BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Alignment] [Repertoires]

575 sequence(s)

>gnl|bykdb|A0A015UXN7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3998] (length=804 residues).
MTEKKTTASKPADDFIRIQDLWGIFMPRWHWFALSLFVTLATAALYLLGTPNIYTRTAAILVKDDSKGGTSTNVVSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTVRKGLKDVELYKSSPLAVTYRHLDETPVGFTIDISSKETFVIS
DMEVNGKAFGEDFSGKMGDSIRTEIGTLVINFTKYWNDSFVGTSIRYRKGNVCAVTDYYTAALHAELGNEDATIINLSIN
DASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAE
NKKELLALNSQLSTAQYIRKELNNKKLSQLLPTNSGIANVNIESQIGEYNTIVLERNRLIANSSEKNPLAKDMANSLQSM
QRTIIQSVDNLIVSLNTQIRNIRQQEATTTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMLPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSIPFIGEIPQYLSAKKKLGFDKHTQSV
MKAIVVKEGNRNIINEAFRVLRSNIDFMAGKDSGQNVFMLTSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSTS
SYVDSPKTGLSDYLGNRVSDWKEIIVKDEKYDNLHIIPIGTVPPNPTELLEDGKLATLIEVLRSEYDYIFIDCPPIDIVA
DAQIIEKLADRTVFVVRSGLLDRSMLPELENIYQEKRFKNLSVILNGTESAGGRYGYRYGYRNGYSSYYGNKGKMGGGKW
MVIK
>gnl|bykdb|A0A015XH67 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. S36L11] (length=788 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A016CWA4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3976T8] (length=807 residues).
MAVNQKNTRPGQADDFLRIQDLLYLCLAKWKWFVLSLVVTTGVAAVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSNTNVNNELIAFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTISDLPENESAGFTLEVRPDSTL
LLSGFTRNGTDLEGKDIKGRLLDSITTPLGKIVVHTTPNYVEGEAYTLYVDKSGLYNAVNSCSSNLSVSLNNEKASVVDL
SFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNAQIRSLQQTERQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNILMVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFARKRKGIFGKKP
QEVKAVVVKEGSRDVINEAFRVLRTNLEFMTGKDRKSNVIVVTSFNPGSGKSFLTMNIAVSFAVKGKKVLVIDGDLRHGS
ASSYIDSPARGLSDYLGGRLDSLNEIIVTDPKQKYLDVLPVGTIPPNPTELLFNDRLKQVIDTVREQYDYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLERSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKRGRGK
>gnl|bykdb|A0A016E4F9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis str. 3976T8] (length=801 residues).
MIEKKTIVGKSTDDFIRIQDLWGMFVPRWHWFVLSLFAALAVATFYLLSTPNIYTRTAAILVKDDSKSGSSTNAMSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTIRKGLRTIGLYKCNPIAVTYRHLDEIPISFTINLPSKKEFTIS
DVMIDGEELGIDFSGKMGDSIRMEIGTFVINLTKYWNDSFVGTSIHYNKGSVNAVTDYYTQNLRAELGNEDATIINLSID
DASIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGFKSEHLLPDVQAASSLYMAQSAE
NKKELLALNSQLSTARYIRKELNNKELDQLLPTNSGIANVNIESQIGEYNTMVLDRNRLIANSSEKNPLAKDMANSLQSM
QRIIIQSVDNLIVSLNTQIRSIRQQEAATTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMFPTAPRKMNILLVAFTIGLFIPAVIIFMKENMNTKVRGRKDLESLSIPLIGEIPQYFNTKKKLGFSKKMQPD
IKAIVVKEGNRNIINEAFRVLRSNMDFMANKDNKQNVFVITSFNPGSGKSFLSMNIAMSFAIKKKRILVIDGDLRHGSIS
SYVDSPQTGLSDYLGNRVDNYKDIIVEDKKYDNLHIIPIGTVPPNPTELLENGKLAILIKVLGSEYDYIFIDCPPIDIVA
DTQIIEKLADRTIFVIRSGLLDRSMLPELECIYQEKRFKNLSVILNGTESAGGRYGYHYGYRYGYHNGYSSYYGNGNRDG
K
>gnl|bykdb|A0A060RD97 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Mucinivorans hirudinis] (length=787 residues).
MVENKINNEQDPKSLTARQVVELVLANWYWFAVSLLVALLLGGYLYVKSPLVFKRQASIMLKDKSGSGQGEAAIFADLGL
LSSTSSLVDNEIFILRSASLMRTVVQKLDLNVSYSYMGRFRKLDIYGEETPIVVKNVAESEQSNNPVSFTVTPKNSEAFQ
LSYIDENETRVSIEKKFGDTVLIRNVLIEIKPTISAEKFVGKEVNVAVTSVAKAQLDFSSRLTVARADKVSSVVNLSFID
QSPQRATAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGVDTDIADYKQQSNVLDFSAAANMYMQTSNEI
RRDAAEVENQIAMANYIKDYLLDPINANALIPRVSGAQNLGVDSQIDSYNELRLKLDKMLESSGENNPLVVDGRTQLSAL
KMTIIQAINNTVNSLKIKQQNIRNEENLSNRRIASVPTKEKDVAGIVRQQKIKEELYLYLLNKREENALNLAITIPEARV
VDAADGPPNPIAPRLILFAAVSIIGGFALPFAVIFLIIMLDVKVRGRKDVEAYTTIPVLNELPRKSKKQKDDVVVKRGGH
DVMSEAFQILRGNIDFSFKRTKPGAMVIASTSTVKGEGKTFVSTNLALSLSFINKRVLLIDMDLRKATLSKNLSLGGRAG
VTNYLLGKVDKLSDVVLSGVLGSGVDFIPGGAKVASVPSLLTSPEFDKFIDDLRPMYDYILLDNPPAPLIVDTQIINRVV
DFTLYVMRSGKIDRRYLPEMERQYQEKRFNNLNILITDSKMRSKIYGYGSYGYGYSYGYGYGAKMEE
>gnl|bykdb|A0A069SJV7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus str. 3975 RP4] (length=804 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLVKEDSKGKSFSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGNLLDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKHN
>gnl|bykdb|A0A069SMG6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis str. 3776 Po2 i] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRPPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A073I794 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. 31_2] (length=797 residues).
MTEKKTTVGKPVDDFIRIQDLWEMFVPRWRWFALSLFVTLVVAVLYLLSTPNIYTRTAAILVKDDSKGGTSTNASSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNEAYTVRKGLKVVELYKSSPITVTCSHLNEKSVSFTIDILSKDTFAIS
DMEVNGKAFGEDFSEKMGDSIRIETGKLVINPTKYWNDSFVGTSIRYGKGDVRAITDYYTTALRAELGNEDATIINLSID
DASIQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIEGELGNVDENISSYKSEHLLPDVQAASNLYMTQSAE
NKKELLALNSQLSTVQYIRKELNNKEFTQPLPTNSGIANVNIESQISEYNTMVLDRNRLIANSSEKNPLVKDMANSLQSM
RRTIIQSVDNLIVSLNTQIRSIRQQEAATTQQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMFPTSPQKMNILLVAFAIGLLIPAVIIFIMENIMNTKVRGRKDLESLSIPFIGEIPQFFIQKKKLGFNNKIQP
DMRSIVVKEGSRDIINEAFRVLRSNIDFMLGKNSRQNVFVITSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSI
SSYVDFPKVGLSDYLGNRVNSWKEIIVKDKQYDNLHILPIGIIPPNPTELLEDDKLISLIGALRSEYDYIFIDCPPIDIV
ADAQIIEKLADRTVFVVRSGLLDRSMLSELENICQEKRFKNLGVILNGTESVGGRYSYRYGYRYGYHNGSYYYGSNA
>gnl|bykdb|A0A076HRT9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. APR13] (length=822 residues).
MAVNENAELESLIRNATGGVSAVPVESEPADDGGGLDFDTLLMVVRRSLLWLLLLIGLGLTGSWLFLRYTKPVYKSSSLL
KIDEKTEAGTLGLGGAMKEAEGRQSLNKLSGEVELIKSNIIYRRLRDSLDLDVNYYAEGTVLESELYGTSPFRVQYDGEV
LYNTKFNLRFKDAQFFHLSYQKDGQEQGGDYALNQPIRLGGMTLRILPEGKIDASVIERNYFFTINDEAAINAYLDRNLL
VEIVNPDANTIQISFQDFSPSKARAIVNKIDTVYLQEKIAQKQTATAQTLQFLDQQLTENRQSLAQAEENLQDFARQNKT
YDVRASIGEITARLEKQEEERLKLSEKIRLLNEVADLAERGTITSREDLTVEQSIPALATLENSQLSQQLGELNDLQWNL
RRLLRSYKETTEAVQQQREQLNFVKGNVRRTMRQNQELLRSQLAALDRQRNLFNSELQTLPQKATELARLNRPLELYEKS
YLMLMDKKVEFNIAKAGTTPDFQILSPASLPSAPISPVKLMVYAIGLASGIILGLALMAVRYLMHNTVTNVRELERATSS
SVLGVIPTYDKEKMSVSKLVVDKNPKSAISESIRSIRTNLDFISSAKKKRLISVTSTISGEGKTFVSVNLAGIIALSEQR
VVLLDLDMRKPKVNLAFGAENVKGISTILIDKHSIAECIQHTSIPTLDFISAGPTPPNPSELILSSRFDELLAELHKLYD
VILIDTPPVGLVTDGILIMRKADIPIYIVRANYSKKAFLKNINKLVRANNFTRLSVILNDATASGLYGYGYGYGYGYGYG
QGYYEETKPADGKLTRLRKRFS
>gnl|bykdb|A0A076IQN8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTDEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|A0A077ENE7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis NUHP1] (length=804 residues).
MNTINQKGYTIGDKKEHSINLLDILKYLLHHWKWFVLSILIFGGYYYYQYSKTPFVYNSSEIVMVKTPSNTPTTARITRS
FGANTISVKDEILQLKSKELMRLVVDKVHADKSYKVHKGLRDYELYKKSPVQVKVEGISSEGSYNFTVIPLDGNSVIIKN
WNPENKDKEIKIALNKLTSTPVGKILITPSKYYKKDYYGVEIQVAKSPREAVMSNFVGNLSIKQMEEEASLMQVTMTDDS
SERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVENLKIANQGIDVATAGSLYLNEKNQYKS
EGTKIETDIRLAEMMRSYLMNKGKQNNLIPNNTGLVDSGVEGQIAEYNKALLKRNRLAEGGNSSNPVVLDLDDALGAMRT
NISRAVDNALRGLNIKLNNTKQEESVAQGKMLQMPQKERTMVSVERQRRVKEDLYMFLLNKREENALNEAVTEANLRIVD
PPVATDSPIYPSRTKKVMTGVAIGAVLPAVVLLSMLMLNTGVRGRQDLENVLSVPFLGEIPLARNRRQGNSDVLVSQSGR
DPLTEAFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELIKELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGMKLNGYGYGYGGYGYGGYGYGSYGYGSYGYGYGEEKKKSVFDL
FKRS
>gnl|bykdb|A0A078RYI7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis str. 3978 T3 ii] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTDEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|A0A078RZN2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis str. 3978 T3 ii] (length=788 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A078S3Q8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis str. 3978 T3 ii] (length=806 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLVKEDSKGKSFSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGNLLDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKNGGG
>gnl|bykdb|A0A078T2W6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis str. 3999B ] (length=802 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLMVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLKIQPDGTL
YLSDFIRNGTDLDEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSEANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYCYGYRYGYGSGYHYGSDGKRG
WR
>gnl|bykdb|A0A078TAH2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis str. 3999B ] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A098LL25 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sporocytophaga myxococcoides] (length=814 residues).
MSLLEDEDKRSLNGSGQRVSFADDSEEEDDVFGDFDFAKLLVIANKSLVWVILLVVLSITGAFLYVRYTKPVYESSSILK
LDLKSEAGVLGLNKFNDENMPGNKLSTISGEIEFLKSRYLYEKIVDRMKMNVSYFAYGNILYEERYNNSPFKVIGEIKHP
DFLDFKFDITFLDKDKFLLSYKKNDEEIKSEHYFGEKISTDNYSFTLYPTTFWSTNETGAKYFFTMNSKEALVKNLMDNV
SVSILNLDANTILLSYKNHNYSKATDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKAEKDLETFVRNNR
TVDVKQDFGKSGIKIEELEKEKQVLKSRISMLGELKDLILGDQEVNSFIPALSQVENPQLSAAINSLNTLQEERNRLLNS
QRENTLVVKTKNKSIERIKENVLELIDINKRILHQQTAEINAKMVQLEQEVLSLPSKETEFTRLKRFYSIYEKFYLLLME
KEAEFGIAKAGTIPNFVILSPALNNPNPIYPKKIFIYISGLGIGIFLGISLIAIRYLLNDTISTQKELERSLHASMLGGI
PEYSKEKMEVSKLVVDKNPKSAISEALRSIRTNLEFICPNKKKKLIAVTSTVSGEGKTFVASNLSGVIALSNQKVILLDL
DMRKPKVHLAFEKENFKGMSTVLIGKHTLEECIQSTSISNLSFISAGPTPPNPSELILREEFDMLIKRLFEIYDVVVIDT
PPVGLVTDGILILRKADIPLYVVRTDYSKKSAKRNINKLVKTIPKLCVLMNALKAINTYGYGGYGYGYGYGYYEGETEKE
SIISKIKSLAGVKA
>gnl|bykdb|A0A0A2DUD9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. COT-239 OH1446] (length=808 residues).
