVKYQFDEVESKVLGVVITKADFGKKYYSHYNYQYQPKARKRKKK
>gnl|bykdb|A0A1T5IIR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium WCE2004] (length=808 residues).
MKTAPRKVTRNEQVNLVDLFYYLIGNWYWFLLCVLLALGVAYYRYSRMPFVYSSGVTAIIKNPGDELRTARLETYDQMIN
KVSVTNEQLQLRSLTIMTEVVKALDADVNYLDRIKFRDVELYTSQSPVRMAFNREKSDPGSVSVTVIPEDAGHIRLQTSA
GSQLVALGDTVALGRGKVVFLPTARYSPDQYGQSIRIQKIPVNWAAQAYISRLSIAHDKQILTLVEQDYNAQRAADIINM
LVVKYNEAAIREKNRVAVHTEDFINERLAIIEEELGGVEGELARFKSSNKIMDVDYTANMYLGDSRGYNAEIVAVETKLA
LSNYLKDHVVSGAESYRLIPGNMGLEDNSMDEVIARYNDLVLQRDRLVAASSTTSPAVLKLENTLGSLRSNILGMISNLQ
TSLEIQRRDLSDRERNAVAKFSSMPTKERQMLEIQRQQSIKQELYLFLLNKREENALSQAMADDNIRVVDPAVANLTPTS
PQRMKIVMLAILIGLLIPGVILIARLFLDTKIRTRKEIEENIDVPFLAEIPLNGTLRGIVFKQGKHKQGHDDPSPFVYDP
TSHTVFTEAMRMLCTNLSFLDSGKKAPFVIATTSYSSSSGKTFITANMASCLADAQKRVILVDTDMRKRSLSGVFALKHK
TKGLSNYLYDLDLTLDDILFKDVKSGIDFIPAGAVPPNPTELLGRPRLEELIEALRQKYDYILLDGVPIQMLADPIVLNR
VVDINLFILRSGQLDRRILPQLDELNDKHHLHNMAIVFNGPQIKKRRGYGFGSYGYGYGYGYGYGYGYGYGYGDEPKKKR
FLGIFKRK
>gnl|bykdb|A0A1V3N3U3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp. CZ-UAM] (length=796 residues).
MNNILERTGAGAERKNNSVNVLDIFKYLLFHWKWFVLSVLCFGLYFYYGYSKSPFIYRSTEMVMIKTPLNTPATARITNT
NNAVGSVSVTSEILQLKSKELMRETIGRIGAETSYSIRKGLRDIELYRTSPVKVDLAGAGPTSQYNLLIIPLDAQTVLLS
GRIAGKEQQEIRVPLNKTVNTTLGRLTVRPTKFYKAGVFGEEIQVRKYDREDIVGYFLGNLKITQLEEDASLLQIVIEDQ
NPQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQQELGSVESNIEQLRQSNQGVNIETAGEMYLNDSRQFQ
SARTKIETERKLTQLMQRQLHDANKRNELIPNNTGLVDGGVEAQITEYNRALLRKNRLVEGSSTANPVVQDLDKALAAMH
ENISSAVDNAVAGLDLKIRNAQQEESMAKGKALQVPKKQRIMLSVERQQKVKEELYLYLLNKREENALNLAMTEDNIRII
DRASVATSPIFPSKFRKVATGIGIGLILPTVILLFLLVFNTGVRSRQDVETVLSVPFLGEIPLSKRKSEQHAVFRVEKTG
RDPLTEAFRILRTNINFMSREGRAPQVITFTSFGVEVGKTFSSINLSATLSFMEKRTVVVDLDLRKGTLSSRLGLLDKIG
CSHFLADATVTLDTVIYPVKGLEFLDCVPIGLIAPNPVELLLSARLDELIAELRKRYDYIVVDGVPLGIVADASIVDRIS
DLTLFMIRAGKMDRRQLPEIEKIYRDRKLSNLAVALNGIKLHGPGYGYGYGYGYGYGYGNTEQQVWYKRWWRKIKS
>gnl|bykdb|A0A1V5F519 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.BinA395] (length=791 residues).
MNPDTGSINQNFTEEESSFDFQKWLHLFIKNWYLFLIFIPFFLIGGYLKNRSWMPLYQSVGTIIINENKYRSSSQGFMQG
FGLEEAYQNVNNQVIILNSYDLIGKVVDSLPFMKVDYLTIGRFKTRNLYTTTPIIIEADYVAPEAYELLFKISLHPNGTF
TISPHNNNSMPSSPINGHIGVPLQHNLFFMTVNSVSDNVKEFEMYFRFRTRETLIEDFKSRLSSRYVIEGSSILEISLIS
ETPDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVSKSLSVSEDEMTRFRRDNQIIDISSHGSELMSKANSL
DEKKAELKLKETYLNYLTKYLTGNFEEGTVVAPSNLGLNEPLLMQLVQQINELYLQRSELTEKNLYYAKYTKAIENVKTS
IFELIKNMRASLEIEKNEVNRLLADVNSQIAELPKKELEIIGIERNYKVNDNYYTFFLQKRAEAEIQKASNTPDNNILDQ
ARTVSLINADVKSNTMFMFILLGILIPSLIIVLKEVLNNTIRSIKDIEKRSVFPVIGMIRHAKNDLPDLTLKNPKSSFTE
MFRVIRTRVEFVVRRKTDIVMMVTSVDAGDGKTFFSTNMAGVYGMTGHKTLLIDMDIRKPAINRRFNVNHPKGVTNYLIN
ECTLDEIINVVPEVNYDVIFAGTVPPNPAELIRSEKIIEMMGELRKRYDYIILDSSPIGLVTDSFSLASLADVNLLVVRN
NKTHKDFFKNVVNQIVTDKLSNFYVVFTDVETDGNYYSYKYGYSSKYGYYTSKGQKNIDEYRKYYDDNNEI
>gnl|bykdb|A0A1V5S1J9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin302] (length=810 residues).
MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIMLWVLRFLKSWYLFVISLAIFLSIAYVKNRSWQPNYKSSALVIIEENKG
LSGAQAALMQGFSVERGYRNVNNQVIMFGSYELISRVIAKQPELTIDYYTQGRFKSTNLYKAAPILITKTFVSPQAYERE
FTIQDLGNNNFEISAPGTKQLPELKISGKYGIPIQNSSFFIQVDKSAIYRRNFNICFKLLNPENLAITYSAKLSFDFLMT
GASVVQASISGTVPERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIADSLRISEGRLKDYKANNFVVASVGG
SNLMGQYTQLDAMQTDLRLKESYLNYLTNYLKSNVEEGAIIAPDNLGVSDANLSSLVSQFTEMQLKRKEIGVKSPLYAKY
TRDIDAVKAQMYEALKNIRVGLDIQKADMQNRLQKLSAGMQELPYKEQQLLNIQRKFKINDDYYTFLVQKRADAQIQKAS
NSPDNIILDKARLASMTNAGEKNKAYTMFLAIGLLVPVAIIVLLELMVPYIRTESEVISMAPKQYQLLGVIMHTDRKTPV
IVDKYPKSAITEAFRVIRTRIEFLSGKSKGISVMVTSSQSGDGKSYISANIAGVFAMTGRKTILVDLDMRKPSINTGLYL
SVNKGISNYLANQISLDEAIVKHPDYKFDILPVGVVPPNPGELIKSDNMNNLISILKETYDYIVFDTSPIGLVTDAYGII
ESVDIILYAVRAEQTNKSFYKKAMSQLEANNVKKVGLIFNDVNLKKLEYSRYYDSYGSYGKKSGYYYYDKKFKSPRSQYL
NYFDNTEEEL
>gnl|bykdb|A0A1V5S5I3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin302] (length=303 residues).
MIPTAPVKKNIALVAIVLGLLIPVVIVFIRENMNTKVRGRKDLESLSLPFAGEIPLAVSGKGKKKVHNAKKIVIRQGNRD
IVNEAFRVLRTNLEFMLDAKTGGKAGVTLFTSFNPGSGKTFLAMNTAAVFALKGKRILVIDGDLRHGSASAYLGSRHKGL
SDYLGKRENNLDGLIQENPDIPGFFLLPAGTIPPNPTELLAEPMFKEAIERLRGNYDYIFIDCPPIDIVADTQIIEKLAD
RTVFVVRAGLLERDMLPELQRMYDEHRFKNMALVLNGTDGGNSRYGYRYGYHYDYGSKSYYGK
>gnl|bykdb|A0A1V6HYH8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin035] (length=219 residues).
MTSTISGEGKTFVAINLGGILALSNKKVLIIDTDLRRPKMSITFNNLNDFGLSNYLLGECNIEQCIKGTEINNLFYFPAG
SLPEYPNELLTSSKMDELLENLKKYYDIIILDTPPIGLISDTTKFVLLADTTVYVFRSEYSKKEFIVNLEKLKQELNPKE
IIIVLNGFNDKFIKQSKYGKYGYEYKYDIYGYYTDNEEKQSNTKKSMKKYFNYFYKKNK
>gnl|bykdb|A0A1Y3Z9Z6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYTWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFNLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDA
RVLDPAGGGDTPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVIRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|A0A212J9Z9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Dysgonomonas sp] (length=801 residues).
MDNNNKKVIESDPYFEEVKTKTNISFDFVLWFYRILKYWYLFIISVALFLGYAYIKNKSWVPVFYVQALMILEDRNTASV
VAGSVPTGTLLRNTENQQIVLKSYGLTERTVKSLPAKMRIEYYIQTRFKYISLYTDTPIEIEMIDIKPEAYNYAYEVTYI
DQEKCEISYKENPESETKISLIAPFDQEIDYKLFRIKLHKTPNFRKDVKGAFKPDISTFNFRFLSEAQLIGMYSGRIGSA
LQNNSSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLINDSLDISRFKLERFQKETGVYDV
SSQSLRIALDSADREKDALALREKSVLLLTEKMKEKILGTDDLMDPASMNIRNPKLSEFVVTYNELLQKARNLGAKNPLY
NKTIDELNDLRVKILQEIQVSQINLQNQKDALVRKYEVLQLKIDNLPPQERDLIKFQREFRVNEMYHQYLTQRQYEAKIQ
KASNTPDNFIWEAPRQMGGAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEECEKISGFPVIGTIENVSKK
LNNGVVLVKNYPKSSFAESFRNMRVRIEYMAQRENKITVLVTSTEPADGKTFIATNIASVYQLMGKKVIIVDLDLRRPSV
AKTLQIDSQKGISNYLIGQVTLDEIIYSHPDYGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYDYVIIDCSPVGLVS
DAYILSEIADTTLFVVRRAKTNKSFFKSVITQLKYDGVEDIALVFNDVKGREGYYGTSRYYGDRTYYLKKNSYYHDDYFE
N
>gnl|bykdb|A0A212K6G4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Dysgonomonas sp] (length=798 residues).
MDINNKPGADTDPYFEEIKAKTTLSFDFVLWFYRILKYWYLFVISIALFMAYAFIKNKSWVPFYGIQAMIILEDRGSSMI
SGAVPLGSILRNTENQQIVLESYGLTERTVKNLPKKMHIDYFIQTRFKYISLYTDSPIEIAIDSLETDITPGAYSKVFDV
AYVSDSQIRVSYKDGLDGEPEEAFNVVFDSPVENKFFKGTIRKTKNFKRDFLPFSFRFFTNSQLTGMYSGRVSTALKTEN
STALTVSMYGTDPAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLERFQKETGVYEVSSAT
VRRELDVADVDRDQVAMREKTVLFTTQKIKEGIMGSAELIDPISIGLTDEIKLSRYVEEYNQELRKSKNLGPKSPIYMTA
INKLNESRVQILRELQLIQVKLQDQKDLLVKKYQNLDLKLDNLPPQERDLIKYQREYNVNEMYHQFLTQRQYEAKIQRAS
NTPDNFIWEYPRMVGGAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECEKISGLPVIGTIENISKKLAG
GVVLVKNFPKSSFAESFRNMRVRIEYMAQRENKITILVTSTEPADGKTFIATNVASVYQLMGKKVIIVDLDLRRPSVGKT
LQIDAQKGISNYLIGQVTLDEIIISHPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYDYVIVDCSPVGLVSDAY
ILSSMADTTLFVVRRAKTNKAFFKSVITQLGFDGVENIALVFNDVKGREGYYGTSRYYGDKTYYLKKNSYYHDDYFES
>gnl|bykdb|A0A229I3A5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=823 residues).
MARPNQEEDFIRIQDLLYLCLTQWRWFILSLVVTCGIAIYYNLTTPNVYQRTASLMIKDESKAQGIGGDVASMFSDMGMG
NMKSNVNNELIAIQSPAVLLETGKRLKLDVDYAIDGRFHKEALYGADLPVTVDFVGFTDEQSGSFKLQLKGDGSYVISKL
KGVTRDNLPVDDSDEITGRIGQIIRTPLGKIKVDKAPAFTQFVSGEDESVLYVSRSNVYAMTDRIKGSLSASLSDVKSTV
IDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKSSNLLPDVEAAAQQY
MQKSTEVDKQIMDLNSRLAIAQYIRNYLTGKVGKNQLLPTNTGIESPGIEQQITEYNKSQLERNNIVANSSEQNPLVADY
DQSLTSMRKSISASLDNFVVTLKTQLGTLQANEAATTSQIASNPNQAKYLQTVGRQQKVKEALYLFLLQKREENELSKAF
TAYNTRIITPPTGDNTPVEPVRRKILLIALVLGFLIPMVVIYIREKANTTVRGRKDLKKVNVPFLGEIPFSISRKNRPTL
EQRIKFWKKPKEVRMIVVKAGKRDIVNEAFRVLRTNFEFTIGTHPEQNVIVFTSFNPGSGKSHIAANMAMSLAIKKKKVL
LIDGDLRHGSTSMLIHSPGEGLSDYLNGRIADIHDILYKGEENGLVKNFDVIPIGTIPPNPTELLFTPLLEQMIKTMREE
YDYVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLMERSMLPEVNALYKEKKFKNMTLILNGTKAHGGRYGSHYGYGYGY
GYGYNYNKEKNGGGKILNNWIIE
>gnl|bykdb|A0A235E1C0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium cellulitidis] (length=802 residues).
MVNHSTNKPFQGKGKQDQSLYVLDILRYLLANWKWFLLSILVFGGFYYYQYSKTPFLYKKEQTVMIKTATNSMSASRITR
PNNFYNIVNVNSEILQLRSQELMRNTISLLNADVSYTKEEGLRTIELYKTSPFIVRFVNAPANAGFSFNLKYKGNNQVEL
SNFSNTDPEKTVTVKLNAETKTPVGNLIISANSDKKFRVNLSEDITITKSPIESMVGYFLGNLDIVQMEDVEILKMTLED
ASPLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIEKELSSVESSLEGMKTQNQGLDVKSAGEQYWTESRTY
QSSSKELATQMKLVEIMRQRLSDPSRVDDLIPSNTGLVDNNIEDIISEYNTLLLRRNRLMSGNSSENPIVQDLNNALSQV
RQNIARAIDNVISGFRIRMSNMKDEENAAIGKARSLPSKQRIMLSAERQQKVIEELYIFLLNKREENAINRAMTDDNIRV
IDSASGSDAPFYPSKFKKVAIGVAIGIAVPAAILLLMLLLNTKIRNRKDIEDAVSVPFLAEIPFSTEMKSAKSEIVIKEQ
GVDEVTEAFRIFRTNLSFMSSGDKKQKVITFTSFNVGAGKTFSVINLGVSMTFLKKKVVLVDLDLRKGTLSNITKFPMPI
GVTHYLSDSAITVDEIIYKDRTDAEIDIVPIGVIAPNPVELLLSDRLDTLINELKERYDYIIVDNVPLGIVADADIVNRI
TDVTIFVVRAGKMDRRQLPDIQKIYDSSALTNMAILLNGVKFGSSYGYGYGGYGYGGYGYGYGYGYGQPKKKGFFSRLFG
KN
>gnl|bykdb|A0A239K409 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter ummariensis] (length=773 residues).
MVMIDKEAQKMGNRQNEQESFIDSFFKYVRYWYLFLLGLLITVGTAYVYIQHATPLYLISGTLLIKTSGNEGQLSESAAF
SDLNTFKTSKNFDNEIEVLKSYRLMRRVLSKLPVNISYYVEESLKERELYGSELPIKVVAHSLDSTAYGREVTVSFNGGK
SYNLEEGGKTFKFEFGEVVRRPYGTFTILTSDAFPQKSPKQKKIIVVFENINTLAKYYSDWLKVEPINAKASVLNISITD
PVPERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLSAELIEIEKDVEQYKRQNKLADVASQSKVYVEESNTY
QKQLAEWSVQIDVLETIETYISNSKENSYRLVPSTLSIEDPTLQELISRFNELQLERERLLRTTEKINPIILSIDQQLQS
LRVNILENIHNIKGGLVLTRRNLKDRTNLYDAKINSVPLVERELQEIDRQRGIKQQLYKYLLEKREESSLALATSAPNSL
VLRPAIIEGVPVEPKKQTVFLLAFIAGLGVPLASIFIKNAFNRKVQQRADVERATTAPVLGEVSYNDTKDVIVVSESSKT
AIAELFRLIRTNLQFVVQGGERKVILVTSSVSGEGKTFFSLNLGASLALTGKNVVVLDFDLRKQSILADLGLACEFGITD
YLSFNTVTVEEMLNQSDQVPNLFIVGSGAIPVNPAELMMSNRVEQLFEELQKKFDYILIDTAPVGQVSDAFSLSKYVDLT
VCLVRYNYTPKHEIENINDILYNNKFKQPMIVLNGAKKFNSNKYGYGYGYVKK
>gnl|bykdb|A0A239XXC4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium mizutaii] (length=796 residues).
