BYKdb

Dataset for cluster tad of phylum bacteroidetes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|B7B948 [Bacteria] Adaptator of bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=384 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLQAVPVSGKEVMLS
GFTLGDQEVSDGKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVALLFQSGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISAYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKNSDLIPANTGISDVNIESQIGEFNEMLLKRDKLIS
>gnl|bykdb|B7BDT7 [Bacteria] Adaptator of bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii DSM 18315] (length=264 residues).
MATQNNISRPKQTDDFIRIQDLFYLCLNRWYWFVISLAVTVGVAVVYLLTTPPVYTRSASLLIKEDSKGNSLGDAAGLMG
DFDLFQTNTNVNNEIQSLQSPAVMLDVVKRLHLDVNYHTDGGFYKKVLYGRDCPYTVDFNDLQDNESVAFTINPSQNGQV
LLTDFSRNGEDVAGNITATLNDTVDAPIGRLVVKVANDSAIQDAPVYVSRRGYQDATGGYASNLSVTLSDEKSTVINLSF
KDVCIQRAEDVLNTVIAVYNENWI
>gnl|bykdb|C2MBF7 [Bacteria] Adaptator of bacterial tyrosine kinase [Bacteroidetes][Porphyromonas uenonis 60-3] (length=566 residues).
MEYATDSIQQEPARSLEEASTLSLQDILMILKANWLFILLSLIVCLTLGFLYIKSSPHQYSRSASLLIKNETPMSSAMQQ
LAQFAGDKHAYSDDVSNQIIILSTERVVSETVRRLGLDVQYHYNAGLREKDLYKQSPVSIRFVNADPDEKITLRVKPDKG
SDSQVILYDIKSSLVGKVQEPITAPLGDTIATPIGQVVVEATPYYSNFPSYEVLKVQKENFHSIVDSYMRSLQVSLQQKD
ASVIKLTMQSSNPQLAEDFLSTLILVYTELEREDKVKVAESTQRFVDDRLAIISSELGQVDAEIEGFKQSQQIADIQAEA
QEYIKGRSEIKTRLVELNNSISIAQFVRGHLKDKNQMEALIPANVGIASPAIEAAIAKYNELLLKRDQLQANSSSQNPLV
QELNTQLAAQRLSIITSIDNLISTLEVERQGILSEQSSYKGRITSVPMQERIVGSIYRQQKIKEELYLFLLNVREQNALS
IESAESNARLIQAPTGPVAPVSPRVPIIMLAAGLLGLLIPTAIIYIRSIANNKVRGKADSRALHDYTCTRRGATLQGLQA
PRQEYW
© 1998-2019