MIQNTTTVVEKPAAEGQQENFFSLQDLWRLVCIRWYVIAISILLALGVAVLYILRTPPVYKRTASVMIKADDKGKSLSND
MSSAFSELGLFQSNTNVNNELLSMKSPMLMEEVVRRLELWTSYEAPGAFHDHLLYGTNLPLNLRFTDLSEQESAECILSQ
LPSGELQLHSFVLNGEKTEVQDPVTLVLGKATETPLGKVLVNKNQGDDLDLVNGLIIKRSSLYDAVENLGKNLTVNLADE
KSTILSLSLLDRSQERADAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEVDKNITKYKSQHLLPDVQTA
SNLFLNQAAQVDNQIVELRSREYMARQVRNLLKNLDKSRLLPVNSFVNNPSLEQQIGEFNDLLLKRNNLVKNSSESNPLV
VDLDANLNDLKSVIVASLDNQLLAIETQLMSLRSSERKNAGRIAASPEQANYLIAEGRQQTVKEALYLFLLQKREENQLS
LAFTANNTRLISAPTGSPQPAFPQKRNILLVALALGIIVPVAFLYLKETLDTSIRSRRDLDNMQIPFIGEIPSFVRVKRG
YRAQIKKLLGIGKPPKKEIRLVVEHNNRNVINEAFRLVRTNIEMMLGRKNEQGRVLSLTSINPNSGKTFVALNLAASLAA
NGRRVLLIDLDMRVATLSDFVGRAPWGVSSLLTEATDDYRELIISTQVAGLDALPVGIIPPNPTELLSQPKLGDLLVQFR
KEYDYIVIDCPPVDLVADAALINEHTDLTIFIARAGMLDKRVLPVIDSYYKERKLRNMVLLLNGTDLSASYGYGYGYGYG
YGYGYHRE
>gnl|bykdb|A0A0A2EVS5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas cangingivalis] (length=795 residues).
MDEKVTTYKRNVEEYFSLKEIFRLCLIRWKWILLSLLITVGAATAYLMITPVEYKRSASILIKESDKPGASLAQDIGGFA
DMGLFSKSTNVHNELVSLRSPATLLEVIKRLNLDIDYKVDGRFHRSTLYGSELPIVVSIDRFYGALEWSLSVTVRGDGMV
EVSDMILDGEPMGEGQIFLGELVDSIPTPMGIVRVGLNSAYSDEKSIQTPMTIHVSRSNLSTTMAECQKRLQVGLINDKT
SILELSYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFKSKNLIPDVRTASE
MYMTQAGEAGTQILALNNQLYMARYIRGHITGGQGRELLPVNSGINSPVIEREISEYNETLLQLNRLLSNSSEKNPLVID
MDRTLTAMRRSILLSIDNEINSLSNQIKTLRAQESKSTSRIASSPTQAQYLLSVERQQKIKEALYLFLLQKREENELSQA
FTAYNTRVITPPMGGLTPIFPRKRNILLGAFLLGLLVPIAFIYVGAVTDTKVRGRKDLEGMTTPFLGEIPQSGDSKGLRA
IKRRRKYERYEIVVQAQNRNAINEAFRVTRANLEFMLGVDGHQKVMMLTSLNGGSGKTFVTMNLAASFAINNKRVVVIDL
DMRRGMLSTYVDSPEVGLSALFSGQLEDWRSIIVPSDDLPDLHVLPVGKIPPNPTELLYSSRLSQLLEALRQEYDYIFID
CPPVEIVADAYIIEKLVDKVIFVIRAGLTDREMLSVVDAFYNNKKLNNMSLILNGTSSMHGNHGYGYDYKQYISD
>gnl|bykdb|A0A0A2F501 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas sp. COT-290 OH860] (length=809 residues).
MKQEENSRSAQGALAEQDSFLSLRDLWAMCWARKFWFVLSLGLFLGGAILYILITPPVYKRTATLLIKDDSKGKGLSLND
QFSFGDMGLLQSNTNVNNELISIQSPTLTLEVVRRLGLNVEYYADGRYYKEVLYGQELPYRVKFLGLKDTDNASLTLTIL
ANGQFAISNLMLNDNELQTQRITCSLGDTISAPIGKLVIVRSESYLADKSKTRPSQIYVSYQNLYNVQELYSSGLKASIN
NDKASIIDIAYQDRSIQRAEDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHVDKDISSFKSANLIPDLK
ETTRIYLDQTSEAEAQLLDLSNQLYMARYIRQHLGTDTNATQLIPAISGIGNKLIDQQIGEYNQKMLERNSLRANSSDEN
PIVQDLTTQIGAMRSIILSSLDNQILTLDNQARSLKTRSGQATARISANPTQAEYLISVERQQKIKEALYLFLLQKREEN
ELSQAFSAYNTRVITPPIGKMMPISPLRRNILLAALVLGLLLPVALIYLSESMNTALRSCRDLEGMTIPIAGELPALEPT
ISGLRGWLGRLFKKKKSMKKDIRFVVQENNRNMINEAFRLVRTNVEFMLTNKEGARVIATTSINIDSGKTFITLNLAASF
AAKGHRVLMIDADMRVASLSAFGPVEGDGLSALLAGRATNYHGLISSSLLDNLYILPVGTLPPNPTELLAGQNFAELLES
LRQEYDYIFIDCPPVAIVADATLISRHIDMTVFVARVGLLDKSSLPVLESYYRESRYPNMVLVVNGTELDNRYGYNRGYG
ASHGYYAKK
>gnl|bykdb|A0A0A2F954 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gulae] (length=822 residues).
MNLNEGSQNTFTRQGRSYISDTEDTAFFSLEEFFLGLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMTGNSEVENEILLLKSKRLTAVVVDKLDLDVSISKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IRINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLDTTLFFADSWKGEVLYVKKENTRKVAERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAISTASFIDERLAMIGGELGSVDTEIETFKKRNNITD
ISTDVGAYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYERLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNKEMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSLEPISPRKPIVFFAAFLLGLIFPAVYIYAKMQLNKGVRGRKDLEGLSIPFLGEIPAYL
GHRNEEDLDVVVSSGSRDSSSEAFRILRSNMEFMRVKSSKLKTVMFTSANPGSGKSFVTMNLAISLALTGKKVIVVDLDI
RKGSLSNRLTQNNTGVTDFLYNESVSIDRLITHSPHSENLDVILAGPVPPNPSELLLSDRLEYLIDELNRRYDYVFLDSV
PAMAVADAMITNRVADLTIYVIRQGLLDRRYLPEIERLYVENKFANLCLVLNGVTYSSSSDRYTYGYNYGYGYEAYDKQE
RKHHRHSASKRKMKFKSPMKKN
>gnl|bykdb|A0A0A2FW91 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gulae] (length=820 residues).
MNLNEGSQNTFTRQGRSYISDTEDTAFFSLEEFFLGLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMTGNSEVENEILLLKSKRLTAVVVDKLDLDVSISKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IRINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLDTTLFFADSWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFVNTLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGSVDTEIETFKKSNNITD
ISTDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSE
SNPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKIVDAADGPSVPIAPRKSLIFMAASLLGLVLPSTFIYAKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEDDLDVVVKPESRDSASEAFKILRSNMEFMRVKSQDLKAVMFTSANPRSGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLSVGNIGITDFLYNNSISVDSLITKFPQNENLDLILSGSIPPNPAELLLSDRLDYLIKELKTRYDYVFLDSV
PAMSVADAMITNRVADLTIYVIRQGVLDRRYLTEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYNTHDKQDRK
PRRRSLKKTKKFKMKPMEKS
>gnl|bykdb|A0A0A2G557 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivicanis] (length=828 residues).
MNNNLYTNPEEGFIENNLSEEQMISLSDIFYLLRQNWYYFIACLLIALICGYVYIKSTPNSYERTASVLVNTKSDISGPL
ADIMKISGTDIGGIKGNDKIENEIIIFRTERLLSRVIDELNLRVTYRKKEGLRSKKLYKETPIRLTLLNTSDTLSGSFSL
SFIEENKVSLSNFEGDFEQLSSAPKMIVSLGETIETPIGSFFLTSNTIATSKKEPIEIIVNSKEKTVADLSKKLTISQSG
KQSSVIDLRFKDENTDFAEDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDVDQEIERFKQNNQIANIAS
EAEVYIESSKEITKQTIEVNNALAVAGFIKEHLTNPSSANGLIPASSGLEDLASNSLIKEYNTLYLYREQLLSESGQTNP
LIETQQKQLESLRKAIIKSIDNYIKSLNIKLSSINKQSDKNEGKISSVPMQERIITSIYRNQKIKEELYLFLLNAREKNA
LSIEGAVSDVQLIQPAVGSSTPIAPKKALIMLAALVLGLLIPAAHLYIRFMMNNTVRGRKDLETYTQIPILGEVPHSTRL
EKKQNILFHKFLDLFRSPGKRHSNKRYQRRANMLLGSKIERDFVSESFSVLRSNMAFMLTGEECKIITLTSALPNSGKTF
VAANLAHSFRTLQKRVLLIDGDIRKGSLTAALRLNLSKQTEGLSAYLSNSSLSVEDVVVPHNDDVIFDFLPAGVFPPNPS
ELLLSPRFEELISILRTLYDYIIIDAVPFMNMADAQIIAKACDLTLMVVREGSTPRALLREINFIHKNKYFEKVALVLND
AGSSQHISGRGYGYQYYSSEYQSYFSQK
>gnl|bykdb|A0A0B0BTJ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes inops] (length=815 residues).
MTENNKDIIDGRKEEENKSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSDLTG
FMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSPLKLTADTIRYTFNIHIKSIEDAD
GSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFRLERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQK
FSNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKSDNSAVDIISE
TKLSLETSRQYEDDLLKTEIQLEMLSAIGDILNGKEEIGILPVNIGIENQALSNAINKYNELVLERMRLGTETSDDNPVI
REMNAQIISMQHSLKKSIENVANSLQIQNESLRQQLAQVSDKVSNIPYLERETVSIERNQEIKAALYTYLLNKREETALS
MVATTPVAQVIDKALVNPIHVAPHRSMIVLLFFAIGLILPAIVIYLIEQLRVKVGSVSEVEDNIHVPIIGAIPSKTAGMH
NDKIVSPNSRDVVTEAFRMVRTNLDFTMPQGGKVIMVTSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKI
SGRRQTKGLVNYLVKKEENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLVTDT
MLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETSTYGYGYGYGYGYGYGNEKKMTLK
TRFRLFWKNLKKRKE
>gnl|bykdb|A0A0D3L8Q3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flammeovirgaceae bacterium 311] (length=782 residues).
MTDQDNLLLEDSEQINFKEIILKYLRYWYLFLLGTIICFGLAYLYLRYTTPQYLITTSILIKSDQQSGGLTESAVFNDIP
GFKSHTNIDNEIRLLKSQSLMHRVFNELDLDVTYYGDGRIKDPELYGNKLPFRVVTNKLDSLAYGKVIKVHLKGNNSYDI
EYNEKISSHKFGQRVNVGFGEFTIVSDSRLIRNGMTVRVHFNNIQRLASNYSDRLVVEKDKLAWSSALILSLVDPVPEKG
KDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDVEKDVEEYKRERRLTNVGTEAQLYLQGRTGYDQQLSE
YELQLEILNSIEDYLRREGNEVGIVPSTLSITDHTLNRLIERYNELQLERQRLLLTNKPNNPLVMNLSEQLTDLRQNILE
NLSNIRQSMEITRNNLQSNYAQFESKIEQVPGMEREIQAISRQQGIKEGLYLYLLQKREESALSLAATVSNSRIIDPASA
GSVPVSPESTTFYLYALVFGIGMPFAFLFIRDMLNNKVQEQKDVERATSTPILGEIAHKRTGENLVVTHDSRSPVAELFR
LIRANLQFANAGRSNKVMLVTSSTSGEGKTFFSINLGASLALSGKRVVVIDFDLRKPSLLHNLGMTNDFGITNYLVTENT
PIKELIKPTKVSNNLYVVGAGPIPPNPAELMLLPKIGGLIDGLRQQFDYVIIDTSPVGQVADALSLAPYIDLSLYLVRYQ
FTEKEQVKIVNDIYRKKKLNHTMIVLNDARKGGGYGYGKGYGYGYGYGQEKRSWFSRFRKKA
>gnl|bykdb|A0A0D3LFR6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flammeovirgaceae bacterium 311] (length=786 residues).