MNKSFQGKGKQDQSLYVLDILRYLLGNWKWFLLSILIFGGYFYYQYSKTPFLYKKDQTVMIKTATNSMSASRITRPNNFY
NMVNVNSEILQLRSQELMRNTISLLNADISYSRKEGLRSVELYKTSPFIVRFRNAAPQSGFSFNLKYKGNNQVELSSFSN
SDPDKTITVKLNSEVKTPVGNLIISANSDKSYRVNLSEQITITKNPIESMVSYFLGNLKILQMEDVEILQMTLEDASPLR
AEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIEKELSSVESSLEGMKTQNQGLDVKSAGEQYWTESRTYQSSSK
ELETQMKLVEIMRQRLSDPSRVDDLIPSNTGLVDNNIEGIISEYNTLLLRRNRLMSGNSSENPIVQDLNNALSQVRQNIA
RAIDNVISGFRIRMSNMKDEENAAIGKAKSLPSKQRIMLSAERQQKVIEELYIFLLNKREENAINRAMTDDNIRVIDSAS
GSNLPFYPSKLKKVAIGVAIGIAVPAAILLLMLLLNTKVRNRKDIEDAVSVPFLAEIPFSTEMKTAKSDIVIKEQGVDEV
TEAFRIFRTNLSFMSSGDKKQKVVTFTSFNVGAGKTFSVINLGVSMTFLKKKVVLVDLDLRKGTLSNITKFPMPIGVTHY
LSDSSVTVDEIIYKDRTDSEIDIVPIGVIAPNPVELLLSERLDQLIAELKERYDYIIVDNVPLGIVADADIVNRITDVTI
FVVRAGKMDRRQLPDVQKIYDSSALTNMAILLNGVKFGNNPYGYGGYGYGGYGYGYGYGYSAQQKRGFFSRLFGKK
>gnl|bykdb|A0A2A4N9A6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=815 residues).
MKENQIQNPLPDLDIGLLIGIFRKSFLLFCLIFAMAMFGVWLFLRYTPPIYQAVTHIRAASNKAVELGTFVNFLEKDKNK
MLLEELQEEIAILKSVFMIKKTLTTMNYGVSYFAEGDLLTQELYKSSNYKVDFMVKDPIIYQVRFNIEILNTREFKLLYS
IDKKYDNIYNFGTWIRTEFADFKVSLKESDAIITDSKSNIYYFLINNLDEQARFKFAPAIQTLITNLSARTMILNFRDPN
PAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIEIQLLNSTNKLMNINLDTKTIANISRVFQSEGKYIINDN
PEFLIAQKINDLKLEINIIDTVNYYLNNNISLENIILLPKEAYVTIIGQLRELELQKKFLAQHETELGPNTKLINGQIKA
NKKILLYSIKAIRATLFAQLALIDKAVRQKQKLDSEVNFDAAIEYLRVSTAYKMEKKYYERLLEKHANLQIHAAGIINDV
VILAEASVPKIQEYPSPVYAMLTGIISFLMLSLITVIFRYMLHNKISHLSDIDRSTNATVLGIIPQFKREEMPISQLVVE
KNPKAGITEALRSLRANLQFISTNPGPKIMAITSTISTEGKTFVAINMAGIIALSGKKVIILDLDLRKPRIHKAFEIDNA
KGMSTILIGKDKVEDCIFKSNIDTLHFIPSGPIPPNPAELIINQRTEELLAVLRKQYDLIVIDTPPIGIVSDGIDIIRKA
DYPLYIFRADYSKKDFVKIMNKLMNDHKISKLALILNESGGGSQYGYGYGYGYGYGYGYGYGYGYGYGYYAEDASRNKSL
WERITNSKFISLLKN
>gnl|bykdb|A0A2E0MDX6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=235 residues).
MQFIANNEGSKIITVTSTISGEGKTFVAINLGGIIAFSEKKVIILDLDMRKPKTHIGFNVQNTIGMSTLLIGQSSLEDCI
QKSHLENLHFITAGPIPPNPAELIISNKMTDVINELKNLYDVIVIDTPPVGIVTDAFPIISKVDYPVYIVRAHFSKKVFL
KNIQMLRDKKKIKNLSVILNGAGGDKKYGGFRKYGYGYGYGYGYGYGYGYGGNHGYYEEKPQKEKTTFNKIFSKK
>gnl|bykdb|A0A2E0VQ27 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Saprospirales bacterium] (length=767 residues).
MTFNKEYKMIIRPLLKASPVLIGLITIAILVTRRAVTYMTPEYRAGGAIKINNLNYTQAAINLFGEENEKNLPRQNENFL
AEVEVFQTRDLIRKTLENLHWELTTYRVGDVRLSEIYEERPFKIDYGVNDDKALDKTIYFDYLGEGRFRFFDGSPKDSAH
ATIVDQGQLIEKNGLLLTIEPDSAFLKLKPNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPVDKEVSIIKVYFNHELPE
KAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVKKRLGDAEAGLAGYRSENQLINSTQETDAVLRELTQLNLQK
VDLDMKTSELKRLQEYLLSGNSLSDFSPNFEALSDPIFRGSYLKAQSYEEQRQDYLQKYTLQHPLILNLDQKIKETRAFL
NESVNSTLENLQQKTLELESQIAEVNQKVERFPEKERQLVVLQRQVALNEALYNYLMRKYTELSIMQQSDLFPHKIIEHA
VRPKATVAPNKSLYYGMAFLLALLAGMFYAYLRSYVKETVSSKDELEEKLPQYPIIGEVYRLTRKTPPGFSLVSGLTANL
RDLPKPETKGQAQLFVLSSNMPNEGKTFVSARIAKAMAAYGYKVLLLDLDVRKPELHEELGMDNSDGFCEAIKSDRHALD
LVQNTSDENLYFIPAGQYDDSLEGKVFSAKALDIIHDLRWHFDMVIVDVAPIGLFDDSIVLMRKSTANLFLIRKGTTRLR
QLKPINELLDSFQIPNLYLVLNGVRQKAKKGAYARYLKKRKPAPALS
>gnl|bykdb|A0A2E3GN39 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Saprospirales bacterium] (length=784 residues).
MLLSSGVAHIFLHFSTRIYSSKGVLIHIAGEEKQSLLGLDKTLPNQDFTPTDFQQDVRVITSPIIVNKAFSQKGLNYVFY
EVGDFRSLEIYPNPYFTIDSFYQDPKMRRVSIDYSVLINQQKDSVRLDYIYQGKSWGGFLKPGKPYSDENIYLAISNLDQ
KLLEGSAESQKSILFKVYTDEQLSNELMAITSIEPNKETFAILVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQS
ISFLDKQIDSIKPLYDDALIAVRNAEAQKGYRNIEALGGGLYKDIKDLQKKLVRIEYVTSVLEWFAVMIQQEEDLSLAST
QLSGEEFDGITRALSVDEILKLEYEKESALMQVTPEHPTVVLIERNLDKARATLIAQVEINIDKFQQEKDAVVAEINKLL
EELDLLPLFEAEYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIVSDYIILEMPKIAEKHVAPDDSFIRFVGLAIGAILS
LILVVFRYVTHKEIINIEDITSQTETSLLGVIQRYSEKLPMSSIVVTNRPKSGISESFRGVRSNLEFLDADKGFRSIAVT
STIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRIHKIFDLPNSAGMSTLLNKRSTKEDITFSTSEENLWAVPAGPI
PPNPSELIGGEPFINFIDEVKTSFDVVIFDTPPIGLVTDSIPVISTVNNPIYVLRADYSHRSFVGHIESTKENLQVPSLS
IIMNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYGYGYYSDSDNTRKKERSSLFSIFRKKS
>gnl|bykdb|A0A2G6H6Y4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=817 residues).
METSNNQIQSMQQFSEEDNTSSLSVMEWIMRCVRYWYLFVIGASIGFGLAFYKNQKVVPNYLSYSQILLEDKKADSFATL
QNYSSRGSGKGVENQIVILKSWDMVTRTIDSLPQFKIDFFKILTFKQKALYENLPINVEILSTYDNSFDNYYRFEVTGEK
SFNISVLDEHDEVLEVVDGEYGEPIGCKYFLVKVLRDERYNEIPQFYFRFRTRMSLIQEFVGRLEVAPIDKTSVLNLSLA
SNNPARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVSDSLSRSEAKLNSYKIEHKIYSSDMTSVLVGQMEKL
KNQGKQIKLRDEYFKYIKRYLNKNIQTESLASPTTIGIQEPRLISLVDKYNELQLQLIDLGVKNPQYEIVIAQIEQIKKQ
LKELIASVSDVYSIETDLYKKDLNTLKSELVEAPSKELRMLDYQRRFRINDEYYTYLLQKRAAAEILKASNTPDNTVLQT
AMISGQLNDKEKRTNYLIFIVLGLMIPVVLIVLKEFMNSAVRTEKDVDIATKNRFDIIGSVLHTKHKTEDKVIAPKYPNS
YFVEQLRVIRTKVEIILGRKEAITMLISSTESGDGKTYMSLNLAGVFGLQNKKVLLIDFDIRKPNLTENLQESLSKHKVG
FVNYMIGECSLEEAIDTTGYGFDFLKAGVMPPNPGEFVRSPKLEQMITELKSMYDYIIIDTSPLGLVTDSYALFPMVDVK
LLVVRSFKTSKREFSELTRRLYMDKVKNVYIILNDVDRSKTGYGYGYGYGYGYGYGGSKKNNAYYVTAEFEKENTTAFQR
VIEFVGDITKKIRNIKK
>gnl|bykdb|A0A2G6R1T9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter sp] (length=776 residues).
MEENSLNQQQFDDSEESGFDFMSWVILLVQYWYLFVIFGVLAFGASYLKNRSWVPVYFSSGKLMIDPNAGQNNPQFMQGF
GVESGHKNMANQVILLTSRDLISQVVDNLPEMRVEYISKGKFKTRNLYKMSPIQIETNYISTEAYGVLFKIEINEDGSYV
ISDDKGVIDEDLEIRGKIGVPVKSKLFVINVTKDIEFSNKTMFFRFRTKTSLVNEFSGLYPEFINKSSVLSISLQSPTPQ
RDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIKQTLKGSENDITEFRRSNQIVDITTHTSEIVEKSTEYNERK
SALRLKEKYLNYLADYIKTNLSSGNIIIPTNTGLNESTLVVLAQQFNELLEERNSTSRKNPVYKKLTREINNIKASINEA
IKSMRKSIQIEKQDIDSKIAAVRSKMNMLPKKETQMTALTRQYKIDDNYYNFFISKKAEAQIQKAANSPDNEVVEQARVR
FVVNGGKKKETTMTYLLFGLMIPAIFLIARELLNNTIRGQKDVEKNSKFPIIGNIRHTKKANPLLTLKHPRSSFTEMFRV
IRTRIEFIVQRKTGIMMLGTSTESGDGKTYVNINLASVYGMTGKKTLLIDMDIRKPSVGDRLGISEKAGVTNYLIGENEL
DDLIIKNDDFSFDVLLGGTVPPNPGELIRSEKLKGMLKELRTRYEYIIIDTSPIVRNEKTNKAFFKRINEQIVSDKFNNF
YIVLNDINITSKAYGRYGYGYGYGYGYGYGYGYGYGVKNKKDNQYTHYYNDDDIDI
>gnl|bykdb|A0A2K8ZAP1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Spirosoma pollinicola] (length=384 residues).
MKNTNAAISENIETIRQQLISNRNQLVANNQRMEGMIRTVPGKERALLNITRQQGIKNNLYTYLLQKREETALSAASRVS
DSRIVDPAHTTSQPVKPVKLMIFALFAVVGLVIPIGVITAKDTVNNHVLRRSDVEEVTQIPIIGEVIKERQLGTESFVFK
SRMHSVIGEQIRALRTNLLFLNGDAQKNQVILFTSSISGDGKSFMSLNLGASLALVNRKTVIVDMDMRKPKLHKSLHIEN
KLGLSNYLTGEADLDNLLHPIIGHENYYIITAGSLPLNPSELLSSPRLANLLQELKERFEYILVDSPPIGLVTDSQVIAP
YADATIFVVRHDHTPKNYIKMVDALYKEQRFQKLSIVLNGVGKGESLSYSYNYGDYMDLTKKFD
>gnl|bykdb|A0A2M7KCE1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium CG_4_8_14_3_um_filter_31_14] (length=239 residues).
SEAFRSVRSSLEFIKNIKESKTIAISSTISGEGKTFIALNLGGIYSFQGKKTILIDLDLRKPRFHLCFNTDNSKGLSTIL
IGKNKVHDCIKKSKIANLDYITAGPIPPNPSELTAGNEILNVINELKQIYDVIIIDTPPLGLVTDALNIFKSCDYPIYVV
KAHYSKRSFLYNLNHLLLEKHIENLSVVVNGIDIEKSRYGGYNYGYGYGYGNSEYHTDYYDESITKKKKNIFTKIISHL
>gnl|bykdb|A0A2M7VVW6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium CG_4_10_14_0_2_um_filter_32_8] (length=304 residues).
MIMATGVLLGIVISLIILILKYVLKNTISTMDEITKFSNGAVGILGTVPTYNREIPISQLVINRDPKSVISEAFRTIRTN
LQFISKSEESKLMAITSTISGEGKTFCAINLSGIIAMSGKKVIILDLDMRKPKIHLGFGVKNDKGMSTILIDKDQIKECI
HHSELTNLDFITSGPIPPNPSELIISGKLDEVIAELKKEYDLVVLDNPPIGLVSDAMEMLKKADYPIYVFKSEYSRKNFI
NNLNKLIVENGIKKLSIVLNGVDYSNKYYSYGYNYNYSYGNKDGYYYDDTQKEKLTKRIFKKKK
>gnl|bykdb|A0A2P8CDS1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prolixibacter denitrificans] (length=824 residues).
MDTQNPLTPNQPTTFSRPRNYRKYFFLLLSHWYWFVIAFILTVTGIWLYYRYSHPVYAVSSTMLIHEQQNQNPLTTQKDP
ESNVFQGFGLFQGKQNTENQIQILKSWTQVRTTLEHFNFEATYYKIGRFRTIELYKDVPFHIELDRSHPQLLDANFDLHF
LPNNRVEMTIQGKKAVRYDYRNEKELQPEKEIEETRTFPIDSFVASDDYAFRIIPAADSKLEGNYRVVFHSLDELTADYL
NRLTVAPISKEGTIVKLSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVSDSLSASQKIRERFQS
RNNLLDVSYQSQQLLDQLVKLEDQKSLLETQHQYYQYLETYLSRNDNLQSLVAPTTVGIDDPLLVNLLQELSQLNIEKTT
LSATVKDPDHPRMRQLNIQMETTKRTLLENSRNIMHQSEITLNDLTKRIDNLQQRTRNLPSVERNYVNIERRYQLNNDTY
TFLLQKLSEAQIAKASNMPDNEIIDPARMEGNTPISPNNMTIYLVALLFGIFLPAGGIILKNEFDNKVRTPEDLENLTKY
PILGHIIHDDQAAISHTALLDHPNSPVGETYRALRMKLKFMLNGTEQPVIAVTSTGSDEGKTFTAMNLAASFALLGQKAV
LLDLDLRNSKMAEMHNYDKNRGVSNYLLGEMRLEDITFRSTHPYMWLIPSGSFPPNPGELLADKKLKELIELLKEEYDVI
VIDSSPLLVADLFQYSHLCNAYLYVSRQGVTPQPAIKSALQEISNQHIRNVGILLNDIRINNQPLGDRYNYSYMYGYGYK
TQKPKNRPAAYWRKVNSKKQAQTT
>gnl|bykdb|A0A2P8G5K0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter jiangsuensis] (length=524 residues).
MSVQDVLPRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARISSELALVETNIEHFRKRHRIIDMAEDGRQALQ
KSATNALEEKELAIRLKIVRLLEAHLLEKPAAAIPSALYPQEGTFEALAGKYNEMQMARIMALATLAPEHPQLRSLEKQI
EVLRNNLLDAIGLQIQELTVNAAAIRKYGKESEAEISKLPAHQRAFLAQSREQGIQQELYLFLLKKRVETAISRSANIAN
ARVIDPPKASRLPVYPNRELTILIAVFTGILTPLGVLYTSQIFNNKITSKEDIQRQCDVMILGEISQQSRTGLLKVADNR
SLIKEQFRSLRTNIQFTTGERPHMVILLTSAMANEGKSFVAMHLAHSLALAGKKVLLVDFDLRKPSLATLLNLRPNGVTE
CIASGHEPLIQQNSSETSFDFLAAGQQSPGTGEIILSPKVADLISTLKIRYDYVLLDSPPVGLVADARLLGAHADMTLYI
VRQHFTFIHQLAEIQNARNQSLLPDLHVVLNGTRSLHRYQYNYY
>gnl|bykdb|A0A2T2TDL4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium QH_6_63_17] (length=214 residues).
LQLGRPDETNTTVLVTSPGSGDGKSLTAANLATVTAQAGHSTLLIDGDLRRPRLHEVFDVSRTPGITEALQNDLDEHAMK
RPLIDNLCVLPAGTEVENPAKVLGSSRFRDFLQRAEQYFDHVIVDSSPVLATADGPLLSDLCETTLCVARAGTTTEAELD
HAMEVLSGIGANVAGVVFNGFDISMAYGYKYRYRHYDQYGPYDQYRSLPEEASA
>gnl|bykdb|A0A2T2UAJ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium QH_2_63_10] (length=425 residues).