MKEDTTYVEYTDAPDEQPEGGPLQSIDFDKLFSVLKKSLPIIVVIFLVCNMGAYLYIRYTKPLFQSNSELQLTENKPAAS
FGFVDSDKATMEGMSSEIELIKSKLFLNKVLSALDLDVSYFTQGKILDDEKYRSAPFKVDYLLKDERFFNQKIYVNIHDL
QEYTLSYFQGENEVSNRYRFGQAVETGSFNLTLTLLEGTTGDAINSNYYFIINSDQSLIDYLSTNLTVTILNPNAKTIKI
SLTDYNPYKARVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGYETYFEDFTISQRTTNLNKDISNTILL
LESVDSQRVATRRQLNNLTNLSSRIKSEDTYFAQSLVNRAGDDFPADIKTLLDQLNKLISEKEVLLEHYNENTQAAQMKI
KQVSMIKEDLLAALQLYESDLRKQVDDLQFRHRELLSSFVQLPSKGTEFSKSQRDYNQLLEVLLNLQSKKIEFEIANAGS
TTDYKILSSASMPGAPISPDKYLFHGIGLAAGLMLSLLFVGGRYMLDNKVNGVAEVERLANVPVLGAVPLTLSKLATARM
VITDNPKSAFSESMRAIRTNMEFLGARQNNRIISVTSTISGEGKTFIATNLAGIIALSKKRVIVLDLDMRKPKVHLAFEG
ENASAGLSTILIGRHSLEESIRKTSIPNLDYIPAGPTPPNPSELVMNGDFDALLLRLKDLYDVIVMDTPPVGLVTDGILI
MKKADLPLYVFKANYSRKLYFKTLNRLATVNQFNNLAVILNGVSRNKGYGYGYGYGYGDTGGYYEE
>gnl|bykdb|A0A0E2M2Y7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis F0570] (length=821 residues).
MNLIEDSKNTLAESRSRIYTKEETSFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL
ADKNATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKSNNITDI
STDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSES
NPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKREE
NALRLAITESNAKIVDAADGPSAPIAPRKPLIFMAASLLGLVIPSSFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYSG
ERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAITIALTGKKVIVVDLDIR
KGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKNRYDYVFLDSVP
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQGK
KLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|A0A0E3V905 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Spirosoma radiotolerans] (length=774 residues).
MSANTYTYTQHQLVESDGLNIRALLSKYSKLWPWFILSTVLMLAIGHIYISNKQPIYKIQASLLVQDQQKGSEQSSSLKE
LGVFAHKQVVENEIEILRSFTLMNRVADKLHLDVRYFQNTTFGKREIYTDSPIELIVESGKPELYKKPLEVSMLSNKAVK
INEQVYPVNHAIETPYGRLKIVTKKQTFDSENPYSIQVTKRATSVKNYLTNLHAIPTGKGSTVILLSLEDAVPAKGEAIL
NQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASAERNVEQYKSHQGITDLSVQAQTFLQTVQQNDALMNQVQIQ
LATLNDLQKYIEGKGDTRGNTPAVVGLSDPVLLSLINNLTQLEQQRDHLLHTTSELNPLLETVDSQIKITKNNMASTILT
MKNMLLSTQRQYVEKNGSVEGAIRTIPQKERVLMDITRQQAIKNSLYTYLLQKREETAVAFASTMADTRTIDTALSEDEP
VRPNKSIIYALFSLLGLVIPIAVVASNDALNNRVTRRIDVEEVTQVPILGELVKKRQKGSLVITPKGQSVIAEQIRTLRA
CLPSLRNEATESQALLFTSSISGEGKSFVSINLGMSLAYVNKPTVILDMDLRAPKLHKVFCLNNSIGISDYLQGEATLDD
VLTPVPGSTNYYVITSGNIPINPSELLSSPRLTQLITELRDRFDYIIIDTPPVGLVSDARIIAPLVDTTFFMVRHNVTPK
NHLRMIDKLHMDNRFPRLNIILNAVDGSDAYQYSNTQNEDYVYGKPGRKKWILS
>gnl|bykdb|A0A0E3ZG78 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter korlensis] (length=783 residues).
MMDKELFPLSSERAGEKDIRRILLNYLRYWYLFLIGAALGLCGAFLYLRYYTIPKYSVYSTVLIKDDKSDSHLSNESAFS
DLEIFQATKNINNEIEVLQSESLMKRVASELSLFIGYYIEGRVNDIEIYGSEVPIKVLVNDLAPPAYRKSFVIHIKSDST
YNLDDNEGKMYTYKFGQQIQKPYGVFTVVPDSGLTASSKSIGSKLTVKFKNVQQLAEHYSQAIQIGPVNKSASVLWVGLT
DPIPEKAKDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGVEKDVEQYKRQHELTDVNIQASNYLNIASG
YNKQLSDWAIQIEILESIESYLNKDENQYKMVPSTLSIQDVTLMGLIARFNELQLDRERMLRTAQPKSPIIKNLNEQLAN
IRSSILENLRNIKKGLLITSNNLRANSDEFESKIKKVPSMERELLEISRQQAIKQNLYLYLLQKREETALSLAATVSSLR
VIDPAKGGNVPVSPNKSTIYLMSLLLGICLPFAGIFIKDLLDDKVQTQQDVQHLTIAPVLGELPHNNYDTVVVTKGNRTP
IVEMFRHIRAKLHFAAVDKENKVILITSSMSGEGKTFFAINLAASLVLTGKKVLLIDLDLRKSTLSDELGLSEEGIGVSD
YLVSNNVPIHEIIRSSAKVTDLFVISSGPTPPDPTELMMSTKLADLILELKSSFDFIIIDTAPVGQVADALSISSVIDST
IYIVRYNYTKKRQIEIVDEIYRNKTLCHPMIVLNDSKHVSSYGYGYGYCYSKEEKKDLSKKLI
>gnl|bykdb|A0A0E3ZGV6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter korlensis] (length=774 residues).
MDKNKVNAEDNLVASLVYKFLPFWPLFVVLFILSVAGAWAYLKFYATPTYAITASLIIRDEEKGVNASKITESIDAFSSN
KIVENELNVLRSNALMNQVVNELKLYAPVYEETKLRSVPAYTSSPITITLKDPEKATENPMIFFTYDESSKEVIIDSKKY
SIGTWEKTPYGVMLFSENEKQTSTTTNPLYFSIISPTRAANQLSGSIFIESAGKLSSVVNLYLEDKVPERGEDILNALIH
AYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNLEDKIVKYKSTQGAVNLNEQGKLFLQSVDNNDRRLNEINLQLAVLD
NVERYVVRKNKDLGIVPSTLGVSDPVLSQLLQKLYNSEIQYQQLSKTTAENNPLLVSLREEIESIRPGILENIRNQRDNL
VSSRSKLSSTNSSYSSVLQSIPRKERELLEISRQQAIKNNAYSFLLQKREETMLSYAPTAEDIRVVDMAESSKTPVSPNA
LYVYLSAVVLALAGGVALVTGKEMLHSKVLFRSEIEAYLNAPIVAELSTVKNHDKNLPLQPAEVAQVEQFRQLRVTMGLY
GRTFTRRKIMVTSSIPGEGKSFVSTNLAISLSSSGKKVVILDFDLRNPNTSVLFENANQTGIIEYLKDNLDPRDIIRSTS
FDNLSMIPAGIDIGDHTELLLNSKMEELFSYLEESYDYVIIDTPPVDLVSDAYLLSEYCDISLLVIRHAYTPKSFIQRLS
QNNKLRSMGNVAIVFNGVKPRGFVKGQYGYGYGYGYENKYGDKTYRARKLATKS
>gnl|bykdb|A0A0F2NS19 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium BRH_c54] (length=805 residues).
MQEDQFAHKKEVVSNFNTELDIILLLKVFKKTFIYFVGIIAICVTLSLIYLRYTVPIYQSKLVLQVGSENTANKVLQVDN
FSKTEDVAKDVELLRSKLLLKRALSKLPLEVSYFNQGKILEYELYKNSPFKVFFEVKDSSVLGKKFYLEKTNNEKFNLFQ
SEKLIGEFSSNVPIELKEVTLRIVFDNYNEFGADKNNSMFFAINDLEALTNKYIQQLGVFPLNPSAKTISISFNDNNALK
TSDVITSLANEYILYDIEERSKSSKKIIQFLDDQLDKYYNKVKLSENRIQDFQTSKKIGNPNEVSSIYLDKINRFENQLI
DIDFQTSVLKEISKSVTGKINTIDIYNLLPTLTGTEYEASITALITNLQNLMVQKQNLLSEVTVNSGSVKSLENQIDVQK
QILFTTINSLISKLELRRKEVVKKVNEIQAKYLTVPANELEYARLQRVLSIDEKFFTLLMEKRTEYSISEAGFVPQHTIL
DKANVPSAPMSPNRNMILITGVLLGVVISLIVLIIRYVFKNTISTIDEINRYVRSSVGFLGNIPLYQNKIPVSQLVINRE
PKSVISESFRSVRSNLQFISTKNEKKTIAVTSTISGEGKTFCAINLAGIVAMSGKKVVIIDLDMRRPKIHMGFGVKNTCG
MSTILINKSTIEECIYHSELENLDFITSGPIPPNPSELIIGGGIEKIINQLKNDLGYDYVVVDNPPIGLVSDAMETLKFA
DYPIYVFKSEYSRKNFINNIDKLVIENEISKLSIILNGVDFRDKFYSYGYNYSYSYGSKNSYYYDGSEESASFFNKLLKK
VGLKK
>gnl|bykdb|A0A0F5IQM7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii DSM 19448 = WAL 12034] (length=797 residues).
MNPEQETNMLREEENELNLIDMYRVVRANWYWFLLSVAVCCAVAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEANESLEFGLTVVPVSDKEVS
LSGFFSEELEEEGQVLEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTA
TILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKRENQLTDIHSEAG
MYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDVSLESQISEYNTLLLKRDKLIGNSSNRNPVVM
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREVQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMVVPSGILWVQLTMNTTVRSRKDIEDNLSVPFLGEIPSRNRKDKS
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSAR
ISHAGAGLTHYLSGRVDDVDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVADA
TIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKQEKFRNMAVILNGINMKRAGYGYGYGYGYGYGYGYGNEKSQKHKK
>gnl|bykdb|A0A0F5IT40 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii DSM 19448 = WAL 12034] (length=786 residues).
MNSEQETINLRREENELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILL
SGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDV
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
KEGLGLENQVTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLIGNSSNKNPVVMDLNNSLSAMK
QTIIRAIDNLIVGLNIKIKNIREREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRSPVAPKSMMILLAAVVLGLAIPAGIIWLQMVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGSTNMGIT
NYLSGKVDDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLEALIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
TIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGYGNEKKK
>gnl|bykdb|A0A0F5IWP9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides gordonii MS-1] (length=788 residues).
MNSEQETTYLRGEENELNLKDLFHIVLANWYWFLLSVLICCGAAFLYLKWAPKVYTRTASVLIKDNTKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMSIVAERLNLDIGYTVKEGLRTVELYTQSPIAVQFPEAEATQAFSLNVTPLTETEVML
SDFSTDETKMLKVVLNDTVITSIGKLVVTPTLYYSDKYFGKPVAVVKKNRVDVALGYSNTLQVALASKTATIINLTLQDV
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
QEGLGLENQLTLAKYIRDYLIDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLISNSSNKNPVVMDLNNSLGAMK
QTIIRAIDNLIVGLNIKIKNIKEREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRNPIAPKSMMILLAAVVLGLAIPSGIIWLLVVMNTTVRTRKDIEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTSKKVMLVDLDIRKGTLSSHVSGATNMGIT
NYLSGKVDNIDSIIGKEELAENLDIIHTGPVPPNPSELLLSTRLETLIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
TIYILRAGLMDRRQLPELEKLYKQDKFKNMSLILNGVRYNHSSYGYGYGYGYGYGYGYGYGYGDEKKK
>gnl|bykdb|A0A0F5IZT8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. HGS0025] (length=784 residues).
MNSEQETTYLRGEENELNLKDLFHIVLANWYWFLLSVLICCGAAFLYLKWAPKVYTRTASVLIKDNTKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMSIVAERLNLDIGYTVKEGLRTVELYTQSPIAVQFPEAEATQAFSLNVTPLTETEVML
SDFSTDETKMLKVVLNDTVITSIGKLVVTPTLYYSDKYFGKPVAVVKKNRVDVALGYSNTLQVALASKTAAIINLTLQDV
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
QEGLGLENQLTLAKYIRDYLIDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLISNSSNKNPVVMDLNNSLGAMK
QTIIRAIDNLIVGLNIKIKNIKEREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRNPIAPKSMMILLAAVVLGLSIPSGIIWLQVVMNTTVRTRKDVEDAVSIPFLGEIPLRDRKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTSKKVILVDLDIRKGTLSSHVSSATNMGIT
NYLSGKVDNIDSIIGKGELAENLDIIHTGPVPPNPSELLLSTRLDTLIEELKKRYDYIILDNVPAGLVADAAIINRVADL
TIYILRAGLMDRRQLPELEKLYKQDKFKNMSLILNGVRYNHSSYGYGYGYGYGYGYGYGNEKKK
>gnl|bykdb|A0A0J6CIR2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii] (length=779 residues).
MNLRREENELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEELNMFNVK
SNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILLSGFSTNE
AKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDVSIPRAED
VLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKRENQLTDISSETGMYLQESSQYSKEGLGLE
NQVTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLIGNSSNKNPVVMDLNNSLSAMKQTIIRAI
DNLIVGLNIKIKNIREREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVIDAAQGSR
SPVAPKSMMILLAAVVLGLAIPAGIIWLQMVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRDSISEAFR
IVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGTTNMGITNYLSGKV
DDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLDALIEELKKRYDYIILDNVPAGLVADAAIVNRVADLTIYILRA
GLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGYGNEKKK
>gnl|bykdb|A0A0J6CKW3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii] (length=797 residues).