GGKGVGYVAEQRRGLAQSRIELNGLQARLDVLNERLRENRQKLEQIPTQSIKLAQPQRERRSTEQIYSFVQEKLQEARLA
EQSEIGYAEIIRSAAPGRPVGPDTRRNLLLGLMLGLVAGGGLVVLREQLDTRIYQPDDLREHGHHVLGVVPSMTPLIDDE
FGGQETIEIDGRSVNTLLAMLVSPMSAAAEAYRRIRTNLRFAKPDDDLQTMAVSSADKGDGKTTTCANLALALASAGKRT
IVVDADLRRPWMHEMLNVDRDLGLSQVLYEGELDPEAYATEVENLFVIPAGDTVPNPAELLGSNRMKEFVEALEAKFDYV
LIDTPPALLFSDVLGLAPRCDGTLLVVAAGETDGRAFDHAAEMLADGEADVAGAVLNQFDASSSVLQSYGYNYGYAYSYR
RLYEYYRDEDKGAPEPSGIRAWWGG
>gnl|bykdb|A0A2T4XEQ1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=356 residues).
DVNIAESIYLTISRQYAETALWEQTQFGLGRPLDYAVAPLSPFKPNKRLFILIGIFLGGAVGVGLAFGREFLNRTIDGLD
KLKGSGYPILAVIPDFTEYVKKKYEEKSKVAVKGRLVSTNWFSLLDNISPVTESYRRLHNNIIYSQPDLEVKTILVTSPG
KGEGKTTTAVNLAGILAESGKRVLIIDFDFRRPNLHKTLGESQTPGILELLFDGVHFDDVIRETAYPGIHCLTTGRRSPN
PASVAQSDKLKSIVEGVKDQYDYVVIDSAPYGIITDAAPMMKMADGIVVSVRFNKTQTNELAQTLENLENIHVSILGLSL
VGYDHKISSDYYYQNKYKYYSYNDYLEYTEEKEEVA
>gnl|bykdb|A0A2T5RP38 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia sp. YR191] (length=793 residues).
MNTLNQKEYRIGERKEQTINVLDLLKYLLHNWKWFALSILVFGGYYYYQYCKTPFVYSRSEVVMIKNSSNTPTTARITRT
NVSSSVSVKDEILQLRSKELMRQTIDRLGADISYKVHRGLRDYELYKKSPVKVVFSNKSPESRYGFTIIPIDAKNVIVKD
WNKNVDGQEVKVVLNQLTKTPFGEIIIVPSKYYHKDNYGESILVTKYPREEMMLGLMGNLKVKQMEEDASLLQVSLDDLS
SERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIESELGAVEANIENLKIDNQGLDIETAGGMYLSESNQYKT
EKTKTETDLRLAEMMRSYLNNKNRNELIPNNTGLVDASVESQIAEYNMALLKRNRLAEGGNTLNPVVVDLDEALKSMRNN
INRAVDNALRGLTIKMRNAQREEEQAIGKTLQMPKKQRAMLSVERQHKVKEELYLYLLNKREENALNEAMTDENIRVVDP
ASGPDVAVYPNRLKKIFTGVALGTAVPAVILLSMLVLNTGVRGRQDLENVLSVPFLGEIPLARGRRQGKGDILVSGSGRD
PLTEAFRILRTNINFMTKDDAPPKVLTFTSFSAGVGKTFSVLNLATTLSFLEKKVVVIDLDLRKGTLSSRVDLLHGKGSS
HYLSSPSISIDEIIHKSDVAEGVDFIPIGAIAPNPVELLLGKRLDELITKLKERYDYVIIDGVPVGIVADASIIDRVADL
TLFIIRIGKMDRRQLPEIEKIYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKRS
>gnl|bykdb|A0A2U0UG39 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides galacturonicus] (length=232 residues).
MQTINIERLRKLDYRANEAYKNLRTNIQLCGSDIKVIMLTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
>gnl|bykdb|A0A2U0UJ71 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides galacturonicus] (length=309 residues).
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
DKSFEKARKASSARKNTNNASKPVKRQAGSVGEVAARKKANVAGNNTGVRKKPSADEFDGDFLMDYDEK
>gnl|bykdb|A0A2V3PNY7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas alginatilytica] (length=796 residues).
MEQNINRPADFGTDPYFDEVQAKTKFTFDFVLWFYRILKYWYLFALSLALFLGYAYIKNKSWTPLYQSGAVLMMESRGNA
GVAIGSVQLGTLVQNSINQQMLLNSYDMVVRAVAKLPQMRVDYFKKSKFKVENWYGVTPVTIEAKYVAPSAYSIVFEIEP
INSEKCRIFYEGSETTQPFSMEVPYDQFVQEPRFYIKITKSPRFAPNFEPFSFRFVSKEELIGRYSGRISSGLVRDGSTA
LGISIFGSSPAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIADSLQQSEIIFKDFQDETGLYRITKSDGRV
ELESVMKSIGEVKAQEDLILRLTDEISNSILNKTELIDPTALGLNEPKLARSIGEYNNLVNKLSSMGSAHPMYAKSEQSL
TNLRINILEELRALQDRVQNKKESLDNNTKEIEDKMATLPAQEREYIRYEKRYQVNDAYYTYLRQRRYEATIQKASNIPD
NFIMEAPRQKGGPVNGDEKRKNYTFYFFIGLGLPLLFVIAKEEIFNLVISTKEDCERLSGLPVIGTIENISKKLSSSGST
TLVKNFPKSSFAESFRNMRIRIEYIAQKETGISTLITSAEPGDGKTFIAGNIASVYQLTGKKVVLIDFDLRRPSVGKLLS
IESKKGVSNYLIGQVTLDEITITHPEYEFDVITAGTLPPNPSELIKTKKTKDLLDHLKSKYDYVIVDCSPIGLVSDAYIL
SKYVDTTLFVVRRGKTNKAFFKSVVSQMRNDGLEHAALVFNDVKGREGYYGTSRYYGDKSYYLKRNSYYHDDYFEK
>gnl|bykdb|A0A2W4RDE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=783 residues).
MEEEKINIKKIFHKLISKWYYFPLGLLITMPLAYAYIQLTEPRYLVRASMLLKGEKDKGPSQFLKGMELFQSATDLEDEI
GIIKSFSNVESAIKRLNFGISYYTEKNFKTAEHYGNTPFTIHLDSSVHQLINVPIYIERLSSSKYMVSVRGKEVPTYDVI
TNTVKDRVPVVDIQEVVDINKPFQSKNLSFSITFNDAFKLEPDSKMFFRINNQVSLAERYRNQLNIEPISKESNIVQLTI
EQAVPQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVSDSLRRVEGTLESFRARSNVIDIRTSAQTLTNNLD
KLETERANLEVKLKYYQYILQSLQSGKNTDIVAPSTFGVDDPLLSNLLIELSKLNQERSGLNYSAREGNPLAQVIELKIT
NLKASITENVSNIIDATNIALNDLNQRIARLNAQLERLPRNERELVKIQRRYDFSDNVYNYLLEKRAEAGIAIASNVVEK
SVVDEAMMVGSAPVSPNKRMIYAAAFILGFGGALGLLILKDFLNDNIVTHEDLEQYTRIPFLGVVSHGSRREQSNVVANA
LSPVGESFRSLRVNLQYLTLGKEVNVIGITSSRESEGKTYCSVNLAAAMANSRRRTILIDADMRRPKVASYFQLENDKGL
SNYLIGEASLKEIINETGIKGYDVITSGPIPPNPLDLIGTPRMAELLNELKQSYHTIIIDSPPIGFVSEYIILMKYTDAN
IYVVRSDYTTKYNLDRINKLYDERKVTNISILLNDVKYSRVNGYSYSYKYKQKKYKQRSYKAV
>gnl|bykdb|A0A2W7QSQ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Algoriphagus ratkowskyi] (length=779 residues).
MRKINKKVNSNEEPINIKLILRTILKSWYLFPIFILLFCGVAYYYIKTITPEYLISSVIIIKEGERNNNVTENSIVSDLE
NMKSTITVENELEKLKSKSLLMDAVIKNKGFINYYNAEDFFKTKIDPFQSSIDITVDSISKSFISPSESFEIQPISETKF
LLILDEDKQKEFEYGQKIKFSFGIISIQKKPASDDFATEMGNVLVELVNPQVAAENYSRVLEFQNPSVKSSTLYIRLYDT
SPEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVKNDLEEFEKSGENFKTRNNITDISMNSKIYLENTAETR
KQVAEVSGKIDILESIELTMNNQSGQFDLIPGGLADLDPSLSGLLTQYNTLQRDKQRIIRIVQPNNPQLLSLNDQIVNVK
SNILANISSIKSNLLISKRNFETTLNENSYKAQSIPGIERELVEISRNTDLKQEQYQYLLRKRDEAVLTLEVTGVSSAQM
VDPPIASLKPVKPNKLMIMAAALGLGLSLPLGLILVNYLVTSKVTSKRVIEKILNAQILGEIAKNDQNGVIAISPKSISP
AAEQLRMIRSNLKFQSGDNNKVILVSSSMSGEGKTFFCLNLAATLSIVDKKVVVVDLDLRRPSIFKSLNIKSKHSLFDYL
NHDIKDLKEIITPSGINSNMDIIGLNKSIENASEIITSQKIIKLINSLKSSYDHIIIDTSPIGLVADAYSLSEIVDLVVY
VVRMNYTRVDNLHALAEIIDENIFKQNFVVLNDSNEYSGSKFGYGYYSGKDTDVVSTRA
>gnl|bykdb|A0A2W7RD29 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Algoriphagus chordae] (length=808 residues).
MNNKSESDPLLLSSQKIDFSVFFKRLGKKWPLFLLTGIICLFIAHTSYKSTVTTYEINSKLFIYTEGQSINFFEKLQNVT
NSQNVLLDNEVVIIKSNPVIKSTLEVLDLKVGYYVPPETTSKNFWSFNKSNLPIEIYEDAPFEIELKENDKSIEEKFFRI
SWVDSLSYSVRFVGDEPTTSMFNSNQDEGSGKSYVCKFNEWCGLPFLTLRTRLLEAKNDGNFLFKIRNEESLISEFSGNL
AIYPATTGGSILDIRLITNNPAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVSDTLGVIENELQNFRAANQ
TTNISSEGEVIFGRLQSMGEELAKEKIKKEYLLSLDRYLRNNDFDNIVVPSLVGITDPTINSLIDELINLQNEKSNQLVT
LTDSSPIVIEQQKRIVISKKNTLELVKSAISNIDISIDDLNYRISEISKDFRKLPFTEQNLIKIEREFTLNEGIYNFLLQ
KRAEAAISKASNINNNKIIEQAKANALPIGPRKLNFYGYAIIITFLLPVIITFLQETVFKKLVDPSEIEKLLNIPVIGSI
PVAEGKTNVQLVDYPNSKVAESFRLLRTNLNFILPNSESTVLLVSSVLPAEGKSFTSVNLATAFALTELKVLIIDCDLRK
PKVSDYLGVDNTAGLSNYLSRRVDDESTIVKATSIPGLSCITSGPYPPNPSELIANKEIIKLLIKMKDQFDIIILDTPPL
GIVSDSMSLFPLVDVSLLAFKCGYNNHKGIVELNKLKSNDFIKKVYCILNGVDSHYHIGSNKNYGYYEVYKDNKGLVNRV
KNYLRSSK
>gnl|bykdb|A0A2X2J8S4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium multivorum] (length=796 residues).
MENRPEVVNNQFFGAKNNSTFNVLDIIKYLLFHWPWFLLSVCIFGGYYYYQYSKTTFSYRQASTVMIKTPANTPSSATLT
RSGMSYNTVNLATEMLQLKSKELMRETVESIKADVSYVVRRQLRDYELYNESPVLVQFVNYNPSGSFSFTITPRDNKSVL
VVENVGKDKEKVYIAPLNKAIKTSFGGIRILATPYYTKAAYDQEISVNKLSSIDMANALLGRLSITQTTDDASLLQIAME
DSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILSEELGSVEGDLEKIKVNNNGMDVAEVGGMYIEDSRS
YRLEATKIDTDLKLAEMMSDYLSKSDKQTALIPNNTGLIDGNIEGQIQAYNTLQIRKNKLMEDGNSENPIVKEIDKSLNT
MRSGIERTLGNTISGLQVKKNNAVKEENRASGKSRQMPQKQRLVLSIERQQKVKESLYVFLLNKREENAINQAMTDDNIK
VIDPASGSFAPVYPNKFKKVGLGVAIGLVIPSLLLILMLVVDSGVRNRKDLEEGLSVPFLGEIPLAKKNKHTVGNVSVSQ
TGRDALTEAFRILRTNINFMSRGGVPPKVITFSSARVGAGKTFSVINLATTLSFLNKRVIMVDLDLRKGTLSSRIPVPVR
KGITHYLSDKELNLSEVIYKTEVSDNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYDYIIIDSVPVEIIADAYITDR
VSELTIFVIRSGKMDKRELPDIEKIYQSKKLSNMAILFNGVNSGKRGYGYGYGYGYGYGYRYGDDKKSFWKKVFNK
>gnl|bykdb|A0A348PT57 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=384 residues).
SKEIEYARIERVYNSNEKYYTLLLEKKTEYAISEAGFISENRVLRRASTSRIPISPVKPIIYASFLALGLILSFLLIGIR
YILNNDISGVHDLSRLMNPRISLLGVVPKYSKNIPLSQLIIDKNPKSVMAEAFRTLRTNLDFFQTDNEKKIIAVTSTISG
EGKTFVAINLGGILAFSDKKVIILDLDMRKPRIHKGFNSTNEYGMSTYLSNRDNLKDIIRKSELDGLHFITAGPIPPNPS
ELIISGNLTKGLDELKKIYDIIIIDNPPVGLVTDGIASLKLADYPIYIFRNEYSKKSFIDNINRIFIENKITNLSAVLNS
VDLSRARYGSYGRGYGAKYGYGYGYGYGYGYTSGNGYYSEDNEEEEPKLNFLRNLRSKLKNDDN
>gnl|bykdb|A0A350PNH9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp] (length=833 residues).
MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYHLLSTPCVYQRTASILIKEDGKSQSIN
SDVASMFSDMGISGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHGNLFSIVHVSGTDKAGNQVESDEEVQGKLGQTVRTAMGHVCVDQAPGYSAFINGHESRKLHVTRTNLYAMTNHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDTKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYCISRKNRPTLLQRIQFWKKPKETLQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGN
IAMSLAIKKKKVLVIDGDLRRGATSMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFT
DRLEKMIRQMRGEYDYVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLMQRSMLGDIEQFYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGGAKIGK
>gnl|bykdb|A0A350V3E4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=738 residues).
MPILLSLAVGLVVSYFYAYSQVDIYASASSMRLSKPKENVLENKIFSDIEGELPERYINNEVEILKSFAIREKTAASLLD
SFQVLKGKIPFYLLSATPENQVDPKSKNQIANVLSAVTEISQKRGLDIVSIKTESPSPQEAALISNCYAEAYADYSMKFN
RGHLTLNREFLEKQVQEKYNSLLQTEDKLTNFLRTENVVELNAQANSIISSLSGIEGDYNRSLIDVQSTTRALTDIKGEL
DKYDPKATDYFESKITDPYVAELQGEIARLEIQRDLAKTGNDELVKNSKSLKDINNKVAELKRSLDEKLNILKEGANSNS
PEEMRSLTSKYFETKVLNNQNKIKESLLRGYLNKYQEKFNKLPAQSIEYANLERERLANEKVYLMLLEKYQEALINEESQ
PNNVKIIDYGKVPKAPSKPNRFLIITIGLLIGLGLGYGFALLRNILDVSVKSPEDLENIGISLIGWVPTFMREPKAGRHT
HTEQELVLAYNSDSVPAEAFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISSNLAASFALSSRVLLLDCDFRKPRM
HNIFNMKRYPGLCDYLFGTVTIEEAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMMKPKYDYILIDSPPLATVT
DAELLSSYVDGTVVVSLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYYYYYGSEKGKESAGTNGKS
TNGVNTNGSQKEKIIKPN
>gnl|bykdb|A0A352ME00 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=790 residues).
MLKTIEPDSSIAPLKYFILKVASLKYLYMALIVLCLAIAFFYNHFSKKVYEASASLSPVEDKTSSLLKSNELFSGIQSLE
SLRNIENDIKNLSSFELVYSTVNSMNLEVSYFSESKKLLKQTNELFGTTPFTVSIDKSHIQPIGANIYVSILDESSFRLT
ASQKKVSYYNYVDNQIISEDNFFEIDTICKFNETISNKVVRFSVALNKDFPLKKTEDKSRYYFKFNHLDYLAKGYLKQLE
IEKASPLASIINVRFSENNLDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMADSLVRSESALKNYRSANQV
MDLSFQGQRVYEQMTDIDNERANLKVQERYYNYVINYFKMNADVSGLAPPSAMNVSDPIINQMITNLNDLNAQRSTIIAG
SNPQKNIFIGQIDSKIDFQKQIILENFTNNLNTLTLSLNELDYRQNKLSKEASSLPRTEMNMVSMKRKFDLNDEIYTFLL
QKRSEAQISLASTRPDYEIVEPARTITSRIVAPKSAINYMMALFFGLLLPTLYLMIRDFFDDKIRSINDAEYMLHRSVMS
VIYSNNLKSEAVVAEFPKSAISESFRNLRSSLFLKSDHEKSKVILITSSQPQDGKSFVSLNLSSSIASVGYKTVLIDCDL
RRPTLHIKLKEDNAKGISNFMIKKATADEIIRNTAITNLDFISAGPVIPNPSELMESGILDNLINYLKTKYDYIIIDTTP
VGIVADAILMMKYASKVLMVIRNNYTRKDIFANVINNLKSNKLTNYDIVYNDLNLHKSSYRHYSNYYIKN
>gnl|bykdb|A0A353WYK7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=779 residues).
MEQNQQFDFDKLQMVFKRSLPVLIMLLIFSVATAYLTIRYTKDLYQSESVLQLDIKSEAQVLGFRSFDEDINNLSKEIEL
LKSKLFFTRVAEVINNDVNVFAYGKVLFEERYQNSPFFVEYKIEPQYFDHPFDVDILNSKKFILRLKKGDQVIENTYSFG
EEIVCDGFVFMLALSPHYRKDNDNVHYFFKINSPQSNIRYLMDNTEVKPLDFKAKTISVTFKDFNKYKAQDILMAIDTLY
IYYTQLEKNRVNDQKIKFLNEQLHQTESTLSELENYFENFTIDNRTTDMNVSLSRTITMLEELDSIKMKLNDQLDNFNEI
YDKLLDTADLQLGNSELRMLSSEVAQDINRLEELKKEMNILKGAYKTNTFAYRKKKEEINFLRERIIGYVEESRKGIYDK
LDEINLKKNRLETDFSSLPSKSTEYAKTERYYDLYEEFYLSLMKNKAQFELAQAGTVTDFKILSSASLPSNPIAPNKILI
WAGAIIASVILSFLFIIIRYLLHNSVSSEKDIEHITPTSILGSIPFVEKLKGRDSDRLVIDKVPKSEISEAFRSIRTNLE
FIKRTDKNTVIAITSTVSGEGKTFVTVNLGGVISLLKSKVVLVDLDMRKPRLQKVFYHNIQAKGVSTILIEKHSVEECIL
KTNLENLDYISSGPIPPNPSELIHTGSFDKMIGDLKSKYDVVIIDTPPVGLVTDGILALKKSDIALFVVRSGFSKKSFIQ
NIDRLVKAHHLDQSSIIFNANRSSKNYGYGSYGKSYGYYEEPEYLESNLFATFKSLFSK
>gnl|bykdb|A0A354LNT9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp] (length=833 residues).
MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYNLLSTPCVYQRTASILIKEDGKSQSIN
SDVASMFSDMGISGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHGNLFSIVHVSGTDKAGNQVESDEEVQGKLGQTVRTAMGHVCVDQAPGYSAFINGHESRKLHVTRTNLYAMTDHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDTKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYSISRKNRPTLLQRIQFWKKPKETRQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGN
IAMSLAIKKKKVLVIDGDLRLGSTSMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFT
DRLEKMIRQMRGEYDYVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLMQRSMLGDIEQFYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGDAKIGK
>gnl|bykdb|A0A355BP94 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=773 residues).
MSKQLNSPTTDPIEGFDLDKLWVLLKKNALIIILLFLSTNLIAYLKIRWTKDEFESYSELKLEVKQDATALGIKQFAEDQ
NRNLVAGEIEQMKSKLFFSRVLDSLDLGISYYSLGNVLEHEMYRRSPFKARCIGNVESFQDQPIFVDFVEGNKYQLWVGE
NGTKQTGTLGEPVVVSDANFVIELSPNATPDFKNHFFFVMNSRNRLLDFLSSNLRIEPINFDANTIRVTFRDFNPLKVYT
VVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVENKMEGFENYFEDFTLKNKSSDLTTELRQTIYALNQVDSQRFSLN
KRILELNGYIEELSTGKLVQVAPRNFLPEYLNTRIEEYLKLVRGKERLALSYKDNTFAYQQKDQELNAARTALFTQLAEI
KKQWLGAMLELNQKKESLEKKFASMPDKSTQYSKNQRFYKLYEEFYLSMMQAKAEFEIAQAGSTPDLKILSSAILPGRPV
APNRYLILGIGLVAGLVINFFFISIVYLLSNKITSLQEIERTIHVPVLGVIPEMRRNTTSPFYIVENPRSIVSEAIRTLR
TNLDFFTSSETNKIIVISSTVSGEGKSFLAMNLGGILAMSNKKVILLDLDMRKAKEILHARVTDPSKGISTLLIHKTTLE
ESITKTDMAGFDYIPSGPHPPNPSELLLSKAFEDLLAELRTRYDYIVIDTPPVGLVTDGIMAMKRADLSIYVVRANYSRK
EFLSNLERIVSINKLSHVAVVLNALPTSGKTYGYGYYHEDQKKRSLIRKIFRS
>gnl|bykdb|A0A356Z058 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=787 residues).
MTKETDSGIALIKHYLQDIAYFKYFYIICLVILLTVAFLFNKYSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN
RNLESGISNFISFPTVSSTISSMNLEIGYFREKHHLFRQVSELYLRSPYVVIMDKSHIQPIDVKLRVFILSDTTFRLVID
QNTVSLYNYLDNQIVIENVPLKVDTICRFNETIRGKTFKFSVSFNRDFYTRETNMEDFYYFSFFHLDYLTKDYLKKLEVE
PISPKTSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQVMD
LSFQGKSLYEKLEQIETERANLQIQERYYNYIINNFKSSNDMSGVVPPSAMNVADPIMNQLITQLLLLYSQRSGIASNNA
EKNLFLGQIDNKIKVQKQAIIETVTNNLNTLNLSLNELNYRADKLSREISQLPRTELNMVGLQRKFDLSDVIYTYLLQKR
SEAAITMASNYPDFEVIEPAREFTKKIIVPRPKLSYLLAIFFGLAIPTTFIFIRNFFNNKISSIYDLESLINQSGMGVIF
NNNYKSEAVVLEAPKSAIAESFRNLRSSLFLKLKSEKSKVIVITSSQPKDGKSFISFNLAASIAIVGYKTIIIDCDLRKP
TLHEKFKEDNSSGISNFMVKNATVTEIIRNTSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYDYIIVDTSPVGL
VADATQLIRYATHILLVTRINYTRKDILEHVLKNFSSNRITNYDAVLNSLPLDTSPYRHYTSYYLKK
>gnl|bykdb|A0A359ATS6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=233 residues).
RDVINEAFRVVRTNLEFMDGSGEPDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKSVLVIDGDLRRGSISDYVDTPKIG
LSDYLGKRIDTPEEIIVVDKKHPTLHILPVGTIPPNPTELLVEERLKELINRMRSRYDYILIDCPPIDVVADTAIIEKLA
DRTIFVVRAGLLERSMLVELEKIYNEQKYKNMCVILNGTTGNGGRYGYGYRYGYKYGYHYGSEKKKTWWGNKG
>gnl|bykdb|A0A365UKN1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia miricola] (length=794 residues).
MDTINQKNQVIGNKKEHSVNVLDILKYLLHNWKWFALSILVFGGYYYYQYSKTPFVYNSSEIVIVKTPSNTPTTARITRS
FGANTISVKDELLQLKSKELMRLVVDRINADKSYKVHRGLRDYELYKKSPVQVQVEGKSSEDSYSFTVVPVDANNVIIKN
WNPENKDKEIKVALNRLTLTPVGKVLITPSKYYTKDYYEVEIQVAKLPREAVMGSFVGNLTINQIEEEASLLQLTIKDDS
PERAADILTSLITVYNDVFLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKNQYKT
EGAKIETDIRLAEMMRSYLNNRGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNSSNPVVLDLDDALAAMRT
NISRAVDNALRGLNVKLNNTRQEEGIAQGKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAMGAVLPAVVLLSMLMLNTGVRGRQDLENVLTVPFLGEIPLARGRKQGNGDVLVSQSGR
DPLTEAFRILRTNINFMTKNEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNSSIKISDILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGSYGYGYGEEKKKSIFDWFKRS
>gnl|bykdb|A0A368D1N7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=821 residues).
MSEPSKKKQQSSVLYDKFNVGLLLYVLRKSFKWFFLFMLLSSGIAHIFLHFSTRIYSSKGVLIHIAGEDKQNLLGLDKTL
PSQNFTPTDFQQDVRVITSPIVVNKAFRQKGLNYIFYEVGDFRSLEIYPNPYFTIDSFYQDYKMRRVSIDYSILINQQKD
SVRLDYIYQGKSWGGFLKPGKPYADENIYLAISNLDQKLLEGNAENQKSILFKVYTDEQLSNELMAITSIEPNKETFAIQ
VSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIKPLYDGALIAVRNAEAQKGYRNIEALGGGLYE
DVKELQRKLVRIEYVTSVLEWFAVMVQQEEDLNLASTQLSGEDFDGVTRALSVDEILKLEYEKESALMQVTPEHPTVVLI
ERNLDKARATLIAQVEINIDKNQQERDAVVAEINKLLEELDLLPLFEAEYLRLKRDYEVKSSFYNSLLDRKASFTLSRAG
IVSDYIILEMPKIAEQHVAPDDSFIRFVGLAIGAILSLILVVIRYITHKEIINIEDITSQTETSLLGIIQRYSEKLPVSS
IVVTNRPKSGISESFRGVRSNLEFLEEEKGFRSIAVTSTIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRIHKIFD
LPNSSGMSTLLNKRSIKEDIIFSTPEENLWAIPAGPIPPNPSELIGGDSFVNFLDEVKTLFEVVIFDTPPIGLVTDAIPV
ISRANNPIYVLRADYSHREFVGHIESIKDNLKVPNLSIVLNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYGYGYYS
DPDNTRKKKRSSLISRFRKKS
>gnl|bykdb|A0A372Y7D2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM18-9] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDIMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A376E091 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia meningoseptica] (length=788 residues).
MNQYNKHSVQKENTINVLDIFKYLLFHWKWFALSILIFGGYFYYQYSKSPFIYNRSEVVMIKTPSNTPTTARITRSFGGG
GVSVKDEILQLKSKELMRQVIDKVGADKSYKIHSGLRDYELYKKSPVQVKVEGKTHADSYGFTVTPVDTRYVLLKKWNET
SDEELKIELNRWVVTPVGKVFITPTKFYNKDYYGKDIQVTKLPREAVMGYFIANLKIKQMDEDTSLLQVSMDDVSSDRAD
DMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIEGELGAVESNIENLKIANQGMDVATSGNMYLSESNQYKTEGTKI
ETDIRLAEMMHSYLTNKNKRNALIPNNTGLVDTGVESQIAEYNTALLKRNRLAEGGNSANPVVLDMDESLNAMRNNISRA
VDNALKGLNIKLNNARQEGRTAQAKVLQMPQKERTMLSIERQHKVKEELYLFLLNKREENALNEAITEANLRIVDPPVGD
AYPIYPNRLKKLFTGVAIGTVLPMIVLLSLLLLNTAVRGRQDLENVLSVPFLGEIPLARNRRQGNGDVLVSQSGRDPLTE
AFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGTSHYLS
NPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVADLTLFI
IRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKR
>gnl|bykdb|A0A389LWV6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=795 residues).
MESTNTKSTNFSIDDTNFQHPGNTSSFDLVLWIFRILKYWYLFLVVILLSLSLALLKNKTWTPTYKTSSTILINENKGQQ
VSDLTTGFAVSQGLRNVNNQMIMYGSYDLISKSVDKLDISTDIYHKGLLKSVSYYKASPILIKSNFISEEAASLDFRIRG
IDTTAYEITFDGAKNIAPFSIVGNYGTSLQHNLFFVTVDKTDQFPHTVKYELNFNFLSRGQQIADYNNRLNCSFLLDGAS
VMEISLVGKVTQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILKDSISSAESKLNAYQSQAGIFSSDNSLRS
STELVDLDKKKAEIRLRKEYTKFLQDNLKKEDGNLVPPSSMGIQDVELAVLVSKYNDIFFEIKGLGSENPIYKRYKLQLT
DIKSSINQSIVSMKNSIGIEEADLNQRYSKLSAEVASLPDKERKLLTHERDFKINDSYNTYLLQRRIESQIQLASNMPDN
LVLDNARTTGLVNAGDISNTYVYFVVTGLILTIIFIFLKEVLLKTSIQSRSEVEKISELPILGTIEHTERKEMMVLYKYP
KSSFAENFRHLRSRMIYLTKRDSPIVMLITSTEPRDGKTFVACNLASAYQMTGKKTLMIDFDLRRPALSKALDLDTQKGL
SNFLIGKASLADVVISHPDFGFDILPAGTIPPNPSELINSEMTKKLLSFLSKEYEYIILDCSPVGLVSDAHFLAKLADVV
LYVVRNEKTNRNFFKHTISEFKGDVTSGKMAIIYNDVDLDGNYYASRNYYGKSSYYHKHNSYYNNDEFVDEQNQN
>gnl|bykdb|A0A3A5RIJ2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CF01-10NS] (length=783 residues).
MALTEEEKSVNIVDVFMYLIAHWKWYFLSILLFGGCFWYFYCKTPFVYSRVAIVMIKTPTNSRSAMQLYGSNDFMGQINV
ASEILQFKSKELMRKVIDRLQANVSYMVYDGLRPRELYTEAPIRVAFMDAIPGERCFLSVIPKNQQQVELAEFSKGTELR
RVVNLNDTVHTALGKLVVFAAENYGGDWMERAVKVISHPQEDMVSFWLSNLTIRQMSGDAALLRITMDDWSPVRAADILD
MLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSRQYELLIKELDTQL
QLVTFIRQYLQDSGKEEELIPGNIGLTDINIESQIARYNETLLRRNRLVSGSSSNNPVVQELDRSMQTMRQNIFRALDNL
SASLKQKKNDYTVQENRVRQKVQAVPRKQREMLSVERQQKVKESLYVFLLNKREENALNQAMVDNNARILDPVSGSNIPI
SPNKYNKVLLGAGCGVIVPTVVLLLILVLDTRVHSRKEIEASVSAPFLADIPQVSKTEADAQEVMVRARGLDPLSEAFRI
LRTNLGFMISQPQEQKVITLASFNMGAGKTFVSVNLAASLVQAEKKIIMIDLDLRKGRLSHFAHAKRVKGVAHYLSNPLV
SADDIILHDAFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYDYIIVDNVPIGVVADASVVNRISDLTLFIVRVG
KLDRRQLPELERLYQEHRLNNLAVVLNGAKKGSRGYGYGYGYGYGIDVEKSGWWSRMKKRMKR
>gnl|bykdb|A0A3A6AD54 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF25-18] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3A6MIU7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF17-1] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3B8TU58 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=779 residues).
MLLSSGVAHIFLHFATRVYDSKGVIIHIGGEQKQNLLGFDRDFQKQFTNTDFQQDIRVLTSPLVINNAYSDKGLNLLFYD
VGNFRSLEIYPNPYFSVDSFYQAPELTKINIDYHMFLSRKKDSIRLEYIYKGSTWGGHLKPGKPFIDENIFISISNFDES
LLTDEFEGEKNIFFNVYDNNRLADEMLSNIKIEPNKETFSVAITGKHPSKAKALVMVDLLIESFLNFHLYQKTESIKQSI
SFLDEQIDSIKPLYDEALVAVRNAEAQKGYRNIEALGGGLYADVKNLQQKLVRLDYLISVLGWFAVMVEQEEDLSLASTQ
LSGADFEGIINGLSVSEILNLEAEKEKALMQVTPEHPAIVLIERNLDKARVTLVAQVRINIERYQQERQLMIDEINKILE
ELDVLPLFEAEYLRLKRDYETKAMFYNNLIERKSSFSLSKAGIVSDYTILENPKIAKNHISPNDSFIRFVGLAIGAILSL
ILVVFRYITHKEIINIEDVTSQTETALLGVIQRYSEKLPMSSIVVTNRPKSGISESFRGVRSNLEFLAAEKNFRSIAVTS
TIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRVHKIFNLPNSAGMSTLLNKRSIKEDVTFSTSEENLWAIPAGPIP
PNPSELIGGDSFVNFIEEIKTSFDVLVFDTPPIGLVTDSIPVISKVNNPIYVMRADYSHRSFVGHIESTKENLQIPNLSI
IVNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYYSDPDETRENERTGFFSRFRKNS
>gnl|bykdb|A0A3C0I8F1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Microscillaceae bacterium] (length=834 residues).
DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRGSIPFIILIVGLSLGGSYLFLRYTKALFQSSS
DLRLSIRDEAQPGGLPIQTAPINNNAHLLGEIEFIKSELLHEEVIKKMNLGLTIYAQGNILDNELYGNVPFEIKWWATAN
NPWFDKRFDVQIVDPKHFVLAFEQGRGVIKQKYQFNDTIHLSGMSLVLIPKPAINISKNYYFIINSRYALLSYLQSKLKV
DIINHNAGIIRISFKDHNAEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVDEELTKYESLLEGSLIENKTT
DLLSKFSTSVKESENFGEKKAEITNLLNLLDQLEVQAQNDSIITTLMPEVNLPGIDFNSLILKINALFSEIASISYYKTD
NNATLKVKRTQLIKYQKELRAQINEAQRMLNKEIGALQSKFSRAQGEFLKIPSKETELKRIKRLHTIYEAFYSQMLNKKA
EIGISRSAIVPEFVILAPASQPTKPIYPVPTNIYSLGLAAGVVLSLLLVAIRYLLNNTVANQKELEKIIIAPVLGVIPFH
NKQKNAKYSKLVILDNPKSTINEALRSVRTNLDFVLNKSGGLNDTSTSKVISITSTISGEGKTFVAANLAGIIAMLNLKV
LIIDFDMRRPKVHIAFDREEEDNLKGTSTILIGRHTPQECIQHTPIENLDFIPSGPIPPNPSELILRPICDEFIKQLTLS
YDVIILDTPPIGLVTDGVLLMQKAEVPIYIFKANYSKKAFSKSINKLILKNNFTNLSVVLNAVNKRFSYGYGYGYGYGAY
YGKRSVAYYNDSESNYKPIRWINRIYKRAMSFRK
>gnl|bykdb|A0A3C0S618 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp] (length=796 residues).