MNPEQETNMLREEENELNLIDMYRVVRANWYWFLLSVAVCCAVAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEANENLEFGLTVVPVSDKEVS
LSGFFSEELEEEGQVQEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTA
TILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKRENQLTDIHSEAG
MYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDVSLESQISEYNTLLLKRDKLIGNSSNRNPVVM
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREVQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMVVPSGILWVQLTMNTTVRSRKDIEDNLSVPFLGEIPSRNRKDKS
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSAR
ISHAGAGLTHYLSGRVDDVDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVADA
TIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKLEKFRNMAVILNGINMKRAGYGYGYGYGYGYGYGYGNEKSQKHKK
>gnl|bykdb|A0A0K2J6Z0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis AJW4] (length=821 residues).
MNLIEDSKNTLAESRSRIYTKEETSFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL
ADKNATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKSNNITDI
STDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSES
NPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKREE
NALRLAITESNAKIVDAADGPSAPIAPRKPLIFMAASLLGLVIPSSFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYSG
ERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAITIALTGKKVIVVDLDIR
KGSLSKRLGSGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSVP
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQGK
KLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|A0A0K8QSK7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium 6E] (length=825 residues).
MEDPRLEIPGLPFFPEFEQSESMIKPFLLKLLGKWYWFVLSVVLFLAAAWLLTRYSMPVYQSSSSLLILERSGGSPFSQT
ESAISSQAFEGFGIMGQNNNIYNQIEVLKSWPIIEEAVQELGFEVSVYSVGQILDPEVYTAAPFVVEWDRSHPQMIGTRI
RLTFAGDGKIRYQAEGENVRVHDFVTGENIRTIPNVNIDETRLLGERFSGNDYSFAIRVKENAPSGLSGTYAIEFNTVQQ
TGKLYASRLTVAQSNRQTSILTLTVQDHNSAKGNDFLNKLVEVYQRDNLNQKNEVANRTINFIHSQLGEISDSLSISETE
MLQFQSDNRVIDLSAQSQQLLQQMSELDNQRVVLESQLKYYRYLRNYIIQNQELESIMAPSAMGVEDPMMTSLTQELNTL
TLEKSRLGNVRVSPRLNQINAQIEKLKEALMANINSSISQAEVRLDDLNRRIRARESQVRQLPTTERNLVNIERKYKLNN
ETYTFMLEKLSTAQIAKASNMPDSKVVSEAIFMSQVAPTPQKNYAIALMLALIIPALWIFLVDFFTTKVKTQRDVEKLSK
LPILASVFFNESKESHNTPVLDLPNSPASEPYRGLRNKLNLMTKGKEKPVVAVTSTGPNEGKSYTAINLASSFALNRKKA
VLLDLDLRNSHLSEMLGIEANKGVVNYIMGEAKLADIAFQVKHPNFHVIPAGSIPPNPGEMLTDEKVVRLMEELKQIYDV
IIIDFAPIGFVTDLFQISDMLDSVLFVVRDRFTNKNWLKSALEEVKAHELKGVGLVINGIKLKKGSYLSSGYGYGYGYGY
SYGYGYGYGHKKKNTSGRKAVKQSA
>gnl|bykdb|A0A0M1W0V2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 9_1_42FAA] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A0M1W8D8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 9_1_42FAA] (length=800 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLTDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPTELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A0M3RW20 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. DG25A] (length=805 residues).
MNTPEPESETEGSGLDLSTLVMVVRKSLPWMLLFILLGLLTSWTYLRYTKPVYKSSSILKIDEKQEAGTLGLGGGLAGPE
GPLSMNNLSGEVELIKSNLIYRQLRDSLELDVNYYAQGTVLESELYKASPFHIEYAIKDPGYYGIQFNIQFLNKDKFILS
YALRGNEIKEEKVVGSAIIQPGINLQLNLTPQFSSDVIGKDYHFVVKDNGAINQYIDQNLTVEIINPEANTIGISFADHN
PLKAKDIVNRIDTVYLVEKLAKNSQGQQQTLQYLDEQLDITRDSLQRAELALQRFVKANKTYDVKADVGTLTEKLAEQEK
ERIELQKRLDLLNGVARLIQRERITRDENVSVEQSVPGLVTLEDPILTQQITELNLAQQDLRRVLRSSTEATEAVQQRKA
AVEYAKRNVQDALQQSMQVVREQLATLNQQRGQYSAQLQVLPQRETELARLRRPFELFEKSYLMLMDKKVEFSIAKAGTT
PDFQILSPASAPVEPISPVRMIVYAIGLAGGIILGLSLVAVRYFMHNTVTSSRELENNCIAPVLGIIPTYDKEKLAVSKL
IVDKNPKSAISESIRSIRTNLEFMASSKKKRLISITSTVSGEGKTFVAVNLGGIIALSEQRVVILDLDMRKPKVNLAFGA
ENIKGISTILIERHSWEECIQHTSIPTLDFISAGPTPPNPSELILSPKFDELLANLHQQYDVIMIDTPPVGLVTDGILIM
RKADLPIYIVRADYSKKVFLKNINKLIRTNGFTRMATILNDARASGMYGYGYGYGYGYGQGYGQGYYEEVQPKLSLWRRL
RQRFA
>gnl|bykdb|A0A0P0CSF9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rufibacter tibetensis] (length=812 residues).
MSVKTVNDLDELDHRLGSGEDEDDDGGTSIDFVTLLHVAKRSIPWIILLVLLGIGGSYLYLRYTKKVYESSSTIKLDEQS
QAGVLGLQNSGLKVESGIGQLQGEVDLIKSNIVFERLKKTMPLQVSYFVEARVLDAELYKDSPFQVSYDNESFNLYDQKI
YVKFTSPSRFDLYVGENGNQSSYTVGNPITVSGSTFSINPVNNFSSSNVGIVYYFIVNSDQRLKGYIDTNLTTAILNPES
KTIQIAFKDFNRFKARDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKAENDIERFVRQNMSYDLKANFQ
EALAQVQELEKEKLELRFQLSLLNTIQTKVQRNEDLGMIASSIQGQENQDPQLAEQLTELSDLQAQQRTRRLTSRGNTLA
DNSLEERLEIAQNRLRDVINGSKGLVQTKINNIDRNQSELTGKILQAPSKETERARLERIFGLYESFFTQILNRRVEYGI
AMAGTTADFQILSPASLPSESAPISPNPFIIYAIGIAGGLFLGVGLIATRYLMHDTVANVRELERNTSVPVLGVVPSYDK
QKMPFSKLVVNQNPKSALSESIRSIRTNLEFMSASKKKRIISVTSTISGEGKTFVAVNLGGIIAMSGLKVVILDLDMRKP
KVHIALDGDNSKGMSTVLIDKHSLAECLQQTSVPDLDFISAGPTPPNPSELIMGSRFDNVLEELHQMYDVVLIDSPPVGL
VTDGVLIMRKADVPLYIVRAGYSKKAFLKGIDKLVRTNHLSNMATILNDVSSMNMYGYGYGYGYGYGYGYGQGYYDEEVK
PTVGSKLKSIFK
>gnl|bykdb|A0A0P0FM97 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKTEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDAFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKIIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTIPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|A0A0P0FQW1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus] (length=805 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWQWFVLSLAVTIGAATAYLLRTPTIYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTISDLPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGNLLDSITTPLGKIIIHITPNYVKGEAYTLYIGKSSLYNAVNSYSSNLSVSLNNEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESVNIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQMVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLENVTVPFIGEIPLFTRKKKGIFGKKP
QEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAMSFAIKGKKVLVIDGDLRHGS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQAIDAVRERYDYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLERSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYSSD
EKRGG
>gnl|bykdb|A0A0P7X1V8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium HLUCCA01] (length=794 residues).
MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQREDNDDEIDLLQIFGLLWHNKWIIITLTLLGGVSAYIYAQSQIPIFES
NGSLQITEAGNRYSMAGSDLSNLMVSNFGIGMGSSIENEIHVLQSRTFTGELAQRIYDERYQPDGRLYPVIWRAFPEDSS
IVTADTVFARLYGNLTFTRADRNSNLLRVSYRSPSPYEASRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQL
NYSEEQLRDFMNQNQLVQLDAQAQQLIETLSTLEAESQGIQVKLVAANSALEAYQQELDRLTPGLSEQLTASIAPRINQL
QVFLADRETQRTLLLSRNPQLRNTPDDPSLIEINQQIEGLREEIARLTNDLIQSDAGLSFFGSSDGNVSNRFMTLRNEVL
LLEVERQQLEAQRNLLEERAAEYRAFFEDLPDNMIEMARYQRNMQINEQLFLLISQQAAETALWEQTQSGLARVVDMSFI
PRSPVAPRKMIILLVGLMLGGVIAVGFVSIREFFKVEISSIDKLMKKGYPLLTIIPDMNRHIKENFDGAEYVTIRGNTLS
TGLVMVLDSISPLAESFRRLQSNVSYSQPDNPLKTIIVTSANKSEGKSTVSTNLCVALAEAGKRVLLVDCDFRRPRVHSY
FGREQEPGSMDILFGGQEPTDVIQKTLVPGVEILTSGKRPPNPAEITRSAKLRELIRSVKNDYDHIIIDSPPFGIISDAA
PLIGEADGVILVARFNQTKSPELDLTIDNLKKVKANVIGTVMTAFDPKKSTGYYYSSYYYKYAYESYDKYHEEA
>gnl|bykdb|A0A0Q9Z8F1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salegentibacter mishustinae] (length=770 residues).
MKYNSKTGKEDNLFRYIIKTFFPFWPLFLVLVVVCILAAWGYLKYATPIYEASASIMIKDEEKGVDDSKIMESINPFDSK
KIVENEIEVLKSRDLMKAVVRDLNLYAPIYEDAGIKTISAYTSSPIKVIVEDPNKISLSEDEPEKHFFKYNANDEKVIFS
GKEYSLNEWFEFSAGQTIMFVKNDHVNKKASNPLFFYLLNPKMISSELIDELDISTSNKLSSVVNLTIRDAVPERAENIL
NRLILEYNRKIIKDQNELAASTMTFIDERIENVEAELDELEYNIQEYKSNQGVVDLSEQGRLYLQDVGENDKQISELELQ
LAVLNNVENYVISKGSAGGMVPSTLGISDPILSQLIEKLYNLEVEYERLKRTTAENNPVLTSISNQISKIRPSILENVKS
QKQNLQSRLANLNSNNRRFNSTLRNIPGKERTLLEINRRKTIKNNLFSYLLQKREEAALANVPTNENSAMIDKAEASIDP
VSPKPLFTYLIAILLAVGVGTGYVKGKEILSGKVLYRSDIEEYTSIPVIAEVFHSKNSKNRRFTKPQDFVLIEQFRQLGA
RLGLYRRDIENKRILVTSGISGEGKSFVSSNLAFSLAQTGKKVVLVDMDFRKHKTSDLFNLSGSNGIIGLLKGEVTYDEI
IHPSGVNSNLFVIATGAKGDDYTEILLNGKLEFLMDSLSDDFEYVVIDAAPVNILAEVNLIAEFSEKTLLIIRHGHTSKE
SLKRLDESAGLQSLKNVSIVFNGLKNRGMIKTDYGYGYDLKHRMASYAKQ
>gnl|bykdb|A0A0S2HYK8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salinivirga cyanobacteriivorans] (length=802 residues).
MQNRKIPIINDTFDIITFKRILYRSVWIGLFIILLALGAGFLKIRYTAPLYEAKSVIQIQEDKKTSQVFQLDDLYEDNKK
LNKTIALIRSKEFLKRTFAKLPLDIRYFVEGAFLSDEIYQSSPFEIQYKIKDSKAFGIPVFISFKDKKNVVFEYEYNGET
YSYPGEAGKWTDLGILSCKAEILRYNVIKSMYESAKQNSYYFVIYNDEQIFTEHSKKLNIKLLSSSSNSIEISYQSHNSQ
QAADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTTESKLQEFKKENNIPSEALERTPFPIFTAKIEEFE
EQITTLDFELITLKNVKTQLETNQQLNTYEMIATLAGTNSEKVLVSILTNLQNLINEKNQLLNDVTENNMRIKIIDKQIA
NQKKLIIDFVKNNINRLEEKRAEYQSKIEEYEEKLFADESFDKLEYARLQRLHSINEGFYNQLIQKKAEYMISQAGYVTQ
NVILERANANLKSIAPKKEQILIASFILGLILFFTFIFIRYLMFNEITSINMIKNYSSAPVIGVVPAYKKAVPVSQLLVN
KKPNSMFTEAFRNIRSNLQFLSPGAGSNVITVTSTISGEGKTFVAMNLAGIQAISGKRAIILDMDMRKPRLHLGFNVDND
KGMSTILIGKHTYKDCIFMSEQKNLDFITAGPVPPNPAELVFSPKMDELIEQLEELYDVIIIDTPPIGIVTDALANLQRA
NYPVYVLKSNLSKRNFLENINSLIKDKRLDNLSVVFNSVDMAKRRYGYGYGYGYGYGYGYGYYSDEEKPSKKNFLKSIFK
TN
>gnl|bykdb|A0A0U3JVM7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sedentarius] (length=835 residues).
MAINENTELEELIRNATGGTASPPEAPSASGGDADDDAPGLDIATLVLVARRSLLWMLLLVGLGVTASWLYLRYTKPVYK
SASLLKIDERNEGSALGLAGQAAAPAVMDKGRTKLAGEVELIKSNIIYRRLKDSLALDINYYVQGTVLESELYGIAPFRV
KYHITDPSLYNHKFDLKFVGPQRFALEFTGQGRPLGGEYSLGQEIKLPGITLAVLGTNELTNAAQDASYHFTILDDRTVN
EYLDKNLTVEIVNPEASTIQISFNDFNPSKAQDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERAEDRLQ
NFVQQTGTYDSKGEFSAITEKLEKLEADRLKLTDKINMLGEIAQMASQGSLTRDETQTVEQSIPALAGIEDPQLAQQLNE
LNDLQWQLRRASRSYTDKTEAIQSKQANIEYTRASIKRLLQQNQKLLRNELSRLDQQRSKLTGALQSLPAKSTQLERLKR
PLDLYVTSYLQLMDRKVQFNIEKAGATADFQILSPASPPAAPISPNRLIVYAIGLAGGLFMGLGLIAVRYFMHNTVSNVR
ELERNTKASVLGIIPTYDKEKMEVSRLVVDKNPKSAISESIRSIRTNLDFISSAKKKRLISVTSTISGEGKTFVTVNLGG
IIALSGQRVIILDLDMRKPKVNLAFGAENVKGVSTILIERHSIQECIQPTSIESMQFISAGPTPPNPSELILSDKFDQMI
QELFQSYDVILIDTPPVGLVTDGILIMRKADIPLYIVRADYSRKAFIKNMNRLMRSNNFTRMCTILNDANSRGSGYGYGY
GYGYGYGYGAYGQGYYEEPETKALTFGEKIKKFFN
>gnl|bykdb|A0A0W8EDI5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Solirubrum puertoriconensis] (length=814 residues).
MAVNKEAELEELIRASGEETDDVAESSFDVATLLMVTRRSLPWMVLLIALGLTAAWLYLRYTQPVYQSASTLKIDQKTQS
AVLGLGGVGGSAEAQQNAKNLAGEVELIKSNLIYRKLQDSLNLNVSYFVEGTVLASELYNATPFRIDYDPADQILYNRKF
DIVFSDAKRFSLVSKAESGDVRVDGVFNQPLKIGNSFIVLKPTEQAIQPNIPYYFIIHDNSSVWSYIDQGLTVEIINPEA
NTIAISFKDHNPKKARDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGAEEALQEFVKRNKTYDVKSDLA
TITEKMEALEEEKEQLLRKAGAIGEIAQLVEQNQVMVQEGDDIEQSIPALAILEDAQLTQQIGVLNDQQADMNRLLESYK
PTTTAVQIRREQLDFTRRSIRRLLQQASQLVRSEVSKLNQQQRELEGRLQLLPEKETELVRLRRPFDLYEKTYLMLMDKK
VEFSIQKAGTTPDFQILSPATLPTAPIFPVRTMVYAIGLAAGVALGLGLVAVRFFLHNTITTVRELESNTVAPVLGVVPS
YDKEKLTVSKLIVDKNPKSAISEAIRSIRTNLEFLAPSKHKRLISITSTISGEGKTFVAVNLGGIIALSDQRVIIIDLDM
RKPKVNLAFEAENTKGVSTILIERHTVQECIQRTSIPTLDFISAGPTPPNPSELILHPQFDQMLEELKQQYDVVIIDTPP
VGLVTDGVLIMRKVDIPIYIVRAGYSKKTFLKNINKLVRGSGFNKLTTILNDAQAGGAYGYGYGYGYGYGSGYGYYEDEP
APKGLFGQLRRRFS
>gnl|bykdb|A0A108TCU0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDNRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKAQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A108TH71 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDVFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKTIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTVPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|A0A126PDF2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. PAMC 26628] (length=831 residues).
MAVNENAELEALIRNAIDGGTEPPTAATVGAAADDEADGGLDLSTLALVARRSLLWLLLLLALGGSAAWLYLRYTKPVYK
STSLLKIDQRSEAGVVGLGGQLAAADPRASSKLAGEVQLIKSEIIYKELRDSLDLYVNYYVQGTVLESELYGISPFQIAY
TIKDKDLYNQKISLAFTSPTRYSISYSGPGTALDGEYDLEKQVSLPGLDLKVTPTQYFGPASLIAKYHFTIQDQGTVNAY
LEKNLAVDISSADANTIQISFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGF
VEKTKTYDVKSEVAALASRGEDLEEQRLKLNQNLVLLSEISRMVQQTHITRNEDETIEQSIPGLGDINDPILSQLLSQLN
GMQWEQERIRRSYTGATEAVQQKNAQMDYTLSSILRQITQARKALLNKIALLDRQQNKLDAKQQGLPSRATEQARLQRPL
ALAEGTYTMLMGKKVDYNIQKAGTTADFQILFPASEPRVPISPVRLMVYAIGLAGGLFLGLGLIAVRYLLHNTITNTREL
EHSTQAAVLGVIPTYDKEKMEVSRLVVNDNPKSAISEAIRSIRTNLDFISSAKKQRLISVTSTISGEGKTFVTVNLAGII
AMSGQRVIVLDLDMRKPKVNLAFGAENLKGVSTILIDRHSVAECIQRTSIDALQFISAGPTPPNPSELILSPRFDQMLKE
LYESYDVVMIDTPPVGLVTDGILIMRRADIPIYIVRADYSRKAFIKNMNRLMRTNNLTRMCTILNDAQSKGAYGYGYGYG
YGYGSGTYGQGYYEDPTAPPTLAQKLGRLFK
>gnl|bykdb|A0A126PFG0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. PAMC 26628] (length=771 residues).
MEPFNGQVSTFYTAATASQPLNLRAVLARYRYHWSLFVAGVALALLGAYLYTQLVQPAYEVRASLLVEGEKKTPAEKSAL
QELDLVTTPKVVESEMEILKSRKLMLSVVRDLQLSTLYQQRDHLGARDLYGRSPVQFTLVPTHSVPRQHVLDIVLKDQTS
FYMAATNGNLTAHPFGRPVSDSIGTWQLTPVPAFALPAGSRLRIVARDPDLVVTAYQKALEVDLINKISPAISLQIKDEV
PQRGMDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQAEADEAGYRSQQGLTDIASQSKVYLENAQANDS
RLNEAQVQLAVVSTIERTLRDPRPTATVPTALGITDATLSSLVEKLTELHAQRERLLTTTPENNPLFNPLNSEILATQLA
IRSSVKNIKASLLATVRELESFNSRFESSIKRVPGQERQLVGKKRQLTIKENLYTYLLQKREEASLSYAATLDDARIIDS
AYVLPSKWPNRWLLYAVAAAVGLVVPAALLQVKDALSNKITTRAEIERATRAPVLAELAFEKEPGPGPMVGPLPATSVLA
EQVRGLRTRLPALLPDQPAGRVVLVTSSVSGEGKSFVSAHLAISLAGTGQRTVLVDLDLRRPGMAKLFGLANDHAGVSDF
LTERAAWPAIVQPTTVSPNLNLIASGTFPVADLLEGPRLGELLTGLRGAFHHVVLDSPPLHLVADALLLAQASDLTLYVV
RQGVTDQDELAFIEELNRQGSLPKLHLIFNGIDSRRYGYGYAYERRYLKSA
>gnl|bykdb|A0A127B287 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rufibacter sp. DG15C] (length=809 residues).
MSVKTGNNLDELDYHTSNADIEEEDSGSSIDLVTLWHVVRRSIPWVILLVLLGLTGSYLFLRYTKKVYESSSVIKLEEQT
EAKVLELPGAGMESDLGKLQGEVDLIKSDLVYDRLKKSMPLQVSYHVEARILEVELYKDSPFKVAFDSSRFDLYDQKIYV
TFDSRTRYTVQIGEDGKKSDVHTVGSPISLSGNNINVLTNPSFSANHIGESFYFIVHSSGALKRYLNDNLSVAVLNPEAK
TISISFKEFNREKARDVVNKIDTVYLQQKLARSNQASQQTIDFLSNQLQETQDNLQKAEIDMEYFVKQNKSYDVKAGLEG
AMTQIQELEKEKYDLRFRNSLLSDIQQRIRKGDDLSLVISSLQLQEQQDPQLAQLLTELNDLQAQRRKVLTTTRGNTLSV
ELLDQQIKFAQDKVSSLLKEGRGYIQDQISSIDRNQSLLTGQIMQMPSKETERARLIRILGIYEKFYLLLMEKRVEFGIS
MAGTIPDFQILSPASLPSESSPIYPNRMIIYAIGIAGGLFFGIALIGARYLMHNTVTSVRELERNTSAPVLGVIPSYSKE
KMPVSKLVVNQNPKSALSESIRSIRTNLDFLSSAKKKRLISVTSTISGEGKTFVATNLGGIIAMSGQRVILLDLDMRKPK
VHIALDGENIKGMSTILIEKHSIAESTQRTSIENLDFISAGPTPPNPSELIMGQKFDEILQELHQEYDVILIDSPPVGLV
TDGILIMRKADIPLFIVRANYSKKAFLKGVDRVMKTNHLTNMATILNDAPSTNMYGYSYGYGYGYGYGYGYYEEEEKPTL
SSRVKSMFK
>gnl|bykdb|A0A139KA16 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A139LU87 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides intestinalis] (length=795 residues).
MVEKKTPVGNPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDAFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKTIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTIPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|A0A150ADJ9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flammeovirga sp. SJP92] (length=822 residues).
MTDFDKEFDDFDREDGNIADSIDFDKLEYVVKKNIVWVLLLISLTTICAYLYIRWSPRIYEATTLNQIKLTSSSQEFAEK
LGLMSNSLNDGKLESEMALITSGVTYNRILDSLIDLRLSYYSVGEIRDSELFGKNLPFSITFPSGKLPFLQDKPILLNFS
GDGKSYQLTYNQGKSVVEGISGKPLFFEGADIIIEPNSKSTINNTFSFVVNSRPSLVKFLKKNISVQVFNPKANTIQISF
TAGNREKAIAILQSINLAYSQLSREGKALVYERALDYLYNQADLTRDSLSLQEKKLREISYNKDLSSYMDAGPIVNNIQE
LEKSLNELKGERKKYQKLRHFLEADSSIVYIQAYATILTDGSIASNLSELAKLEVQANRIKNSYTERTVASNAKLELYKK
LRYEVAESIKFAEEFLTENISELQGEIGKLKHVFYQNIGGDPDFKKIEKRVEIYTNIFDLLTNKMIEVSMAQASTIESST
VINSPNASKTPITPKIMIAYGIGIVAGIFLSVILILIVYIKMDKISGLKHLERRTTMPILGLIPEYNKEEMPVSKLVVSG
DPKSTMSEAFRSVRTNLNFMITDNENKEQKKVISVTSTISGEGKTFIGSNLAGIIGMSEQKVVMVDLDLRKPKVHLAFGG
NNYKGSSSILTGQSTIEDCLQKTDIDNLKYISAGPIPPNPSELVMSNNFSVFLEQLKKEFDVIVLDSPPIGLVTDGMIIM
QHVTHPIYIIRADYSKVSFIDNANNLYKSGKFKNISVILNSVPDRRSYGGYGYGYGAMSYNAGGFGYGYTYGYESDMNPE
DAAYFNTVSEPFWKRVFKKKKK
>gnl|bykdb|A0A173UQR8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=788 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETEERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A174AHH7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=792 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPTELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A174AVF1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes finegoldii] (length=820 residues).
MTEYNNQQQHLQNDENENGSGLTLHDLLQMVLANWYWFALSVLICLGVAYYYLASTPKIYSRTATILVKDSRKGGDMELG
AFSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVRDGLRTLDLYGRSPIEVDFIDDDNQRLSLEVTELEDGR
IKLADFDDKYLTKQEKRRVIRAQYGDTIPTPLGQMVVHKTPFMDSTYVDRPITVTKSSPMVTTNAYRATVKSDVANKQAS
IVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKKSNQMIDITSEATR
SITESSKFKVEGLSIENQISVANYIRDYLDDPSHAGDLIPMVASLTNNGIVAQITEYNDAILRRQKLLENSSERSPVIQD
MDNVLAAVRRSIIASLNSHVSTLEIQLSNMRKEEALANHRISTMPSQEKVLLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDQAYGSPRPVSPRSMIILGISLLAGLAIPFGIIYLIGILDTTIRGRKDIEENISAPFLGDIPFLEGENKGG
IVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLATAGKRVVLIDLDLRRHALSTT
LGRSNSKKGITSYLAGTITDIGELITPMDVHKNLDVICAGIQPPNPTEMLLSDRLDKLIAELRESYDYVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFRNMCVVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYDDYKETS
YRKRLKLFFSKIGRRIRNKE
>gnl|bykdb|A0A174FPA3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides finegoldii] (length=797 residues).
MEYIQENERTPKKDEGGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMSAMLEV
SGGITGTSVDNEIYILRSHQLLREVVNRLHLDVGYAKDGILRDAPLYAESPVEVHFIDPYNQPVSFNITPLNTTKFRISD
WKVAGEKGRMQEQDLTYNDTIRTEAGRIVVQLRPENLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCS
DTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQRNQIVDMSANATQYLAESSK
VKEESAQLETELSIARSIKTYLADVTRKDQLIPNVTGVGDVSMQSQITAYNELMLQRNRLKESSGEKNPVVQAADKNLEG
MRATISGSMDNYMKTLRLRLDKAKAVENRLASSIQAVPKQEKMALSIMRQQSIKETLYTFLLNKREENALQLAITEANIR
VVEEPFGSYSPVSPARSSILAAAFIVGLLIPLGVQVIILLLNTSVRGRKDIEEYTTIPIVGEIPARKDSEGDDAIVVSDS
RNDRISEAFRMLRVDLNFIAKEARVLMFTSTLSGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLS
TYLSGLNSNPDTLITVGAFHPQVDTIFAGIIPPNPAELLMNERFDQLIDELKKRYDYIILDNVPALVVADAAIVSRVTDL
TIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGYGQGYGYGYGYGYGYGHISGYYSEENKDKK
>gnl|bykdb|A0A174JCE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=792 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPTELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A174QNT3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=804 residues).
METNKTTDLKRTENVVTLRDLLELFLNNWYWFIASILFCVGGAWLYLSAVSPVYQRTAVMLVKSDNQNSQNDLSAMLELS
GIPGGSSVENEVYILRSYQLLNDVVQRLHLDINYVVRNGLRHDHIFGELPFEINFLDNYPGYTELKVSVVNDKQCRISNI
EIEEETRDYDKIVAFNDTLFTPVGRIIVTPKAEYVRLYIGKDVLVTRSDLETVTNSMMERIQTSAMDQKSTLVNIVYQDV
NIARADAILATILQVYNETIVEDKNRIASNTARFIDDRIVIISHELGEVEDQLTIFKQEHRIVDINANANIYLQEGSKAK
EESIQLEAQLNVVEFIKKYVTDKSKSADLIPNVSGVGDAGVQTQIEDYNEMMLQRNRLVSNSGESNPVVQNMNKNLVAMR
STIAGSIDNYMRTIRLRLQNARKVESQVNQSIERIPQQEKYALDVMRQQSIKETLYTYLLQKREETAMQLAVTEANIRIV
EAPFGSRLPIAPKRMMIFIAALVIGIVIPFVYFRFREFWNTGVRGRKDVEEMTTLPVLGEIPARKQGQADEQIVVSENKN
DRITEAFRLLRANLDFMNKGAKVLMFTSTMAGEGKTFVSRNLAVILAGTGKKVVLVDTDIRKRTQSKLSGVQRKEGVSTF
LSGNYNDVAKLVIPGQLHKNVDVLPAGSIPPNPAELLMSDRLELLIEELKKHYDYIILDNVPALVVADASIVNRVAEITL
YVIREGILDRRYLTELERLHQEKKFSNMCVILNDVKDKTNRYGYGYGYGYGYGYGYGYYTEDGKQRRTHIGSRKSLFRKV
LRKK
>gnl|bykdb|A0A174TYU6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=813 residues).
MIEKKTAVGKPADDFIRIQDLWGMFVPRWHWFALSLFAALAVAAFYLLSTPNIYTRTAAILVKDDTKSGSSTTMSEFSDL
GIFKSNTNINNELLTLKSPTLMTEVVRRLGLNETYTVRKGLKDVGLYKSNPVAVSYRHQDETPVSFKIDFSSKEEFTISD
VMINGEELETEFSGKMGDSIRMEVGTFVINPTKYWNDSFVGTSIRYNKGSVRAVTDYYATALRADLGNEDATIINLSIDD
VSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAEN
KKELLALNSQLSTAQYIRRELNNKELSQLLPTNSGIANVNIESQIGEYNTMVLDRNRLIANSSEKNPLAKDMANSLQSMQ
RTIIQSVDNLIVSLNTQIRSIRQQEAATTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRVI
TAPRGSMFPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLEDLSIPFIGEIPQYFSKERKLGFKRKKQSYM
KTIVVKEGSRDIINEAFRVLRSNMDFMAGKDKGQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGSVSS
YVDSPRIGLSDYLGNRVENWKEIIVADKKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVAD
AQIIEKLADRTIFVVRSGLLDRGMLPELENIYQEKRFRNLSVILNGTESAGGRYSYRYGYRYGYRYGYHNGYSSYYGSKG
EMGGVNGWLSNNR
>gnl|bykdb|A0A174UR09 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=809 residues).
MMTINQKNTKPGQQDDFLRIQDLLFLCLAKWQWFVLSLVVTVGAATVYLLRTPAVYTCTASVLIKEDSKGKSVSSDLESF
SEFGLFQSSTNVNNELIAFRSPALMTEMVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDVPENESAGFTLEVQPDGT
LFLSDFIRNGTELDEKDIKGNLLDSIPTPLGKIIIHTTPNYVKGEAYILYISKSSLYNAVNSYSSNLSVSLNNEKASVID
LSLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMA
QSSQTNAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESTNIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQ
ALASMRGAIIRSIDNRIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTA
YNTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFTRENMNTRVRGRKDLENVTVPFIGEIPLFTRKKKGIFGKK
PQEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHG
SASSYIDSPAKGLSDYLGGRIDNLDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQAIDTIREQYDYVLIDCPPIE
LVADTQIIEKQADRTIFVVRTGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGS
DKTRGVGGG
>gnl|bykdb|A0A174VQ92 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides caccae] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A1B1FWQ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flammeovirga sp. MY04] (length=829 residues).
MSDFEKEWEDLENNEESSANDIDFDKLEFVVKKNIIWVILLLILSGVAAYLYIRWTPEIYQANTLNQVKLTSSSQEFAEK
FGITNSSLEEGKLESEMALITSGVMYERIVDSLIDLSVEYYSVGDVRDSELFEDGVPFTLTYPSGKQPALKNTPFYLQFS
NEGKEYVITYKVGQTEKEIKGSSGESIILGGQSLIITPKNKILETNKYSFTFNSKASIIGFLKRNLSVMIYDPKAKTIQI
SFTARNRKKAERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMREMSFNKDLSSYMEAGPIVGNI
QELEKSLNSLKSEKKKYQKLRTLLQADSSIVYIQAYATILTDGSISSSLDELAKLETEALRIRESYTSNTVASNSTLELY
KKLRYEVAESIRFAEQFLDENINDLQREISKLRAVFFQNIGGDPDLKKIEKRVSIYTDISDLLTNKLIEVSMAQASTIES
STVIDAPRAGTAPISPRKMIAIAIAIAVGIFLSVLLIVINYLLMDKINGLKHLERRTNMPILGLIPKYEKEEMSVSKLVV
STDPKSTMSEAFRSIRTNLDFMVSDFLDDNPEEEKEQKTSKVISVTSTISGEGKTFVASNLAGIIAMSDKKVIMVDLDLR
KPKVHLAMGGSNTIGASSILVGQNTIEDCMQETDIPNLKYISAGPIPPNPSELILSNNFKRFIKQLKEKFDVIMLDSPPV
GLVTDGMIVMRHADNPIYVVRADYSKQSFIDNANNLYKSGKFKNISIVLNSVPDRRSYGGYGYGYGTMTYSSQGYGYGYT
YGYDSDLTEEDVAYFDDKKKPFWKKWFKK
>gnl|bykdb|A0A1C5Q1F3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Bacteroides sp] (length=805 residues).
MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHTLHVGDWLHIALANWKWFVLSLVVCMGASFWYIKRSPDIYSRSASVLIKD
ETRGAQLPNAASAFSEMDLLNIQSTVDNEVLIFKSKRLMIEVARKLKLDIFYSVKGKFRDWDLYTTSPVTLTFPEALETS
SFSFKVTPLNDKEVLLSDFPEMEGVKPVEQMKVHLNDTVATPVGKLVVTPTLYYTQDYYQVPVTVNKMNLEKVGMAYNAA
LQSMVASKTSSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKSQH
NLADISTQTGSFMERSNRYQQEGVTLENQRTLALYIRDYLADPAKSGELIPSNTGISDGTIERQIMEYNELMLQRDKLIG
NSSNKNPVVMDMNNSLASMKQTIVRTVDNLIAGLDMKIQNIRGEEERAMKRIAAVPSQQKYVLSVERQQKIKESLYIYLL
NKREENALTKSITESNARIIDPAMGSSVPVSPKTHLIMLAGFMLGLLLPACVLFVLRTSDTKVRGKKDLTDVLSIPFLGE
IPRREREKGEGNRSVVVTEEGKDAVSEAFRILRTNMAFMSGAADGKLQTLMVTSFHVGDGKTFVSSNLAMTLALAGYKVV
LVDLDIRKGTLSKHMGGSQQVGVTNFLAGTVDRVDDLLMPSGCHENLSLVCKGPVPPNPSELLLNARLNVLIRHLKERFD
YVILDNVPSHMVADALIVNRVADLTLYVIRAGGMDRRQLPEIELLHTEHKLKNMALVLNGVNRQRDSYGYYGYYGYYQYG
YKEEK
>gnl|bykdb|A0A1C6B3Y5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Bacteroides sp] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDAFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKIIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTIPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|A0A1C6H117 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Bacteroides sp] (length=803 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
ENI
>gnl|bykdb|A0A1E9CFZ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. HMSC067B03] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A1F3C1M2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWA2_31_9] (length=810 residues).
MSEKKIPLINEKFDIGLFVYIVKKSLILIGLLIGIAAVSVFAYLRYTLPTYKSSSIIQINTKNQTNQLLNIENVSDNNEL
AQIIELIRSTEFLKRTFNKLPFQITYFSEGTFLKNELYKNAPFTIEFNIKNNIVYDIPIYIEFIDKLNFNLSFTINEKTI
EKKFTIGEWIDLDLIEFKLTVNNYNAILEEHDELTKNNYFFIINNPINIIKDNLLKLKVNILNPSAQTVDISFTDNNATK
TSDVVNTISEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTEREIHDFKQLNNIELTNQDNVKPISIYLTKFTEIE
TEILNIEFEYSTLKRINEYVNKNSNLNILDLIAILSGTKSEGLIVSILNKLQDLINQKEILLNDVTKNNHQIQVIDKQVQ
NQKEILIEFISSTLSRLASQKEDYKKKLAEYEEQLFSKNTYNEIEYAKLNRIYSINEGFYNQLIEKKAQYLISQAGFVSQ
NIILEKAVTPLLPISPDKKNVLVFSIVLLLLTCVGFLVVRYLIYNEITGVHDIKEYTSVPVLGAVPLYKTKVPVSQLLVH
YKPNSMFAEAFRTVRSNMQFINNDETSKLIAISSTISGEGKTFIAVNLGGILAISGKKVIILDMDLRKPRIHLSFSTDNS
KGMSTILIGKNSISECIRQSDIKDLQYITAGPVPPNPSELAMSKKVDEILNELKPLYDFIIIDTPPLGIVTDAINHFQRA
DFPIYVMKANFSKRAFIHNLNHLLNNSKLTNLSCVLNGIDVYSRYGGYGYRYAYGYGYGYGYGYGYGSGYYDEKVVKKTF
LQKLKFWSKK
>gnl|bykdb|A0A1F3CFW6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWA2_32_17] (length=806 residues).
MEQKRIPILNEKFDVNIFLQVFKRSIILSIIIFFAAIVGVYVYLRYTLPIYKSSSIIQLKNEGTTANKVLNLTTAVEEIN
SMQVIELIRSKEFLKRTFNKLPLKISYFSQGTFLENELYKANPFSIDYKNTKRNLYNVPIYVSFDKNGDSNIKYKTNNTN
FEKTIKKNKWTDINGLEIKIEVTDIDAIRTQINKIKNDSYYFIINDTESVYKKYSSQLEVSLLNQEANTIQISFKDNNAQ
KTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGITHQIRNDNDSKETGTERYSILLSKI
EEELDNVEIDISNLKQILDEISKTPNIKVYDLISLLPSKNDGILISLLNQMQNLINQRDLYLNNQTQNSFQIKVIEKQIE
TQKQTIIDLIKSNYNRALDKKSTLTKKLVEYELKVYGNSSAMDLDYLKIKRLYTINEEFYNKLLEKKAEYLISQAGSISQ
NTILEKSVIPFSPISPIKTSVIILFLIVALVVNVILLIVRYLLFNEITSPDDIRVYSQVPVAGIVPLYKTKLPVSQLLVD
IKPNSVFSEAFRSVRSSLEFIKNIKESKTIAISSTISGEGKTFIALNLGGIYSLQGKKTILIDLDLRKPRFHLCFNTDNS
KGLSTILIGKNKIQDCIKNSKIPNLDYLTAGPIPPNPSELTAGNEITKIISELKQIYDVIIIDTPPLGLVTDALNIFKSC
DYPIYVIKAHYSKRSFLYNLNHLLLEKHIENLSVVVNGIDIEKSRYGGYNYGYGYGYGNSEYHTDYYDESTTKKKKNIFT
KIISYL
>gnl|bykdb|A0A1F3DS87 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWA2_30_7] (length=812 residues).