MENRPEVVNNQFFGAKNNSTFNVLDIIKYLLFHWPWFLLSVCIFGGYYYYQYSKTTFTYRQASTVMIKTPANTPSSATLT
RSGMSYNTVNLATEMLQLKSKELMRETVESIKADVSYVVRRQLRDYELYNESPVLVQFVNYNPSGSFSFTITPRDNKSVL
VVENLGKDKEKVYIAPLNKAIKTSFGGIRILATPYYTKAAYDQEISVNKLSSIDMANALLGRLSITQTTDDASLLQIAME
DSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILSEELGSVEGDLEKIKINNNGMDVAEVGGMYIEDSRS
YRLEATKIDTDLKLAEMMSDYLSKSDKQTALIPNNTGLIDGNIEGQIQAYNTLQIRKNKLMEDGNSENPIVKEIDKSLNT
MRSGIERTLGNTISGLQVKKNNAVKEENRASGKSRQMPQKQRLVLSIERQQKVKESLYVFLLNKREENAINQAMTDDNIK
VIDPASGSFAPVYPDKFKKVGLGVAIGLVVPSVILILLLIVDSGVRNRKDLEDGLSVPFLGEIPLAKKNKHTVGNVSVSQ
TGRDALTEAFRILRTNINFMSRGGVPPKVITFSSARVGAGKTFSVINLATTLSFLNKRVIMVDLDLRKGTLSSRIPVPVR
KGITHYLSDKELNPSEVIYKTEISDNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYDYIIIDSVPVEIIADAYITDR
VSELTIFVIRSGKMDKRELPDIEKIYQSKKLSNMAILFNGVNSGKRGYGYGYGYGYGYSYRYGDDKKSFWKKVFNK
>gnl|bykdb|A0A3D0FMX4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=803 residues).
MATDTNVQNQDFTNQDDRIQFDVMEWVFKFLSVWYLYVICLAIAFGISIYSNRKWVPTYRTAGTLIINEYGSQASNALMQ
GFGVDVGYRNVNNQVIMMGSYDLMCRVVDSLPFMRTDYISRGRFKDTYLYRYTPVVFEPSEIRPEGYEHLYKLDIGTNGQ
LTVSIADEDTKNPMTFNTIYGQTFDCGLFSGLFMPTEYMTEKTTIYFRFRSQESLVADFSSRLTLNFVAEGSSVLTIQLV
SETPERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIRKSLASSESAMTDFRKRNEIVDIQSYSSELLGKVNA
YDQERLAMRLKETYFEYLTNYLNTTMEQGTVIAPSTMGLDAQALGTLVTQLNDLQIKRAELSEKNIYYDKYTTDMQNIKV
AILEVLSSMRASMDIEKKDLELRFSEVRAGINALPEKELEMVALERNYRIDDNYYTFFLQKRAESEIQKASNTPDNDRLD
KARILECTNAGAKNANRTKYLLLGLIIPFLFVILRELLNNKVRTTREAEALSHYKLLAQVRHTRGSNPTEVVDHPRSSYA
EQLRALRTRIEFVVRRKTGIMVLTTSAQSGDGKTYLSTNLAALYAMSGKKTLLMDMDIRKPNIHEKLGTSIEKGLTNYLI
GEISKQEMIQHDPSYEFDIIYAGSIPPNPGELIRSDQVVELLEELRSEYDYIVIDSSPIGLVTDAYALIERSDITLFVVR
YNKTQRNFCREVLAQMEEDGKQNIYIVFSDLPHERSGRYNYNSKSYHYGYGYGYGYGGYGYGYGYGYGSRKKGTNHYYTD
EDE
>gnl|bykdb|A0A3D0QPV7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=816 residues).
MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARKSLRWVLLFLITSLLAAWLYLRYTPPVYESLSVIQISEENNMK
QVIPGINSFEDEQSGVDKALELMRSEFLFKKSIEKLDFTVSFFSEGQILTENKYPAKYLRFSDLTIIDSTIFGERIDIFS
NSNQITLNCRNQTFTTESGGLLQSPWFRARITVADPQTIQAIQSENKLYFVFNHPDQLLTQYFPAINVQVLNASAKTLQI
SMRDHNKAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVYTKLKNSELELQAFRQLNKVQNFEGVSKNYLER
LTELEGQLLKVDIDEELIIEVERALKEYHNESDIYNVLSILSGTRFESELSGMVKELHVLILTKEKEKFSSTSKSTYMKS
LDYQIDIQLKMINQAITSLKNQFSKRKGSLKDKIRQYETIYYGLPEKEIEHARMERMFAINEKYHTMLLEKKTEYEISLA
GQTTGNQILEQATIPKLPVSPKKRMIVIAFFFIGILFSSVMIVIRYLMHNEITTLHEITRISNASLGILGIIPKYKEDIP
VSQLIVDKNPKSLISEAFRTIRTNMQFLTADKDAKLVSVTSTISGEGKTFVAINLAGMIAFSGKKVVILDLDMRKPKIHI
GFGTDNEVGMSSLLIGRDQLEQCIRKSEMENLHFITAGPIPPNPAELIINGKLDSILEELKRIYDIVIVDLPPVGLVTDG
IPIVQMADYPIYVFRANYSKKNFVQNADRLVNENNIQRLSVVLNSVDTDRGSSGYNYGYGYGYGYGYGYTYGGNYYTERT
NATEKKIRFFRRKNKK
>gnl|bykdb|A0A3D1AEJ6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=212 residues).
MDFMRVKQDNIKVITTTSTSVGSGKTFVSSNLAASLAMTGKKVLLMDMDIRKGTLGKGVDTHKNIEGYDIGLTSYLSKIV
TKVESLIIQDQDYPNIDIIRSGPEPPNPAELLLSPRLDELIRELREMYDFIVIDNVPAGMVADAMISNRVTDLTLYIIRA
GKMDRRMLPEIEQLYREERLKNMAVILNGTGSGIGYGYGYGYGYGYGNDKDK
>gnl|bykdb|A0A3D1BT36 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=796 residues).
MSKNNETKSESLKIKEFIFKVFSYKYYFISSIILLGLMAFLLNKFTPAVYEVNSIIGPVENKQSSLLESSDIFSGLGSLS
QSRNLENDINSLKSFSLISETIKNLALEIGYFIESDDILGQVRQVYPNSHYTVNIDKSHIQPINARFYINIVSDTTYRLT
VSEDDVSFYNYLDNKVISAGHMLNIDTVYKFNQTIASPYFRFSVSKNQDYLNQRPVDEERSFFMMNHIDIITEQYLNRLT
VESVSLKSTLINVFFQGENLDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEISESLSSSQSELRDYRSTHQV
TDLSYQGQQALNQMEQIDNEKATLQAQQRYYNYIIDYFNNNQDIAGLAPPSAANVSDPIMNTLVLELLDLNSQRSAILSN
NVQKSLFLEQIENKINLQKQTIIENVKNNLNTLSLTLNELDYRAEKLSSQIARLPRTELNMVSMQRQYNITDAIYTFMLQ
KRSEAGIAMASNHPDYEVLESARSITSSIIKPKKMINYIASFFLGLLIPSLIIILKDFFNEKITRAYEIEDVLGKPVLST
IYNNSFKYEDVVHKAVGSPIAESFRNLRSNLFFRSKTNPLKVILVTSCQPQDGKSFVAMNLASSIASVGHKTIILDCDLR
RPTLHDKFKIDNEGGITKYLTDKNVDNDIILKTFVDNLDFIPAGPVLPNSSELIEAGALDKLIQYLEDNYEYIIIDTTPS
GMVADAAQLIKYSSINLLVCRNNHTRKDVFNSVLNFYKTHNIENFDIIYNDVEIKESRYGRYHGYYKKPKAFTARK
>gnl|bykdb|A0A3D1MEL0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=782 residues).
MLLSSGIAHIFLHFSTRIYSSKGVLIHIAGEEKQSLLGLDKTLPSQNFTPTDFQQDVRVITSPIVVNTAFSQKGLNYIFY
EVGDFRSLEIYPNPYFTIDSFYQDPKMRRVSIDYSILINQQKDSVRLDYIYQGKSWGGFLKPGKPYVDENIYLDISNLDQ
KLLDESAENQKSILFKVYTDEQLSNELMAITSIEPNKETFAIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQS
IAFLDQQIDSIKPLYDDALIAVRNAEAQKGYRNIEALGGGLYQDVKELQKKLVRIEYVTSVLEWFAVMVQQEEDLSLVST
QLSGEEFDGVTRALSVDEILNLEYEKESALMQVTPEHPTVVLIERNLDKARATLIAQVEINIDKNQQERDAVVAEINKML
EELDLLPLFEAEYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIVSDYIVLEVPKIAEEHVAPDDSFIRFVGLAIGAILS
LILVVFRYITHKEIINIEDITSQTETSLLGVIQRYSEKLPMSSIVVTNRPKSGISESFRGVRSNLEFLEAEKGFRSIAVT
STIPGEGKTFVAINLAAIIAMQGKRVLLVDVDLRKPRIHKIFDLPNSAGMSTLLNKRSTKEDITFSTPEENLWAIPAGPI
PPNPSELIGGDSFVNFLDEVKTSFEVVIFDTPPIGLVTDAIPVISGTNNPIYVLRADYSHRSFVGHIESTKDNLKVTNLS
IVLNDYGRGVSGSYYNYGYGYGYGYGYGYGYGYGYGYGYYSDPDNTRKKERSILFSRFRKKT
>gnl|bykdb|A0A3D2HF71 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=816 residues).
MTSPSPLNNPSQPYYIPPEEEGLDFKRYLSLFISNWYWFAGALLIALSIAYSINRWSEDVYSVSSTLLIKDEQLMGGLSS
GTTTLFPGMEAFRSQQNLKNEMGILRSFTLNYRVMQEMPDFHVDYTAVGRRGIVEKRIYNKSPFIVIYDSLNKQTIGEKV
NVKILSAKKYKIEIDGERNFSKEMNFGDRFNEQGFDFIIELRDKNNFVFDPNASNRYYFYFVSPQSLANIYRSKLSVSPV
EEEASLVTLTVTGTNPEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIISDSLHLAENSLESFRLANRLIDLS
REGVAIQNRLEEIDKEKTSLMLQKNYYEYLKDYIDTKKESGEIIAPSVMGVTDQLLIRLVEELSQLQKQKKQLSLNLLES
TGPLRVLEGNIANTRIAISNNIADGLANIEKSISEADKRLNEVEREIMKLPSTERQMINIQRKFDINNTVYTFLLEKRAE
AGIARASTVSDNRIIDYAGVYSSTMIKPKERQNFMLAIILGLFFPGIGILLLDYFNNKIIDKKDIEKRTSAPIIGFIGHN
TFKTDLPAVEHTGSSLAESLRSVRTNLKYFMKDISNPVIAVSSTITGEGKTFVAVNLAAIIALPGKKVLLIDLDLRKPKA
HKILGNNDNTEGISKYLIGESKIEDIIIKTEVENLWYAPAGPIPPNPAELIESESMKEFIDKAKKDFEFIIIDTPPAAVV
TDALLLADLADFYIFVVRQRFSSKNTVELIEELYRNETIGRIGIVMNDISLTGYYGYGLRYGYAGGYGYSYGYNYYGDYV
YSRYGHSGEGKYYIEE
>gnl|bykdb|A0A3D3HL11 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=791 residues).
MQLMTNNNDSQSEAFNIKEFLAEALSYKYFYIASFFICLLIAFLVNRFSPTVYEVNSVIGPVEDRRSSMLGSNDLFSGLG
ALAESRNLENDINSLNSFSLVATTIRSMNLEVGYFAGKNTIFQKPTQVYLGNPFSVIIDKSHIQPINTRFRVDILDDQSY
RLTASEDEASYYNYIDNAVVSTENRVRIDTICRFNETVTSYNYKFSIGFNKEYYNPKLSGETDYYFEFYHLDQLTRTYLR
RLKVEPVSIRSSLINVLFHGENRRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEISDSLTQSESKLRDYRSA
NQVTDLSYQGQQALEQMRQIENERSMLQVQERYYNYILDYFDKNQDMTSLAPPSSSNVVDPILSSMIMELQQSSAERANI
LSNNAEKNLFLGQIENKIRLLKQAIIENVKNNLNTLNLTQNELDYRESKLSGEISRLPRTELNMVSMQRQFNLTDQIYTF
LLEKKAEAAIAMASNYPDYEILEPARDVTASIIAPRTNLNWLIALFMAFMVPTIYIILKNFFNEKISSVRDVEHMIGQPV
MNLIYTNFYKTESVVKDYPGSSIAESFRNLRSSLFLKFRSEPQKVIMITSAQPQDGKSFVSSNLAASIASVGHKTVLLDC
DLRRPTLHEKLKIVNSVGLSNYMVNNASTKEIIKKTDVDNLWFIPAGPILPNSSELIEAGVLDSLIEELKQQFDYVIIDS
TPAGLVADATLMIKYASYILLVCRNDYTRKDVFTDVLNLFRTNNITDYDIVFNDLNLKKSRYGRYDNYYKQ
>gnl|bykdb|A0A3D3LSK1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=370 residues).
NKIGIVNSLSSQYNAQIKTLPSQVIEYAKLERDKLAAEKLYAALESNYQESLINERTQTIKSYVIDPGYDDNSPIGPDRR
NMNIFGIIAGLIIGLAFALMRIYFNKNLSTPEELESKGVSLLSWIPNIEQITDKSDPTNDFIVAKKPSSQISEAFKALRT
RITFSKLEDKPLKTILVTSSLPSDGKTIVSVNLAGSFALDNKKVILIDCDLRKPRVHTVFEFDRFPGLSDFLFHHVNFED
IVRDSGFDNLSVITAGTIPPNPSEMLGSLQMKKFLELVESKYDIVILDSPPLISVTDSEILYNLTDGTVLVAQAEKTDKK
AFFKTYNQLKRINPHNLLGAVLNNFKFNTSYGYYYNYYYYYSGDSKKKNN
>gnl|bykdb|A0A3D4CJE1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=568 residues).
IAFQSANARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYYNKLKVSENKLQKFQKENKISGSSEFSAMYME
KLNRLENQLIDLDLQINVLKEIQNKAKNANDNMQVYDLLSILAGTDYESTINGLITNLQRLLDKKQQLQNEVTPDSEILK
TLNLQIEAQRDLIIESLRSLLDKLLTQRNEVAQKIKEFEQKFYNIPAKELEYARLERMFSIDEKFFTLLLEKRTEYSISE
AGFVPQHTILEQAEIPNVPIKPNKKLIFVVFVFGSLVLGIGFVVIKYLFHNEITSVADITQEGKAKLGVLGVIPKYKKEI
PVSQLIIDKNPKSVISESFRTIRANLQFISNKPGSKVMAITSTVSGEGKTFVAINIAGIIAYSGKKVIILDLDMRKPKIH
LGFNVENDRGMSTLLIGNDSLNNCIKHSALKGLDFITAGPIPPNPSELIINGNLTEIIEELKQTYDLVIIDNPPIGLVTD
ALYTISMADYPIYVLRANYSKKEYLKNAYRIYEENNIHKLSLVLNSVDFEQGQYGYGYGYGYGYGYGYGYYEDVPEKQVW
WKAIFNKK
>gnl|bykdb|A0A3D4RLG4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=444 residues).
MHKYKATSKICRKKNWRWSLSNAITELMTTTXTQKNVYYAKYTKDIENVKTAINEVVGSMRASLEIEKKDLQNRYKEVEK
EIPNLPTKELQMVAIERNYRIDDNYYTFFLQKRAETEIQKASNTPDNAVLDKARTTYITNAKQQRKTMISYLALGFLLPL
VLSVLIELIYNKLRIPKEVERLSSFPLIGSLRHVRSQNPTLVQKNPRSSYTEMLRTIRTKIEFIVGRKQNIVLSITSTQS
GDGKTFLATNLAALYGMTGKKTLLIDLDIRKPNIHEKLGVDAGLGVTNYLIGECEIEDILHKDTSYNFDFLLAGTIPPNP
GELIRTDKLVSLLQELRKQYDFIIIDTSPIGQVPDAFALIEQTDLTLYVIRCMQTNKYFCKNTLQQMEADYKDKVQLVFS
DMPVEKKRKRLGRKSYGYAYNSYGYGYGYGYGGKNDYNYYSDDE
>gnl|bykdb|A0A3D5KRM7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=251 residues).
MVENSESDSLDNIRYSKTRIMPLDAEVLQDNRIIMGLYNDQRADLFRVLRTNILKQLRENNWNSFFITSATPGAGKSWVA
TNLAIAIALEGNQTVLLVDADLRHPSICNHLGLNCKFGLIDYLSGVTSLEQILIHPKIENLVLLPGKESKVNYSELISSP
KMIEFIKETKSRYESRIIIFDVPPLFVADDALLYMSYCDAALFVVEDEKNTVDEIKHSMKILEETNLLGIVLNKSRQPIP
SYKYGYGYGYG
>gnl|bykdb|A0A3E0QD27 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=804 residues).
MGKKKITNLNEEFDFKLFSIIAKKNAYWLFVILTICFTSAFLYLRYTLPIYESRGILKIGTVNTANAVLNIGSNQALEVL
GSNQLAGDVELIRSRVIVSRVVGALPLDVSYYAHGKVIDHEMYLSSPFRIEYEIEDSAIFSIPFYLDFESEKVFHLRYPT
HEGEKVKAFQTNVWNKVPGLKFRMTVQNWAAIQKQEINLQDEAYYFIINNSTTLVERYFKNLTVVLMNQVAQTILIKFND
NNAVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGIDVELRASEGSLEQFKKDNMIIDPRQNASEALTHINKL
IEQRVEMQLQLAVMNRLERDITSDSEVESLLPFLSGSYSDGVILSIVSKIHELEDKRSNLRFIATDKNAAVISLEQDIDF
QKKNLVMSIQNARLSIREKINNIDERIREFEGNFLKLPSQEAELSRLSRLFEINQKFYQLLLEKKVEFSITKAGIISNNI
VLERGKPAVNPLSPNRRLVIAGSLLLGFIISFLIIFVKYLFYNEITTLDEINLYTDAALLGIIPKYKNEIPVSQLLVDKN
PKSAISESFRSVRTNLQFISNEPGPKVVAITSTISGEGKTFVAINLAGVIAFSEKRVVIIDLDMRKPKIHLGFNVENTKG
MSTILIGKDEADNCIRKSNLTNLDFITAGPIPPNPSELILSRKMVELVEYLKSKYDVVIIDTPPVGIVTDGVDVIQNADY
PIYIIRAQYSKRMFINNLNRLIEESKVRNLAVVLNGVETSRFRYGYGYGYGYGYGYGYGYGYYDDEAKKPLTTWQAFKAR
LGKK
>gnl|bykdb|A0A3E4JJC9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNRKQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRGTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3E4WDQ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNRKQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A3M1NUH2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=238 residues).
MSPVVESYRHLRTNIQFSRPDTVVETIVVTSPSVEEGKSTTAANLAVVMAEAGRRTVLIDADLRRPRVHQLFGRELGPGL
AHFLVQEPRFDEELVATPIDNLWIIPAGKVVPRSSELFATRVMRDFIESLRARFDVIILDTPPVRVATDAALLATQCDLT
LVVVRAGQTREGELEFAMESLAAVGAPAIGTVFNGFDVSMAYGYKYRYRHYDRYTQYTSEYGTYGYRDVKELLKDKES
>gnl|bykdb|A0A3M1TXY5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=695 residues).
LDFGISYYLKEGLKTRQTYHYAPFEVQLDSSHVQIVGAKFFVRPISDTEYEIEADEKSAEIWNIAEDALVHELEPFVFNK
RLRFGQPYTDQNLSFTLHRNPDFEVKKGQRFYFVIHGLKDLAERYQSALKVEAVSKEARLLNITSEGPVVSMQNQFINTL
LNTYIQNDLEKQREIGRKMLMLIDEQLTGVTDSLRKAEFSLRGFRAGTNIVDIGVTSKDLTDQLTELERQRAALAVAGQY
YEYVLEDIQADNSLAEVVAPASTGIEDPLLTSLLVDLARLKQERAAIRLTAKERSPKVQNIDAKINNVRQAILKNVNTSI
RANNIAISNVNERIEALRTRLRRLPESERILTNIKRNFDHSSEVHKYLLQKRAETAIALATDIANKFVVDEAKQVGSGPV
SPKVGLIYAVAFVLSLGLPLAIMLVYDFFNEKISGDQDIEACTNIPILGYIARYEKSNNYIIEKDSRTSFAESFRSLRVK
MLFVVEGDKKKVIGVTSSSSGEGKTFCATNLAATLAHAGKQTLLIDTDLRRPKVQTYFRTEHHAGLSDFLCGEVDYVNEI
IHSTHIENLHIIPAGNPSNNPTDLISNSRMKELVEACMDEYDHIIFDTPPIGLVSDYLILMHLTDYNIYVVRHNVTEVAD
LKLINELFETGKIQNIGLLLNGVASLSDYGYLDTDYGINGYVKKGKKRKRYEAIN
>gnl|bykdb|A0A3M1Y2F5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=437 residues).
NINDPFLQSLMGKLTELVSERAELDFSVTADNPNIDRINLEISRVKSSLLENINNRVSSTEFELESVEDQIRTANGRLSR
LPRNERMLTQMGRTYESINELYSYLQKKKTEAEIALANLTVDLMIIDPARYTGKESRNSRMLIMALALILAIGLPAGFLV
VLSYFSDKVSTYQELKKATPIPVLGTVIKNDDGLEVIKQSTSYSPLAECFRAVRVHIYNKLTNKREKIDVSERGILLGVC
STWSDEGKSFCAANLAASFGIGGYNTLLVDLDLRNPSQPEYFRYPRQMGISNGLLGPERSHWKKWIIKDVESQIDILPAG
PHLPNSIDLLDTGAFEELIEELPLHYQYVIVDLPPIMQASDYMLVEKWLDFTAFVVRHQQTRLQDLERINELFEQERIGK
IGLLINHVANPAQFRHGDASYYTYGKKYAKVYGAMHT
>gnl|bykdb|A0A3N2LCI3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-077] (length=448 residues).
KMLPMNSGVANVDIQSQITDYNNLVLQRNSLLAKSSDKNPLVVQLNEQMDQMRHAILASVDNSINALNMQISSLQGSQAS
TTSKIASNPSQAKYLLSVERQQKVKESLYLFLLQKREENELSQAFTAYNTRVVNKPASFGPTAPNTRNILMMSFLLGLAI
PFGVVYLMESNNTKVRGRKDVEHLAVPFLGELPQDGHEKKKEAGEANTIVVKGGKLDIINEAFRVLRTNVEFMCNSSEGN
KVIAMTSFNPGSGKSFVSMNLGMAIALKGKKVLIVDGDMRHGSTSAYMGSPAKGLADYLGGAVSEVDTLIVKTPECQNMQ
VLPIGSIPPNPTELLESPRFGELIGELKSRFDYVIIDCPPIEVVADAQIIDKFADRTFFVIRAGLFDRSMLPELDRLYEE
KKYRNMSFILNGSRNDQGRYGYSHTYRYGYGYGYGYGYNYGSGEKKEE
>gnl|bykdb|A0A3N2NDY8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-114] (length=804 residues).
MSDNINVTQESEAAEEFSLKDFLACCLSKWRWFTVSIVLFCCLGVLYVLRQQPVYSRSMELLIKDQDGGGGVADISNAFS
SLGLVSSNTNVNNELISLSSPAVMYEVVKNLGLDVNYSTPGRFHEKTLYGSNLPVNVKFHDLEEQQCAGFRIELGKDGNV
VLSKFHLETPDGDEEIEKEVKAKIGAGPIETPVGKVSIAANGNYTAPKGKKNKPVTEIIVERDGMQSTVETYGGLVKADL
ADKDADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKRDHRVPNL
EEAAKTQMKQSVEMSNKMLEVTNQMSMSIYLRDYLNNPGNAKSVIPVNTGIGSPTLEAQISNYNNLLLTRNTLAASSSDT
NPLVVDYDGQIKGLREAIVNAINGQIVALNKSLRNMEGAKGAAESQLASGSTQAKYLLSVERQQKVKESLYLYLLQKREE
NELTQKFTADNTRIITPPTGSLQPVAPKVKFILAICMFFGLCVPGVAIYIISATDTKVRSRKDLDRMSAPFAGEIPFVGK
KSIKDRMARLLPAKKNSKELERVVVAVKEGSRDAVSESFRIVRGNIDFMIRGKEGGNVIMITSFNPGSGKSFISFNLSAS
FALKGKKVLVVDGDLRHGSASQFVDMPSKGLSNYLTGNTDNWQSLVVPVAGQNGMSVMPIGHRPPNPSELLDNGRIGQFL
DEARKEYDYIFVDCPPTDVVVDTQIVEKYVDRTIFVVRAGLLDRKALEEIDAIYRNKRFKQMSIVLNGTEAASRKSYGAY
GYYG
>gnl|bykdb|A0A3R6HJB3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. AM23-5] (length=816 residues).
MARPNQEEDFIRIQDLLYLCLTQWRWFILSLVVTCGIAIYYNLTTPNVYQRTASLMIKDESKAQGIGSDVASMFSDMGMG
NMKSNVNNELIAIQSPAVLLETGKRLKLDVDYAIDGRFHKEALYGADLPVTVDFVGFTDEQSGSFKLQLKGDGSYVISKL
KGVTRDNLPVDDSDEITGRIGQIIRTPLGKIKVDKAPAFTQFVSGEDEPVLYVSRSNVYAMTDRIKGSLSASLSDVKSTV
IDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIERVLGDVDKNISTFKSSNLLPDVEAAAQQY
MQKSTEVDKQIMDLNSRLAIAQYIRNYLTGKVGKNQLLPSNTGIESPGIEQQITEYNKSQLERNNIVANSSEQNPLVADY
DQSLTSMRKSISASLDNFVVTLKTQLGTLQANEAATTSQIASNPNQAKYLQTVGRQQKVKEALYLFLLQKREENELSKAF
TAYNTRIITPPTGDNTPVEPVRRKILLIALVLGFLIPMVVIYIREKANTTVRGRKDLKKVNVPFLGEIPFSISRKNRPTL
EQRIKFWKKPKEVRMIVVKAGKRDIVNEAFRVLRTNFEFTIGTHPEQNVIVFTSFNPGSGKSHIAANMAMSLAIKKKKVL
LIDGDLRHGSTSMLIHSPGEGLSDYLNGRITDIHDILYKGEENGLVKGFDVIPIGTIPPNPTELLFTPLLEQMIKTMREE
YDYVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLMERSMLPEVNALYKEKKFKNMTLILNGTKAQGGRYGSHYGYGYGY
GYGYNYNKEKNGGAKS
>gnl|bykdb|A0A412GR09 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=784 residues).
MAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFTGLVNVA
SEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSRGMEQRK
VVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRAADILDM
LITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKELDTQLQ
LVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYRALDNLS
ASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSGSNIPIS
PNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALSESFRIL
RTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYLSDSSVE
VTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLFIVRVGK
IDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|A0A413V760 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides nordii] (length=305 residues).
LGIPMGVFWLLNVTDTKVRTRKELDGVLTIPFLGNIPRHGNNKGEDSDGIVVRENSRDSVSEAFRIIRTNMDFMRVKAAN
LQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSGIFSNSSNRMGLTHYLSGSTDKLDDIIGRSEEYD
KLDVIFSGPVPPNPAELLLSERFDRLITELRKRYDYIIVDNVPAGMVADASIVNRVADLTIFVVRSGVMDRRQLPELENM
YRQEQLRNMSVILNGVPSDHKGYGYGYGYGYGYGYGYGYGNESHGHKHGRYESLKNLFSRFFKRS
>gnl|bykdb|A0A414H9P2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNRKQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELISSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|A0A451FS66 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Aequorivita sp. H23M31] (length=822 residues).
MNQEFDIKQADGSFDFKGFFDRLLRSGPLFLISFLITFSIAYYFNIRKLPIYQMENLVAIKDDQNPFFTTTTSLTFNWGG
TTDKVNTSVITLQSRSHNEKIVERLQFYLTYLRDGKFQLIDAYKQTPFLIRVDTTKAQVLNQQFKVVFKDSVNFNLSVSF
EEGKNINLQNYTTKEKSSLFIDTDVFSKDYKLGESISTPFFSGTFIPNEEVISNPGTPYYFIFQDYDTTVKNYLNTKVTP
ESKGSSVLRLTVIGSNKAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKSAELNSVQDELNKFRNKSAVYDL
ATEGSELNSKLNALDLRKEAVNRELNYFITLQEYLTTRTDYRDVPAPSVAGISEGSIIAGVGKIVALAQERNKLQYSFKE
GAPVFNDIDRQINAVKSVLLENIRSSRSLKADEINSINQDIGRYESEIRKLPKEQQDLLNIERRYNLSEGTYNLFLAKRS
EAGLVKAANVSDVVIIDTAKDTGGGKIGPNTQLNYVMAGLLGLFIPLFIIFGMAFFDTKVEYVKDLAKITPIPLFGVIGK
NHSGNILAVLSHPKSAIAEAFRSLRSSLQFLYKQHGVTGAKTVLFTSSVSGEGKTFCSINIASIFALSEKRTVIVDLDLR
KPKVSGAFNMDNSIGVVNYLINEADLDTITQKTEVDYLDVIPSGPTPPNPSELLIGERMDEFMERLKERYDYIILDSPPI
GLVSDAMEIIKYADATLYMVRHNRTRKNMLTFVNEKYKRGEIKHISIVLNEYVEKSGRGFGYGYGYGYGYGDGSYKSYGD
GYHGPLGKKSLADRIKNIFKQT
>gnl|bykdb|B5CTK0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides plebeius] (length=788 residues).
MAEKKQATDLLKGEDSSFNIGEILHMFLSNWYWFLVSVILCLFFGWYTLQKAIPTYKRMATVLIKDNSSGSMSESAVFED
IATVRAERNVSNEMLVFKSNRLMQIVARRLHLDVNYLIEEGLHMKELYTQAPISVRFFDVDEAETLSLTVLPHSEKEVTI
TDIITSSGESVNKSFYIPLNDTVSTPIGRILISPTLYYGKGEFSPLIVRKVNLKSIANSFAARLTIAQALAGSTMLNLSI
IDSSVARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIEKELGNVDSNIETFKRQNRLTDVNSEASMYLASSS
SYQQEGVGIENQLTLAKYIKSYLTDPSKNFNLIPTNTGISGADVNIESSIATYNAMLLKRDKLIDSSSDKNPVVVNLNNS
LSALKQTIIRSIDNTIVALNVKLKNLQAQEARTASRIAAVPTHQKYILSVERQQKIKEELYLYLLNKREENALAQSITES
NVRTIDPASGSNTPIAPDRMRIWMISFLIGIGIPAVFLMLLKMTDTKVRTKKDIENKLSIPFLGEIPKYQGKDDIIIHEN
GRDSISEAFRIIRTNMDFMRMKKDNMKVVTFTSMMPGAGKTFVSMNLALSFALTDKKIILMDLDIRKGTLSAHSKRKELG
VTDYLSGKIADLNQIIVKGKLHANLDMIYAGAVPPNPAELLLSERLDQMIEELRTRYDYIIVDNVPAGMIADAAIVNRIA
DWTLYIVRAGVLDRKQLPDVDALYKSGQFTNMALILNGVDFKHAHKYGYGYGYGYGYGDTKTKHKKKS
>gnl|bykdb|B6W3W8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei DSM 17855] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDA
RVLDPAGGGDTPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|C2FUH6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium spiritivorum ATCC 33300] (length=797 residues).
MVNNQITQNITKADKSVNIIDLFKYLMIHWKWFALSVLLFGGYYYYQYSRSTFMYRSSEMVMIKTPMNTPSTARITRTNS
AFNSVSVAGEILQLNSKELMRRTIDRLNADVSYVIRNGLRDQELYTQSPVKVTWMDKKPDQSFSFTLTPLDGKYVLLKKW
SNGDRAKELKIELNKESNTPVGRIVVTAEKQFTASTVGEDIQVTKYAHEAMVGYIMGNLKIQQMEEDASLLQITLEDQSI
KRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIESELGNVENNIEQLKTANQGVDVNVAGEMYLSESRQHLEE
RNKLETDIRLVDMMRSHLDNKTKRNELIPSNTGLVEANIENQITDYNTTLLRRNRLVEGSSTENPIVQDLDKALGAMRGN
IDRAVENATEGLRVKMQKARSEEQQARGKVIQMPQKQRIMLSVERQQKVKEELYVFLLNKREENALNKAMTDDNIRIIDP
ASGSDAPVYPVRFKKVMTGVGIGIVLPAAVLLCLLIFNTGVRGRQDIESVLDIPFLGEIPQAGKRKTDSNKVLVSKTGRD
VLTEAFRIIRTNIGFMSRNGNSPQVITFTSFSIGAGKTFTALNLAATLSFLDKKILILDLDLRKGTISSRVNVKSALGVS
HYLSNSQVAIDDIICKSGIADNVDIISIGMVAPNPVELLLGKRLDELIADLRNRYDYIIVDGVPVGLVADASIVNRISDL
TIFMVRVGKMDRRQLPEIEKIRQEGKLSNMSVILNGLKQGRRGYGYGYGYGYGYGYGYSNEKRHNLFSSLLEKIKGL
>gnl|bykdb|C3R5A8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei 5_1_36/D4] (length=803 residues).
MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLSNWYWFILSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRTLNREQV
RLSDFSTDATGITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|C9LKL0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alloprevotella tannerae ATCC 51259] (length=815 residues).
MEYSQKNEVQNSEFKIVPFLLLCYHVFLAKWRWFAFSIIVCVACGWYYQQIQPRVYTRQATMLIEGGNGSGRGGFSSSRN
RGSGLNTMMDFNGVTIGDNLSNELFILTTRRLMRKVVDSLGLDVDYTTKNALHRIALYDNRPFDVSFGTKTSVPANFQAE
IMPGGKVRLFDFKLNGEEYSDDIETAPEQAVKTPLGVLKISKNATFEEFSKGKVITVDYIPADLAARRYQGEISATVQDQ
ESSLIVLTCQDINIARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIGSELAGVEGRLASLKESNRIVDFKTA
ADQYSSMSVTARQSSVDLQSQVSVARYLKDFMQNNSNKHQLIPVLNLPDATFAGLVNEYNTMMIERNSTEKNSSPNSPLV
KDLDSKLTTMRNTILSSVRSYVKTLEMRAKSARSNESVINGEVSRAPGLERRALSIGRQQNLKEALYTYLMNKREEVALQ
LAVNDANVRLVEDPLGSNTPISPSRSTIILISLLIGLLIPTLILTIRRLMDITVSGRHDVEEATTIPLVGELPTWEEGGD
DGLITTCSSDAPIVEAFRMLRYGLNFMRHSAKVCVVTSSTPGQGKSFISRNLAAIMGMANKRVLLVDADIRKRTLSSKFG
RSNGLTGWLVDEEEKLSLDEIIIKDGVAKQVDFLPAGMLPPNPSELLMSSRLEALVEEARELYDFIIIDTTPILAVSDAS
IVDRVADVTLFVIRVGVQVRAFLPELEKMNKDKKYRHLCIALNDVDVKAKYGYGYGYGYGYGYGYGNYSYGYGEQYNNRK
SKKKLSGRLLSKLRK
>gnl|bykdb|D1JY72 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 3_1_33FAA] (length=794 residues).
MSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRGLDRFNTYSY
TNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQVRLSDFSTDA
TSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSLRDYSTARAE
DVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKRQYSSTTQEL
ELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLIAMRQNIIRA
IDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALGQATTETDARVLDPAGGG
DAPISPNGRSMIMAGIMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAHGIAVRAQGR
DIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSHTRLHTEEKG
MTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVADAAITNRIAD
LTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFKKKS
>gnl|bykdb|D6D2Z5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides xylanisolvens XB1A] (length=781 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINLLPERHISFVVTPKDDATVTLSGFGGL
PAAGESYEVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|D7J4K6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. D22] (length=779 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINVLPERHISFVVTPKDDATVTLSGFGGL
PAAKDSYDVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|D7JEV9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes oral taxon 274 str. F0058] (length=811 residues).
MEQNNNISNNTFNEEETSSFNFMEWAIRFLKYWYLFVLGVFISLAIAYYQNRSFVPIYNSSLRMLLKQEAGSLSYMQGQG
FNSVMNRLDQTNIENQILLLQSQDLIGRTIDSLPKFRVDFYKKLQFKNRPMYATSPIDIDIISISDISYGKYYLYQRKDN
DYFTIKVFDNEDVELETVEGRYNEPVGCKYFLIKVIENKAFRDVDKVHFRFRHRQELIAEFSSKLAIQLIPNTSVLNISV
LSDNPLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIISDSLSRSESNLNSFKVANKMYGQNNTSILTERMES
LENQGKQIRLRDEYFKYLRNYLKNNIDNESLASPTTIGIQEPRLIALVDKYNELQIKLLDLGVKNPQYDVVISQIRQIKT
QLNELINSVSDVYKIEKSSYQSDLSALNKLLVEAPNKELRMLDYERRYKINDSYYTFLLQKRSEAQIRKASNSPDNAVMQ
KARTSQLVNANQKQKKYMIFFFIGLAIPAVLIILKELLNNAIRTEKDIERATRNRFPTIGSVRHTKHKADERVIASKYPN
SYFVEQLRVIRTKIEFILKRKEKITVLISSTESGDGKTYISLNLAGVFALQNKKILLIDFDIRKPNLTKNLGGMVKNKLG
FVNYMIGDCSLNEAIESTPYGFDFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYDYIIIDSSPLGLVADAYALFSVVDIK
LLVVRSFKTNKMEFTDLSKRLYSDNIEDIYIILNDVDKSKIGYVYGYGYGMHKKMGNYYVTEEFEQDDVSILEKLIYKIS
DMTKKIRNIKK
>gnl|bykdb|E4T131 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Paludibacter propionicigenes] (length=798 residues).
MDKFNLEKPFNSEEESGFDIMEWVSYFLNNWYLFVIGIILSLGLAYIENRSWLPTFQTEGRVLIDENRSSNANSSQALMQ
GFGIQSGYKNAKNQIIMLGSNDLFSKVVDSLPFLKVDYISKGSFKTRNLYKTTPIIIQTDYIAPEAYGVLFKIKLHSNGS
YTISVDDKNLFSKFQINGRYGRPLQHNLFFLTVHNVNKYMGNTEMYFKFRTKESLVNDFISRFSTSYVTEGSSVLRINFV
SDTPDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVSKSLTTSESQMTNFRQSNKIVDVSSHTSDLLGKATK
YDGQQAELKLREDYLTYLTKYLKTNLEDGAIVAPSSLGLSEPMLMKLVEQVNDLYNQRSDLTEANPYYAKFTKQIETSKL
TILEVIKSMRASLEIEKSDFNKRLSVVNKQIEELPEKELEQIAIQRKYKMDDNYYTFFLQKRAESEILKASNTPDNDILD
KARIVGVTNSDKRSKTTMVFLLFGLLIPTFIVILIELLNNTVHSTKDVEKNSVFPLIGAVRHTKSTDPLVVSKNPRSAYT
EMFRIIRTRIEFIVQRKTNIIVMTTSTESGDGKTYFSINLASVYAMASKKTILVDMDIRKPSVNQRFNIVHPLGVTNYLV
GQCALDEIILKLPKVDFDILPAGSIPPNPGELIRSEKLGKMFEELRTRYDFIIVDSSPIGMVTDAYSLAQHSDVNLFVVR
NGKTNKTFFKKLCAQLKLDNIPQLYTVLNDVLDDESKYTKYKLYKYAYLFGFSYGYTSKKKKGDAEKYFHYYQDDTEI
>gnl|bykdb|F0R0C9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salanitronis] (length=802 residues).
MAIPNNPTRPKQGDDFIRIQDLFYLCLAKWRWFVVSLVLTLGIAVYYLLTTPPVYTRAASLLIKEDSKGQSLSGDVGSTF
ADMGLFQANTNVNNELLSLQSPAVMLDVVKRLHLHTDYLTDGTFYKQVLYGQTLPFSISFFGLQDNETASLTLRQGASGK
LELSDFTRNGEKVEGISEGKLNDTIASPVGKLLVEPTPYYNIGFHEPVYVSRSSLHGATGAYSSRLSVVLSDEKSTVINL
SFQDVCIQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDENISSYKSEHLLPDVQAASNLYMAQ
SSETNAQILALNTQLSMARYIRNYLTAASSRNQLLPANSGIESANIEQQIGEYNTMQLQRNNLVANSSEQNPLVKDLDQS
LASMRRAIITSVDNLMVTLDTRIRSLQRSEQQTTERLAANPSQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRVITPPTGSMLPTAPVRRNILLVAFALGLLIPVVIVFVRENMNTKVRGKKDLECLSMPFAGEIPLAGESRRKHLFASK
TYDAPRGIVVKQGKRNIINEAFRVLRTNLEFMTSENEKANVILLTSFNPGSGKTFLSLNIAGSLALKGKKVLIIDGDLRK
ASVSAFIDSPKTGLSDYLGRKTDAIDTAVVEAPQCPGLYILPVGTLPPNPTELLAEDRFGKLVAGLRDRYDYIFIDCPPI
EIVADTQIIEKVADRTLFIVRAGLLERSMLAELETIYQEKRFKNMAVILNGTLDGNNRYGYKYGYKYGYHYGYGSKDYYN
NE
>gnl|bykdb|F4KR18 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Haliscomenobacter hydrossis] (length=776 residues).
MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILSKWYLYLAFSIICIGLAYVYYKNQQPVYAITSKLLIRERERDYGP
GADFVKQNINFAAAAEDASNEIEMLTSFALMKAVVEDLGLETRYYWKHKFSEYDAYGNFPIVVDTFKLNPSAESTFKITP
LNNYSFRFSQGSKTETQRFGTLFSNQFGVFRINRIGALPISSDSSMYVSFQDTKGLARNYQHNLSVELSDEKNHSSVLIL
GLRDVVPQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANISAELASAESTVESYKLNNDIIAETTTDLSITLE
DVNNLVKEQRKVELQQKMLQAMKSDLQDTSSKFKLIPINPALYDGKIRDLIQPYNDLVMERERFLTKGQTSNPVVQSNNQ
KLKSLQSSINLAIDHMQDDLNMQQNKLKYHYDQSSNHLRSVPSKERGLSDRVRIQSIKENLYVYLLQKREETALALVSNY
ANALLFDPPYSSIGPVGPNKIKIFAAAGMGGLAIPFFLILVLELLKNSVQTEEDLKSMLPEKTIMGVINHQKGKKQHSLL
SKSQNTLTERFRTLRTNLQFHQREKTKSILVTSSTSDEGKTFVATNLAMSFALAKKKTIVVDFDLRKPSISKYFEGNAEI
GLSSFLINQLEVEEVIQTSGDLPNLDYISGGPFIPNVSEQLTEQQLSVLFAYLKSKYDVIIIDSSPIGVVSDGMLLNNYV
DNTLFVVRSNFTKKATIAKAREIFEQNKLVNPAIIFNGVKKQNDAYGYSYKDYGYA
>gnl|bykdb|F5IV23 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas gadei ATCC BAA-286] (length=801 residues).
MDNNNKKVIESDPYFEEVKTKTNISFDFVLWFYRILKYWYLFIISVALFLGYAYIKNKSWVPVFYVQALMILEDRNTASV
VAGSVPTGTLLRNTENQQIVLKSYGLTERTVKSLPAKMRIEYYIQTRFKYISLYTDTPIEIEMIDIKPEAYNYSYEIAYI
DQEKCEISYKENPESETKISLIAPFEQEIDYKLFKIKLHKTPNFRNDVKGAFKPDISTFNFRFLSEGQLIGMYSGRIGSD
LQNNSSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLINDSLDISRFKLEKFQKETGVYDV
SSQSLRIALDSADREKDALALREKSVLLLTEKMKEKILGTDDLMDPASMNIRNPKLSEFVVKYNELLQKARNLGAKNPLY
NKTIDELNDLRVKILQEIQVSQINLQNQKDALVRKYEVLQLKIDNLPPQERDLIKFQREFRVNEMYHQYLTQRQYEAKIQ
KASNTPDNFIWEAPRQMGGAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEECEKISGFPVIGTIENVSKK
LNNGVVLVKNYPKSSFAESFRNMRVRIEYMAQRENKITVLVTSTEPADGKTFIATNIASVYQLMGKKVIIVDLDLRRPSV
AKTLQIDSQKGISNYLIGQVTLDEITYSHPDYGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYDYVIIDCSPVGLVS
DAYILSEIADTTLFVVRRAKTNKSFFKSVITQLRYDGVEDIALVFNDVKGREGYYGTSRYYGDRTYYLKKNSYYHDDYFE
N
>gnl|bykdb|F8X2T0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas mossii DSM 22836] (length=798 residues).
MDINNKPGADTDPYFEEIKSKTTLSFDFVLWFYRILKYWYLFVISVVLFMAYAFIKNKSWVPLYGIQAMIILEDRGSSMI
SGAVPLGSILRNTENQQIVLESYGLTERTVKNLPKKMHIDYFIQTRFKYISLYTDSPIEIAIDSLETDITPEAYSKVFDV
SYVSDSQIRVSYKDGLDGEPEEAFNVVFDSPVENKFFKGTIRKTKNFKRDFLPFSFRFFTNSQLTGMFSGRVSTALKTEN
STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLEQFQKETGVYEVSSAT
VRRELDVADVDRDQVAMREKTVLFTTQKIKEGIMGSSELIDPVSIGLTDEIKLSRYVEEYNQELRKSKNLGPKSPIYMTA
INKLNESRVQILRELQLIQVKLQDQKDLLVKKYQNLDLKLDNLPPQERDLIKYQREYNVNEMYHQFLTQRQYEAKIQRAS
NTPDNFIWEYPRMVGGAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECEKISGLPVIGTIENISKKLAG
GVVLVKNFPKSSFAESFRNMRVRIEYMAQRENKITILVTSTEPADGKTFIATNVASVYQLMGKKVIIVDLDLRRPSVGKT
LQVDAQKGISNYLIGQVTLEEIIISHPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYDYVIVDCSPVGLVSDAY
ILSSMADTTLFVVRRAKTNKAFFKSVITQLGFDGVENIALVFNDVKGREGYYGTSRYYGDKTYYLKKNSYYHDDYFES
>gnl|bykdb|I8WPP8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei CL03T12C01] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRILNRKQV
RLSDFSTDATSITLTANLGDTIQSPVGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKSYLVDPSKETELIPSNTGIADINIETQITAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKGKTENKETAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTKEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPEVEKIYRSGQLNNMSLVLNGAIVKTGGYGGYGYGYGYGYGYVDGSESCWKRLFR
KKS
>gnl|bykdb|I8WPR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei CL02T12C06] (length=803 residues).
MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLSKWYWFVLSVSLFGGYAWYQYAKLPFIYSRSATVMIKDAYSNNIGRG
LDRFNTYSYTNVSNEILQFQSHKLMRDVVNRLHANVCYLIMDDLREEELYTQAPVKVSFPEEEDHLDFSLTVRIQNRKQV
RLSDFSTDATSITLTANLGDTIQSPIGKIVVSPTLYYTDKWFNTPITIRRQSTDTMASLFRSNLNISQAENDASILYLSL
RDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR
QYSSTTQELELQARMARYIKGYLVDPSKETELIPSNTGIADINIETQIAAYNANKLKRDKLIEGSSDKNPIVQELNKNLI
AMRQNIIRAIDNMIVSIDVKLNEARSRAGEAQWRVTNIPRQQQQMLSIERQQRIKEELYLYLLNKREENALSQATTETDA
RVLDPAGGGDAPISPNGRSMIMAGVMKGIALPAIVLLLFLFFDTRIRNRKDIEDAVTVPFLGEIPKDSSKRKIENKKTAH
GIAVRAQGRDIVSEAFRIIRTNMDFMRVKSKNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKKVILIDMDIRKGTLTSH
TRLHTEEKGMTSFLAGKATTDEIIKHNEICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYDYIFVDNVPVGVVAD
AAITNRIADLTIFVVRVGKLDRRMLPELEKIYRSGQLNNMSLVLNGAIVKTSGYGGYGYGYGYGYGYVDGSESSWKRLFK
KKS
>gnl|bykdb|J6GV98 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. oral taxon 279 str. F0450] (length=796 residues).
MSTQTNRSNQAGEKAAEVNLLDIFFYLLRFWWLYLLSVGVVLAVALYRNAKQPYVYESSVKIFIKDASQRAMMDTEMLRY
ARAARLNMDNEHVQLVSRRVLERTVKMANANVFYNVKSGLRTLELYSDAPFSMKFLDTTERKSVYEVAFQDAGHVRVTPV
HTGKSQVVPLNVPVQLGDERFIIEPHQNFNTPWEYKHIEVNRMPFTQMVRYYQHAILVAEPENRASTLTLRLQDRTKKRA
LDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSLESEAEALQ
IETQLKLISYMLSEFSNSHRKNGYLPLNVGVPDQALDGYIAQYNQLKSQRDKLVEGAGGSTENPVITEYDNALSQLRKNA
IESLNQQAAVLRMRLKDTQGQQSSLLSKLPEVSNQGREKADIDRRLEIRQRLYTELLNKREEYALRQAMTQDSAYVLDMD
DAPSKPVSPNALRVALIAILIGLVLPSVYLIIRLLADNKVRSRKDVMDRVSIPFLGDIPKEEKRGGKKAQPRGVREQGSD
ETSEAFRVLRENMRFMIGTGGKKAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHSVVLVDLDLRKGTLSRRIGLAGMGAT
EYLSNPDVRLDQILRKDPNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFDFVLFDNVPFGSVADAAIANRIADL
TIFVLRAGRLDRRALPELQHLYDENILTNMSIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKGLLRRLGLR
>gnl|bykdb|L1M9T3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. oral taxon 473 str. F0040] (length=780 residues).
MVRDGFYLCLAHWKWFVLSLLVCLSSATYYLLRTPKTYVASASILIKPDSNKGNTPDELLARRMNVESGLDAQMTNEMLS
LKSVTITRAVAERLNLDVEYTHKGMFHPKVIYGSELPVKTEFLNISEEQTASLSLTLMADGRVLLENFVRDGQNLGGSVL
SQVGKRCATPIGLLKLTPTNAYRKGMTDEYDIKRSSISTTAAIVRSRFDVQLSDKASTIIDIRYSDVNTARAKDAIDMLI
SVYNENWVKDRNQISVSTNEFIKERLSVIQRELGNVDQNIAGYKSANLLPDVEQSGSMAMAQANDAEIKARELSTQTYMT
RHVREYLTDGRHENQVLPSNSGINNPSIQAQINDYNSKLLERNRLLATSSAQNPAVMDLETQLGSIRRGIIQSLDNELDM
LKTQQRATEASHSEATSRISANPRQASYLLSVERQQKVKESLYIFLLQKREENELSQAFTAYNTQIIETPHVTGTPATPV
SKKILGIALLLGLGIPAALIFAREGFNTTVRGRKDLEDMSVPLVGELPFKGKKRPVWQRWRKQTIVAQPNMVVADQQRDI
INEAFRTVRTKLEFSMGFDNGCKVIMVTSMNPGSGKTFITANLSTAYALKGKRVLVMDLDLRKASLSQYVGNPQIGLSNY
LSGQINDWHKIIIPLGQVDCLPSGVIPPNPAELLSTSRFRDLIETVRQEYDLIFIDCPPVEIVADAEIINPVADLTLFVV
RAGLMERSFLNDIERWYLDKKFHNLTLLLNGTTDALGRYGYHKYGYGYGGYGYGGYGYGK
>gnl|bykdb|L1NGW4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas catoniae F0037] (length=797 residues).