MTEKKIPLINEKFDFALFIYIIKKSAILIGLLIGIAIFSVFAYLRYTLPTYKSSSIIQINTKNQTNQLLNIENVSDNNEL
AQIIELIRSTEFLKRTFNKLPFQVTYFSEGTFLKNELYKNEPFSIEFNIKNNIIYDVPIYIEFIDKINYNLSYEINDKKF
ERKYTIGEWIDLSLVELKLTVSNYTAILEEHDELKKNNYFFIIKNPANIIKENLDKLKISILNPSAQTVDISFIDNNATK
TSDVVNTIAEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTERELHDFKQVNKIELTNQDNVKPISIYLTKFTEIE
TEVLNIEFEYSTLKRINEYVNKNSNLNILDLIAILSGTKSEGLIVSILNKLQDLINQKEILLNDVTKNNHQIQVIDKQVQ
NQKQILIEFISSTLSRLESQKEDYKKKLAEYEEQLFSKNTYNEIEYAKLNRIYSINEGFYNQLIEKKAQYLISQAGFVSQ
NIILEKAVTPLFPISPDKKEVLIFSIILLLLTCIGFIVVRYLIYNEITGVHDIKEYTSVPILGAVPLYKTKVPVSQLLVH
YKPNSMFAEAFRTVRSNMQFINNEESSKLISISSTVSGEGKTFIAVNLGGILAMSGKKVLILDMDLRKPRIHLSFSTDNS
KGMSTILIGKNSIEDCIRNTEIKGLQFITAGPVPPNPSELAMSKKVDEILNELKPNYDFIIIDTPPLGIVTDAINHFQRA
DFPIYVMKANFSKRAFIHNLNHLLINSKLSNLSVVLNGIDVYSRYGGYGYRYAYGYGYGYGYGSGYGSGYYEEKETKKSF
IQKLKFWNKKQT
>gnl|bykdb|A0A1F3FZ62 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWE2_29_8] (length=835 residues).
MAAKISQINTEFDLGLLFKIIQKTILPIFILFIISSTIAFLYLRYTHPVFEASSVIQLSSSNSANKVLQTANIYDGENDI
SKTVELLKSKVFLKRVFSKLNFEVSYYIKGRILNFDVYRNTPFIIEQKVFNPSIYGINFDIEFKGNNKYILRYLLNEKLN
IREFYFNETVKLPEMEFVLKLNPKSSIKTDLNADEYYFIINNPDLIVNEHINQIDVSILNVLAQTVLINVTNQNATKSAD
IANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKRMNKIPDRLTDMKSPPTYFSRVNDLQSQLL
NIEVEEKMLEELEKNFSSIKDLDVYKLIAFISGTEVNKIVKGNLDAIQSILLQKEKMLYEITPDNRQINALEYQLGIQKK
IMFETLKSYKSNMKKRKSQLDDMLDKYTRLDSEVDTSRGLRRYDVIEYSKLQRMYSINENFYNQLIQKKAEYSISKAGYV
SQNTIFEYAITPSSPIAPSKKQVLLISFVIAFIISMAFVVVRYLLHNNIIAMIDIVKYTKIPILGIVPKYKKEIPISQLL
IDKRPKSLIAESLRTIRTNLQFISNEPGPKVVAITSTVSGEGKTFIAINLAGIMAMSDKRVIIIDLDMRKPKIHLGFGID
NTKGMSTILIGKDTVEDCIKRSDLANLDIIPAGPPPPNPSELIISKKMDDLIELLKFKYDIVVIDNPPVGVVTDGIASII
KADYPIYVFKSNYSKKMFILNVEKIVSDYNIQNIGIVLNNVEISRPKYGYGYGRYRYGSNYTNYGSSYGYGYGYGYGYGY
GYGYGYGYYEDDAKEDDRTIMQRIKDLFKKKDKKK
>gnl|bykdb|A0A1F3IU95 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWE2_42_42] (length=807 residues).
MTDSRKIKFNDEFDFKLFLNITRKSLIYIIVFSALLFTAVYVYLRYTQPVYESACIVQINTDDKAEKLFDNKTYYEDDIY
RKIEIMRSPVFMQRVVSNLPLGVSVFAKGNILNFELYDDVPFDIKYEIVDSTFYGVPLLIEVHDTGFVITEINGIQTDKS
FRFHEPVSLPQVNFVLTPINNDAHAFFKSNRNKQFIVQFNNLTDIAAQYSQQVNIAVINDVAKTIRISLKDYNPRKAADV
VNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSAPSVDSSLDRTALQSRLFELDNLISENSSEV
ESLEIFYKAFSSGNADIITLLPLISGIESQVYLSPYLQSLKDLEMRKQELLLRVTENSTAIESINAQIEFQNKIIRESTI
GLLTKYKRQYQRYVAEKNNILRMLGKPVIGTMDDQSRIERYYSVNEKFYNQLIEKKIEHSIAQAGYVSQLIVLQPAQSNF
APVSPNNKLIWIGAFVFAMVLSFAFLILRYILYNEVVSLRDVKKLTTVPVLGVIPKYKSFIPVSQLIVDTRPRSLLAEAL
RAIRTNLQFIKNITQAKVIAISSTVSGEGKTFVAINFAGVLAFNNKNVIVLDFDLRKPKIHLGFNTDNEKGISSILLKIN
TVEECIKQSSIPNLHFITAGPTPINPSELILTNETDELLTFLKTKYDYIIMDTPPIGLVSDAMKPLQYADYPIYVVRANY
SKRSYIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGFAYGYGYGYGYNNSKHGYYDSEDIVKKSWKDRIFEKFRRK
DDGSSNV
>gnl|bykdb|A0A1F3K211 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWF2_29_10] (length=835 residues).
MAAKISQINTEFDLGLLFKIIQKTILPIFILFIISSTIAFLYLRYTHPVFEASSVIQLSSSNSANKVLQTANIYDGENDI
SKTVELLKSKVFLKRVFSKLNFEVSYYIKGRILNFDVYRNTPFIIEQKVFNPSIYGINFDIEFKGNNKYILRYLLNEKLN
IREFYFNETVKLPEMEFVLKLNPKSSIKTDLNADEYYFIINNPDLIVNEHINQIDVSILNVLAQTVLINVTNQNATKSAD
IANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDMFKRMNKIPDRLTDMKSPPTYFSRVNDLQSQLL
NIEVEEKMLEELEKNFSSIKDLDVYKLIAFISGTEVNKIVKGNLDAIQSILLQKEKMLYEITPDNRQINALEYQLGIQKK
IMFETLKSYKSNMKKRKSQLDDMLDKYTRLDSEVDTSRGLRRYDVIEYSKLQRMYSINENFYNQLIQKKAEYSISKAGYV
SQNTIFEYAITPSSPIAPSKKQVLLISFVIAFIISMAFVVVRYLLHNNIIAMIDIVKYTKIPILGIVPKYKKEIPISQLL
IDKRPKSLIAESLRTIRTNLQFISNEPGPKVVAITSTVSGEGKTFIAINLAGIMAMSDKRVIIIDLDMRKPKIHLGFGID
NTKGMSTILIGKDTVEDCIKRSDLANLDIIPAGPPPPNPSELIISKKMDDLIELLKFKYDIVVIDNPPVGVVTDGIASII
KADYPIYVFKSNYSKKMFILNVEKIVSDYNIQNIGIVLNNVEISRPKYGYGYGRYRYGSNYTNYGSSYGYGYGYGYGYGY
GYGYGYGYYEDDAKEDDRTIMQRIKDLFKKKDKKK
>gnl|bykdb|A0A1F3K4G0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWF2_40_13] (length=804 residues).
MYQGKIPIINDKFDLAIFLQIVRKNYWAPILFVAVSFVASFLYLRYTQPVYQTQSIIQINETNNTTKVLKIEDVYQDNDI
LKVIELLRSKEFLKRTFLKLPIQISYFSEGTFLSTELYRRSPFQIEWKMITGKLYDIPVYIEFDGSEKALIYYGDGGVNA
SYPIEIGKWSAIRADSIRCTVSDYLTIESQKENYKGNRFYFVISNPKNIVENHLQNLDIFLLNRSAQTIQISYSGYNAEK
ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKRENKINTDQFKAEGSPFPLFTTKISEL
EDELINIDFELVALQRINQQVANDHDLNIYELIATLSGTKSETIVVNVLNNLQELINKKEQLLNDITRDNLKIKLLEKQI
DNQKDLLLEFVNSTIVRMETKKGDYQKKIAEYESKIFNDQNFDELEYSKLERLYTINEGFYHKLIEKKAEYLISQAGYVS
QNTILEVGNVPVEPISPISKKIYPVFILIGLFAGVGYIILRYLLYDEVTSIATIQNFTDAPILGTVPIYKKEIPVSQLLV
NKHPNSIFSEAFRTIRSNLQFISHGAETKIITVSSTISGEGKTFVAINLAGILAISGKKVIVLDLDLRKPRIHLGFNTSN
NKGISTLLIGKNILDECIQKSDLSNFDYITAGPVPPNPSELSAGKQMETLLAELEERYDIIIIDTPPVGIVTDALSNLQR
ANYPIYVMKANVSKRHFIDNINNLVKSKNMDNLSIILNGVELHQRSYGSHGYGYGYGYGYGYYTEDDETTIGKKLTRKLQ
KLKQ
>gnl|bykdb|A0A1F3K695 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWF2_33_38] (length=813 residues).
MEEKKIPLINEKFDLGLFLFVFRKSILLIGIFLFLIVAVMYAYLRYTPPLYRASSVIQINDQNQADKLLNLESVYENTNL
AHVVELIRSKEFLKRAFEKLPLSIAYYSEGTFLTNELYRMSPFTVEANILDSRIYEIPIYIDFISSKETKALYKIGEENH
EFAIYSNVWSNIGLAEIKLKIDDTSQIQAQLSDLKQNSFYFIIKNPNNVYLDHFSRLEVAVQNQLAQTIEIAFSDNNPLK
TAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFKKENNINISESELNTLSLNLYASKIEEI
ETEILNLDFELITLKRIQEQINSKANLNIFELIALLSGTKSGNVIEGILNTLQSLITQKEVLLNDVTNNNHQIKVVDKQI
ENQKMILTEFITSAISRLSNKKDDYKKKLNEFEGQAFNKASYNEMELAKLNRIYTINEGFYNQLIEKKAQYLISKAGYVS
QNVILEKAIVPQSPISPNKKFIFILAIVSFLLISFMLIAIKYLTYNEITGIHDLKSYTDCPVLGSIPMYKINIPVSQLLV
HHKPNSVFSESFRTIRSNLQFISKDEGSKIIAISSTVSGEGKTFVAVNLGGIMAISGKKIIIVDMDLRKPRIHLSFNTDN
SKGMSTILINKNTIDECIKKSELENLDFITAGPIPPNPSEISMKKYTEHVFQELKSRYDVVIIDTPPIGIVNDAMNSFQQ
ADYPIYVTKANFSKRSFIHNINHLAFEKGITELSVVLNNVDVSSRRYGYSYRYGYGYGYGYGYGKGYGGGYYDENTPQKK
TLLQKLLFWKNKK
>gnl|bykdb|A0A1F3KLL5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium GWF2_35_48] (length=833 residues).
MKQQQRLIPVINDKFDLPIFLMIIRKSIWWIVIIFILALFSAFAFLRYTPPIYQSNSILQINEQNQTAEILGFKNNFIKP
SELPAVMELIRSNEFLKRVFVKLPFEISYFSQGTFLSTETYRTSSYIIEVRNVEPEMYNNQIYISFLNKNSFTLEYYING
VKSHYSLKPDRWNKINKTEIKININNIDDLLADKQNLKQNSFYFIINNPTYLLQAYKANLLVEVLSDEAKTISIKYSDYN
AQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKKSNIDSALQNKLSPLPLFTAKINE
LQSEILKTDFELATLKRIEKQLSAGENLKYYDLYSLLSGTKSENVVSRLLEEINKLENDREQMLSDVTANNYKIKVIDKQ
IVTKKGILVEFVKTTIIRLNDSKNDYLLKIKEFEARLMSKSPSNGKDLEYAKLSRLYSIQEGFYNKLIERKAEYLISSAG
YVSNNTILQRSDTPKVPVYPRANIILLVFTLAAFIISLIITLGRYLFFNEITAVGDITAYTDANVIGVIPKYKKHVPVSQ
LLVDKSPKSRLSEAFRNIRSNLQFISNEEGPKVITISSTVSGEGKTFVAINLGGIIAISGKRVILMDLDLRKPKVHMGFN
TDNSRGVSTILINKHTIEECLKFAPIENFHYITAGPIPPNPSELILSQNMDNLVETLKRTYDVVIIDTPPIGIVTDAIVN
FMRADYPIYVMKSNFSKRTFINNINHLITEKNITKLSVVLNSLDTSTFKYGYGYGYGYGYGYGYGYGSGYGSGYGYGYGK
YGSGYYDDEPKKEKKSILKRFLNLFQREKIDNG
>gnl|bykdb|A0A1F3PPL5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium RIFOXYA12_FULL_38_20] (length=809 residues).