MANTQETTSTQPAEKGLEVNLVDIFFYLLRFWYLYVICVGIVVAFALYRTAKQPYIYEASVKVFIKDASQRSMMDADVLR
YMRSFRLNMDNEKMQMSSRRVLERAVKTVNANVYYQVQSGLRTLELYTAAPFSMRFLDSLEKVATYEVRFKDAGHVSIQP
QGSSKAQDVPLNVPVQLGPDRFIIEPRSNFNSPWEHKTINVIRHPLVGTARYYQNAVAISQPQEKSSTLMLSLQDRTKQR
ALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLSKELGIVENEMESFLVTNRTLDFDAKMGRYNTRSVDYEVQAM
EIETQLKLVSFMLSNLSSPQKQTEYMPLNIGVSDPNLDGYIAKYNQLKGDRDRLVKASEGSTENPVIAEYDRGLAQIRQN
AISSLNQYANVLRVRLKDAQGTQSSLLSQLPDVSNKGREKAEIDRKIAIRERLYTELLNKREEYALMQAMTQDSAYILDM
NDAPAPPVSPNKTRTVLLAILIGLALPTIGLIIRLLADNKVRTRKDILDRLTIPFLGDIPKEDAPGRKQPRGAREQGSDE
TSESFRVLRENLRFMIGSGDTPSKKIIFTSFGESAGKSYVSYNLAKTLTFSGSTVVIVDLDLRKGTLSRRAHVAGQGVTE
YLVDKAMPVEKIIHKDPNFSKLAIIPAGAIPPNPAELLLGHRLDDLAQELSDRFDFVIFDNVPFGSVADAAIANRIADLT
IFVLRAARLDKRALPELQRLYDNEILRNMSIVLNGASDGGHGYGYGYGYGYGYGYGYGYGYGNKKKKGILYRLGLKK
>gnl|bykdb|Q8ABP9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=779 residues).
MQNNSLSNKNEQGVNLVDLSVYLLSKWKWFVLSVLLFGGMAWYHYAKSPLVFFRSVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVESGLRMNELYTLSPVNVSFINVLPERHISFVVTPKDDATVTLSGFGGL
PAAKDSYDVRLNDTLAVGGERILVTGTDHWGKSWTGREIHVVKNPLNAVAGRLQGSMGIRQEEDESSILVLSLKDGSPLR
AEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQAYSADAL
EQETQLKLARFIKEYLTDPTKSRDLIPSGTGISDAAVEGQINQYNALKLKRDKLIADSSESNPVVEELNNSIHALRQSII
RAVDNMIVGINMKRNDARSRQEQAQARFTTVPTKERQMLSIERQQKIKEALYMFLLNRREENALSQAMADNNARTIDSVD
GPAGPISPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVHSRKDLKGAVSIPFLGEVPQDKEAAKAGVAVGEEDGMLAES
FRILRTNMTFMVKKDKPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKRVVLVDLDIRKGTLSRHFHKHPVGVTNYLADD
SIRLDDIIHTDGKFDNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYDYIIVDNVPVGIVADATITNRISDLTIFVVR
AGRLDRRLLPDMEELYRDNKLRNMAIILNGVGPHRRGYGYGYGYGYGYGYGYGKHGRRK
>gnl|bykdb|R5DEG6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii CAG:246] (length=600 residues).
MVVVPSLYYGDKYFNTTVQVTKSPLQNVALRFQSGLQATLASKTATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKN
QIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTSSQYRQEGLSLENQLSLAKYIKNYLTDPGK
NSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSLIAMKQTIIRSVDNLIVGLNIKIKNIRAQE
EQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESNARIIDPAAGSNAPVAPKAMMILLASVVLG
CAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKNEVVVHENGRDSVSEAFRIVRTNMDFMRVKEKNMQV
VMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLDIRKGTLSSHVQVSDMGVTNYLSGRIDNVDEIIQKGELYDKLDII
HAGPVPPNPAELLLSDRLEALIAELRERYDYIILDNVPAGVVADAVIVNRVADLTIYVVRAGRMDRRALPEVEKLYREGK
LRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGQRKKK
>gnl|bykdb|R5JJI4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:189] (length=755 residues).
MIRDDSKGGSISESTAFADISFLGGKRNVDNEVLVFQSRHLMEKVARRLHLDMSYKVKNGLREDELYTHSPITVLFPESE
ERQVIEMTVTPVDSATVRLSDFSLSIAGEEIRSAEVVDARLNDTISTPVGTMVVTPTLYYTDTYYGKPVYITKSNMEKVV
EGYLRRINISLASKTATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIE
SFKRENQLTDITSETGMYLQNTSRYKQEGLSLENQLSIVKYIKEYLVDPQKGSDLIPANTGISDNSVESQIKEYNDMLLK
RDKLVAGSSNKNPIVIDLNNSLGAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPTQQKYVLTVERQQKIKEE
LYLYLLNKREENALTQAITESNARIIDPASGSSVPVAPKSMMILLAAIVLGGTIPMIVLWLLNVTDTKVRTRKELDNILT
IPFLGDIPRHGTRKGEDTDAIVVHESGRDSVSEAFRIIRTNMEFMRVKSDNLQVVMFTSANPGAGKTFVSSNLAMSIAQT
NKKVVLVDVDIRKGTLSGIFSNPSGRMGLTHYLSGRTDGLDDIIGASEEYGKLDIIFSGPVPPNPAELLLSERFDRLITE
LRKRYDYIIVDNVPAGMVADASIVNRVADLTIFVVRSGVMDRRQLPELEKMYREEQLCNMCVVLNGVSYERRSYGYGYGY
GYGYGYGYGYGNEHHGNNKQGVAKRIINKLIAFFK
>gnl|bykdb|R6D982 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:754] (length=797 residues).
MEKQVKKILAEEDKSINLVDILMYLLSYWKWYVLSILICGGYFWYDYSRTPFVYSRSATVMIKTPANTPSAIRLIRSGDY
MGQVNMATERLQFQSKALMRKVISRLNADVSYAVRDGLRQKELYMAAPVRVHFLVSEPEAELSLLVTPKNERQVELSDFS
RGAESRKTVNINDTVETALGRLVVSATENYDSSCWGKPVKVSKQAREKMVYFFLSNLSIKQVNGDVALLNIMMDDFSPLR
AGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIEDELGSVETDIEVMRKESDWGDINTAASMYVSDGRKYESSLK
ELDTQLQLVSFIKQYLQDAAKEDELIPGDIGLTDAVIEGQIARYNEALLRRNRLRSGSGGNHPVVQELTRSVETMRQNIN
RSINNQVTSLKLKRTEISGQERLARRKVRDVPGKQREMLSVERQQKVKESLYLFLLNKREENALNQSMVDNNARIIDSAS
GSNAPFYPNKYKKLLLGGGMGILIPTVILLLILIVDTRVRNRKDMEAVVSAPFLAEIPKSAEKVTEINDIMVRARGQDAL
SESFRILRTNLGFVASQSPGQKVVTLTSFNVSAGKTFVSVNLSASLVQADKKVILIDLDLRKATLSLIAKARGNGIKGMA
HYLSNKSISMDDIIMKDGFGERIDLIPVGVIAPNPAELLLSGRLDELIGHLRERYDYIIVDGVPVGMVADVSISNRISDV
TLFIVRAGKLDKRQLPELERLYQEHKLNNMAVVLNGTKQGRRGYGYGYGYGYGYGYSYGNDEKKKNWFFGKRKKESV
>gnl|bykdb|R6U429 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:770] (length=732 residues).
MRDLASFTGGLSRMRSSGSNVYNEMEAFSSPDLMCSVVKRLGLETSYVEKQFLRTRDLFTNSPLALVRAGDNNASSFSFE
IMKEGEDAFVIKDWHVAGEEMEYAKIKGRLNDTLDTPVGKLVIAPTMLYDQWKKPIVISWVNAKKLAKAYNKSLSVSLSG
KESTVLVLTLTDRFPSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIEKELGGVEEHLKDYKAEHNITDIQS
LSAAYLGESTEYKSMSFEVNNQLAIAKFIKEYLENPAHDGALIPANSGLTNSTVESQIGEYNQLVLSRDRLVSGSSSENP
LVLDYNNSIAALKIAINRSIENLISTLKLQADKVAAEETNIMNKISNTSGQELQLLSIERQQKIKEELYIYLLQKREENE
IASLVNVGNTRLVMEPAGEDMPQSPNKKMIMLIALILGAGIPFGIFFMINQLDTRVKTRNDLTNMQVPFLAEIPQLGQGA
GILNKMRKKMCDDANTKIVVAPSNRNSINEAFRVLRTNLDFMTGGQEGCHKVMITSFNPTAGKTFVLMNMAATMALKGAK
VLLLDLDLRKGTLGKALEHNKSGISAFLNGKLESIVPEIQNIKENLDLISVGSLPPNPAELLVSEKFDKMMDELSARYDY
IFMDCPPVDIVADTSIIAKHADYTVFVIRAGLFDKRALPAVEDAYERGVYNHMAVILNGVDTTSKSYGYGHYGYGYGYGY
GYGYGYGNNVQD
>gnl|bykdb|R7CUW4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:462] (length=782 residues).
MQTTSNNNRNEQGINVVDLLVYFASKWKWFLISVLVCGGLAWLSYARSPLVYFRSATVIIKDPSNKTSTAGLDRYDNFIN
KVNVANEILQFRSKKLMREVVQRVHADVDYLIQDGLRYNELYTQSPVRLSFPDAMPEQGLALTVQPKSERSVTLSRFSWM
EADSTCTVAMGDTVRVHGQRLVVTPTNYYAASWTDVPIRVQKRPLESVVNRYKGALGIQQEEEESSILTLALKDSSPVRA
EDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIERELGGVESDLESFKRSNQIVDISSAAGMYMTESQKYNADALE
LETQLRLANFIKDYLTDPSKETDLIPSNTGLSDMNIESQINLYNTAKLKRDRLISDSSEKNPVVEELNNSLRAMKQTIIR
AVDNMIVSLNVKRNDAQNREMRAQSRVTSIPTKERQMLSIERQQKIKESLYLFLLNRREENALSQAMADNNARIIDSAEG
GDSPISPRRNRILLLGLLVGIALPGVGCLLVLFLDTRVHGRKDIEKAVSVPFLGEIPLDKEAARQHGRTAKASVGQDDSI
VSEAFRILRTNMAFMSRKDRPTQVITFTSFNEGAGKTFISCNLAMSFVYARKRVVVIDLDIRKGTLSRHLGEHRTGVTNY
LADTTVTVDDIIRKGEHFDIIASGPVAPNPAELLLDSRLDTLIAELRTRYDYIIVDNVPVGIVADATIANRIADLTVFVV
RSGRLDRRQLPDIESLYEDKKLHNMALVLNGVDPHRHGYGYGYGYGYGYGRYGYGNKKHGRN
>gnl|bykdb|R7F6L5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:485] (length=814 residues).
MANQIKENEAANISPYYEQAAPASLVSVQGFLSFVRHRWYWYVISVAVCVGIAWLMLARSPRLYTKSETILIKDPTFGNS
ASSVDLSEVGVMPKYANLENEIAIFTSPDLMENVVKAYNLNNFYSYNDGFKDVDIYHQEPGIISSPDAANADASYSFKYI
VKPDGTVILKDFNKGGTELPDKPLSCKLGATVKTPVGAIAIDRPEWVSDYVDKTIHYSHVPVRPVAESIVGGLKATYEAK
EGTLIALSYTSTSPYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIEQELGNVDSDISSYKARTMSPDLEAQ
AQINMARSSELQNQQYDLSNQIQILNYVRGELSREGIDETLPSNMGIANTGLESQIQVYNQQVIERNRLLKTTGANNPQV
VEKDEALRTMKRNIQHTAATYATSLNTRLSGVRSQESVTNSRLATAPRQANYLLSVERQQKVKESLYLFLLQKREENELA
QAFKSYNTQVVRQPAGPGAPISPVSTNTYLIAVLIGLIIPSGVYVVKANLDNKVRSREDVENIGIPFIGEIPQKGRKKLG
KDSSSERQVVVRADSTNVINEAFRVVRTNLDFFLTSDKKGAQVIMVTSANPGSGKTFITMNLAVALALKHKRVLMIDFDL
RRAALSNAFGSPREGIANYLCGADQMSDIVQHNVNDVEGLDLIGVGNLPPNPSELLYSERLKTLLSTMEQEYDFIFFDCP
PIEVVADSRILNEYVDTTIFVIRAGLFDRRMLKSIRNLYAERRYNNMCLLLNGTSVGHNYGYGYGYGYGYGYGYGYGYAY
GDDNDKKKKKRKKS
>gnl|bykdb|R7JFY1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. CAG:409] (length=276 residues).
MAIPAGILWLRWANDTRIRSMKDVQDRTALPLLGEIPALEKNQEKLVVKEGSRDAVSEAFRILRANMDFMRGGDEHMQVL
LFTSMNAGAGKTFISSNLAASLVLTHQKVVLLDLDIRKGTLGKQAGYRGEGITNYLSGKVTDVTSLICQDELVPGLDVIH
AGPVPPNPAELLQNKRLDAMIAELRTRYDYILLDNVPAGLVADAQIVARLADLTICVIRAGVLDRRQIPALEMLSRRFPK
FSLVLNYVKGHHGGYGYGYGYGYGYGYGYGNEKKRK
>gnl|bykdb|R9H6G0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron dnLKV9] (length=790 residues).
MEKHKKLAVTEEEKSINIVDLFVYLVVHWKWYLLSILLFGGCFWYIYCKTPFTYSRVAIVMIKTPANSRSTMQLNNSDFT
GLVNVASEILQFKSKELMRKVIDRLQANISYTVYDGLRPVELYTESPVRVTFLDAGMDEAHSLSVTPKSRQQVELADFSR
GMEQRKVVNLNDTIHTALGRLIVFAAENYGESSFGKPVLVTCKPPEEMVSFWLYNLAIKQMSGDAALLHLTMNDLSPTRA
ADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSREYESSIKE
LDTQLQLVTFIKQYLQDSSKEDELIPSNIGLEDLNIETQISRYNETLLRRNRLMNGSSSNNPVVQELNRTMQTMKLNIYR
ALDNLSASLRLKKQDYSLQENRVRQKVQAVPRKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARVLDPVSG
SNIPISPNKYKKLLLGVGCGVIVPSVILLLMLMLDTGVHNRKEIESIVSAPFLADIPQTPKAMANVHEVVVRARGLDALS
ESFRILRTNLGFMLSQTQERKVITLTSFNIGAGKTFISINLAASLVQTEKKIVLLDLDLRKGKLSEMAHCRQVKGVAHYL
SDSSVEVTDIIVQDAFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYDYIIVDNVPIGLVADATVVNRITDLTLF
IVRVGKIDRRQLPELERLYQEHKLNNMAVVLNGTEKGSSGYGYGYGYNYGYGYAATQKKKGGWWRRKGKK
>gnl|bykdb|U2K8K9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. oral taxon 278 str. W7784] (length=795 residues).
MPEQQITNRPSDKGADLNLVDIFMYLYRYKFLYILCVGIVVALALYRNARQPFTYEGVVKIFIRDASQRTMVDDNMLRYM
RNTRLNVSNERIQLSSRRVMQRTVRLSGANVFYNVKSGLRTLELYDEAPFKVTFLDTLDVANTFRVSYQDASHVSIKLGK
DGRTQVIPVGEPIRIGETRFIVEARKTFNAPWAYSEIQVSRIPFVDAVRFYQHSVAITQPEAQTSTLTLTLRDKTLKRAL
DILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALSRELGVVEQDMTRFSARNKTIDFTSKVESYNARSLEEEDASIKI
EKQLKLVSYMLSQLNSPSKRNELMPLNIAMPDPELDGYITQYNQLKFQRDKLVESSGGSTQNPVIAEYDATLDQLRKSAT
EILNQQASALRARLKSVERDQSALFSKLPGVTEEGRTKADIDRRLAIQEGLYTELLSKREEYALRQSMTQDSAYILDMND
APNTPPVSPNTLRTIVLAFLLGLALPTIFLIVRLLTDNKVRTRKDILDRLTIPFLGDIPKEERAKSGHTRGVREQGGDET
SEAFRVLRENMRFMIGSAAGKTKKIIFTSFGESAGKSYVSYNLAKTLTFSGHRVVLVDLDLRKGTLSHRAGIIGKGVTEY
LSDPTVQVDQIIRKDPNAPKLSVIASGAVPPNPAELLLGERLDELADKLSEQFDFVVFDNVPFGSVADAAIANRVADLTI
FILRAAKLDRRALPELQRLYDDHILTNMAIVLNGATESGHGYGYGYGYGYGYGYGYGYGNKKKKKTLLQRLGIRR
>gnl|bykdb|Z4WRA0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas catoniae ATCC 51270] (length=795 residues).
MANTQETTSTQPAEKGLEVNLVDIFFYLLRFWYLYVICVGIVVAFALYRTAKQPYIYEASVKVFIKDASQRSMMDADVLR
YMRSFRLNMDNEKMQMSSRRVLERAVKTVNANVYYQVQSGLRTLELYTAAPFSMRFLDSLEKVASYEVRFKDAGHVSVLP
QGSSKAQDVPLNVPVQFGPDRFIIEPRSNFNSPWEHKTINVIRHPLVGTARYYQNAVAISQPQEKSSTLMLSLQDRTKQR
ALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLSKELGIVENEMESFLVTNRTLDFDAKMGRYNTRSVDYEVQAM
EIETQLKLVSFMLSNLSSPQKQTEYMPLNIGVSDPNLDGYIAKYNQLKGDRDRLVKASEGSTENPVIAEYDRGLAQIRQN
AISSLNQYANVLRVRLKDAQGTQSSLLSQLPDVSNKGREKAEIDRKIAIRERLYTELLNKREEYALMQAMTQDSAYILDM
NDAPAPPVSPNKTRTVLLAILIGLALPTIGLIIRLLADNKVRTRKDILDRLTIPFLGDIPKEDAPGRKQPRGAREQGSDE
TSESFRVLRENLRFMIGSGDTPSKKIIFTSFGESAGKSYVSYNLAKTLTFSGSTVVVVDLDLRKGTLSRRAHVAGQGVTE
YLIDKAMPVEKIIHKDPNFSKLAIVPAGAIPPNPAELLLGHRLDDLAQELSDRFDFVIFDNVPFGSVADAAIANRIADLT
IFVLRAARLDKRALPELQRLYDNEILRNMSIVLNGASDGGHGYGYGYGYGYGYGYGYGYGNKKKKGILYRLGLKK
© 1998-2019