MQKKIPLINETFDVRIFTYIIKKSMFLVAIIMGISIVGAFLYLRYTPPLYQSITVLQISNNNNADKVLEIENLREENTIA
QTIELLRSQEFLKRVFSKLPIDIQYFNEGTFLSNEMYKSSPFEVKVKINNGAIYDKKIYIDFENPTTYHLKINSDDLEFE
NLSVGKWENINGIDVKVTITNYKGIEELHKSLNHESFFFILKNPTTLLNEHISKLEIKLQNPEANTIEISYVDNNALKTS
EVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKKENKISPNSDLNLSAFPIYTSKIHEFDEE
IMNIEFELVTLNRIKSEVAENKNIDVYELIALLSGTKSEGYISNILESIQQKNDQKDMLLNDVTNNNHKIKIVDKQIENL
RKTMIDFIKNTIKTLEKKSIDYEEKILQYQNEIFNTGQVNEVELARLTRIYEINEGFLTQLIEKKAQYSISQAGYVSQNL
ILQKSSPPTEPISPRKKMTLIIFLAAGILISLSIVILRYLLHSQITSITDITSYTDAPIIGTIPKYNKEIPVSQLIVNIN
TKSIISEAFRTLRTNLEFIAHGESNKIITVSSTVPGEGKTFVAINLAGILAISGKKVILIDLDLRKPRIHKGFDIVNDKG
VSTILIKKHLYKDCIKKSRFENLEFITAGPIPPNPSELIISKEMDEFLSELHNEYDFIIIDTPPIGIVSDGISIFKKAAF
PIYVTRANYSRRNYINNINHLIDDKNITKISVVLNGLDTRQTKYGYGYGYGYGGYGAYGEYGYGYFEEEFKPKLPWYKKI
IKRILFFIK
>gnl|bykdb|A0A1F3Q014 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_35_15] (length=813 residues).
MLQEDISKTNDNFERYKERISNFSGEFELGLFIFIARKSFFWIILFFILAFLGASAYLRYTTPIFESSSVLQIETTNQAS
KLLNVGNITEPDNGLAEGIELLKSKVFLKRVLSQLPLQASYYAEGTFKNNELYTSSPYSVDYKIINPKISGVKIYIDFVD
STHGTISYSFDNETEQQHNFISNKWMKFPEMDLFISIKNFTEIANEQNVVKKNAYYFTLNDLDAIVNESYPKVEVKLLND
QAKTILVSYKGFNPQKAADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSSETSIQEFTKNNNVTNTDIE
NTAKTTRLNALDDQIISLELEENVLNKIETTLSNSKNIDTYTLIAMLAGTTTESNITSAVEALHKLLIQKEEMLYDVKPN
SEATRLIDYQIEIQKKLLKESINSVKNNVKSRKEDLKRKALEFEGKYQKLPENEIEYGRLQRLFSINEKYYNLLLEKKTE
YSISKAGFVTQNVVLEKAEANLVPVSPNRRITFIIYFLIAGLLGIFLIIIRYLAHNEINSLNEISKYTNSSIGILGIVPN
SKQDIPVSQLLVDKSPKSLIAEAFRSIRTNLQFISNTPGPKIIALTSTISGEGKTFVAINLAGILAFSGKKVVIIDLDMR
KPKIHIGFKADNSRGMSTLLIGKDFIENTVQHSSLENLDFITAGPIPPNPSELIISQKMDDILTQLKSIYDIIIIDNPPV
GLVSDGIAMIQKADYPIYIFRADYSKRNFIQNVDRLYNETNIKNLSVVLNGVDIERKSYGYNYGYGYGYGYGYGYGYYDE
HTKQKKKKSFFKR
>gnl|bykdb|A0A1F3R158 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium RIFCSPLOWO2_12_FULL_31_6] (length=806 residues).
MSEEYRDKQNNEAISNFNTELDIILLLQIFKKNLLLFIAIIITTSIVAFIYLRYTVPLYQSQLVLQVGSKNTADQVLKVD
NFEEKEDVEKDVELLKSKFLLKRALSKLPLNVSYFNQGKFLTFELYKNSPINIEYYIKDSSVIGISHFVEITNNNKFKLY
ENEKLIGEFSDREKIQTNLAEFTVIFNNYEEAKNAQSDIKNTLLFFTINDIESLTNSYISSLNVFPLNPLAKTISLSFQD
NNAVKTADILTSLANEYIIYDIEERSKSSKNVIEFLDDQLDKYYNKVKLSENSIEEFQKTNKLTDIDKFSSLYVDRVNKL
ENQLVDIDLQKNVLEEINNSVKGKIKDINVYNLLPILSGTEYEIRITTLITDLQTLLLQRQKILNEATKESDLIKFHDQQ
IEVQKEVLFKTILSLVEKLETRRKDAVNKIEEIQNKYLNVPAKELQYARLQRVLSIDEKFFTLIMEKRTEYSISEAGFVP
QHTILDKAAVPSIPFSPNRKMVMATGILLGIVISLIILILKYVLKNTISTMDEITKNSNVSVGVLGTVPVYNREIPISQL
VINRDPKSVISEAFRTIRTNLQFISKSEESKLMAITSTISGEGKTFCAINLSGIIAMSGKKVIILDLDMRKPKIHLGFGV
KNDKGMSTILIDKDEIKSCIHHSELTNLDFITSGPIPPNPSELIISGKLDEVVAELKNEYDLVVLDNPPIGLVSDAMEML
KKADYPIYVFKSEYSRKNFINNLNKLMVENGIKKLSIILNGVDYSNKYYSYGYNYNYSYGNKDGYYYDDTQKDKLIKRIF
KKKIKN
>gnl|bykdb|A0A1F3SJM1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium RIFCSPHIGHO2_02_FULL_44_7] (length=807 residues).
MSNKKSLIINKSYDPLILRTILRRYWWWPLTFVFIFGLLAFSYLRYTKPIYESSMILQLSDKDEAKDVLNIDNLNVRGDQ
LSSVVELLRSELLFERAIAHLNLNVSLYSRGKILTEEKYLSSSFHVQPYELRDSSLVYEGTEVAVAYNNGKVVLSYLKNG
KKKTIRGNLNEHFVNDDMDVVIKSTNKQLFISTSQNDDLYFIFNSVQSVAERMRNGVTITPIDVAAKTISISFRGHNAQL
CHDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSSKDSLMFFQRSANLPDPESISGTITENISKLNDELY
RLEEEQLSLDILDQKLNAKVSRLNVYRMIPEMLGKSYETALVGHIESLHTLLEKKEDLLYNVTEENEEVVALTKKIKAKI
LLIQHSVSTIRNRLTTNIAIIRSKIGAEEGEMFELPEKRMEYGRLKNIQELNEKYFTLLTEKKVLYEISDAGYESSNRVL
SAPKVSKEPVAPSKKFVYTTFILFGVILGLGVMFLRYLMFNEINLIEDLVSILPERASILGGVPLFKYNMEYSQLIVAEA
PKSMMAEAMRKIRTNLSYIHPNYKTIAISSSISGEGKTFVALNLGGIIAMSGKRTVLLDLDLRKPKIHLAFEVDNTVGMS
SLIVGQSELDECIQHSVLENFDFITAGPIPPNPSELLLSQRFKDIIEDLKTRYDVVIIDNPPVGLVSDGVRNLTEADIPI
YVFKSHYSKRNFADRVKELFEMQQLKNLNVILNGVQSNRGSVYGYGYGYGYGYGYGNGYMDDDTNKFKEAARKMKWYRRI
FRRDANK
>gnl|bykdb|A0A1G0CI31 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fluviicola sp. RIFCSPHIGHO2_12_FULL_43_24] (length=786 residues).
MNGAQQPSLLINREYNPLIAATIVKRYWWWTLLFVTCFTAIAFVYLRYTKPIYDSSMVIQLGEKDQGKEIVEIENINTKD
NIASEIELLRSELLFGMAVERLHMNVSLFSKGRILTEEKYLQSSFNVQPFQLKDSSLCDIPIWIELKGNKVQLSYQVGGK
SYSMLKPINSRFSNQHFDIAFKVDNIENLRSDDEQNELYFTFNNKKTLVTRLLPNLEITPADIEAKTILIRYQGYNAELC
HDITNAVAEAFFTYDEEVKRKSAENILQFINKQLDSISGELQISKDSLTLFQRSAQLNDPETDGLSLTQNMDQFQDQLFM
LEEERSALKLVSSKLRNDPNRLEIYRLIPEMLGKSFEISLTRQITDLHALLQRKEDLLFDVTENNTEIKNINIQIQSKIQ
SIRRSVDAIEERISNNIKVIQAKVNQYQGEYSQLPGKKMEYSRLKSLQELNEKYFAILTDKLALYSISNAGYSSNNRVLN
EATIASTPVSPNRKMVYAGFIFIGAILGFGVLVFRYVTFNEINSMEDLKQLLPEKATMLGSIPLLKDANEFSQLMVQDAP
KSMLAESLRTIRTNLSFVKADARVIAISSSVSGEGKTFVALNLAGIIALSGKRTVVVDLDLRKPKVHLGLNVSNNKGISN
LIIKKVTLEECIQHSSIENLDFITAGPIPPNPSELILSEGFQEILEKLKSLYDVVVIDNPPVGLVTDGVKILANADVPIY
IFKSHYSKRIFANRVKELFDMKQIEHLNIILNGTKTSGRGYGYGYGYGYGYGYYEEETKKKSNKKK
>gnl|bykdb|A0A1G1SSV2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter glacialis] (length=835 residues).
MATNENRELEELIRNATGGTASLPEAPTVGASEPEDESASLDITTLVLVARRSLLWMLLLIMLGTTASWLYLRYTKPVYK
SASLLKIDERNEGSALGLGGQGAPAVVPNGRTKLAGEVELIKSNIIYQRLKDSLALDVNYYVQGTVLESELYGTSPFRVK
YNITDPSLYNRKFELRFTGPSRFKLDFVAQGRPLGGEYALGQQITFPGIQLQVLETESFAANNTADASYHFTIQDDRSVN
AYLDKNLTVEIVNPEANTIQIAFNDFNASKAQDIVNKIDSVYLEEKLAQKSESTISKLRFLDQILDQNGQNLEDAEDRLQ
KFVQKTGTYDSKGEFEAISGKLEKFETERLKLTDNIAMLAEIANMANQDRLTRDETQTVEQSLPALAGIEDAQLGQELNQ
LNSLQWRLRRVSRSYNESTEAVQGIRDDIAYTRASLKRLLRQNQILLKKELARLDQQRAKLNGALQSLPSKSTQLERLKR
PLDLYTSSYLQLMDRKVQFNIEKAGATADFKILSPASPPGAPISPNQLIVYAIGLAGGLVLGLGLIAVRYFMHNTITNVR
ELERSTKASVLGIIPTYDKEKMEVSRLVVDKNPKSAISESIRSIRTNLDFISSAKKKRMISVTSTISGEGKTFVTVNLGG
IIALSGQRVIILDLDMRKPKVNLAFGAGNAKGVSTILIERHSIQECIQPTSIESMQFISAGPTPPNPSELILSDKFDLMI
QELFLSYDVILIDTPPVGLVTDGILIMRKVDIPLYIVRANYSRKAFIKNINRLMRSNNLTRMCTILNDASSRGAGYGYGY
GYGYGYGYGAYGQGYYEEPAAKPLTFGEKLKKFFS
>gnl|bykdb|A0A1G1SXV7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter lapidarius] (length=835 residues).
MATNENRELEELIRNATGGTAFPSEAPAVGTGETEEESASLDITTLVLVARRSLLWMLLLITLGLTASWLYLRYTKPVYK
SASLLKIDERNEGSALGLGGQGASAALPNGRAKLAGEVELIKSNIIYQRLKDSLALDVNYYVQGTVLESELYRTSPFRVK
YSITDPSLYNRKFELRFTAPGRFRLEFVGQGRPLGGEYALGQQIKFPGIQLQVLGTKNLVTDTPDDASYHFTIQDDYTVN
AYLDKNLTVEIINPEASTIQIAFNDFNPSKAQDIVNNIDAVYLEERLAQKQESTISKLRFLDQILDQNGQNLEDAEDRLQ
NFVQKTGTYDSKGEFEAISAKLEKFETERLKLTDNIALLAAITNMANQERLTRDETQTVEQSLPALAGIEDAQLGQELNQ
LNSLQWRLRRVSRSYNESTEAIQGIRDDIAFTRASLKRLLRQNQVLLQKELARLDQQRAKLNGELQSLPAKSTQLERLKR
PLDLYTSSYLQLMDRKVQFNIEKAGATADFKVLSPASPPSAPISPNRLIVYAIGLAGGLVLGLGLIAVRYFMHNTITNVR
ELERSTKASVLGIIPTYDKEKMEVSRLVVDKNPKSAISESIRSIRTNLDFISSAKKKRMISVTSTISGEGKTFVTVNLGG
IIALSGQRVIILDLDMRKPKVNLAFGAGNAKGISTILIERHSIQECIQPTSIESMQFISAGPTPPNPSELILSDKFDLMI
QELFLSYDVILLDTPPVGLVTDGILIMRKVDIPLYIVRAGYSRKAFIKNMNRLMRSSNLTRMCTILNDASSRGAGYGYGY
GYGYGYGYGAYGQGYYEEPAAKPLTFGEKLKKFFS
>gnl|bykdb|A0A1G1TM36 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter coccineus] (length=732 residues).
MVGVALALLAAYAYNQLAQPTYEVQASILVEEGNKQPGERSALQELDFANGNNVLESEMEILRSRRLMQQVVQTLGLSTV
YQRPGRFSAQDLYGKSPVQLTFLHTLRGQHVLNIVLQDTASFAVRAADGTLTRHAFGRPISDSLGTWQLNATASLRGFEG
GEVRIRTSSPEAVVQAYQKLLDIELINKVAPAIRLQIKDQVPQRGIDVLNQLIAAYNNASATEKNKLTANALQFIDSRLG
SLRGELNQAESAVTGYRSQQGLADVASQSQIVLENTQANDTRLNTAQVQLAVVESIERYLRNPQPAATVPTTLGITDEAL
NNLVGRLTSLQLQRETLLTTTPAGNPLFKPLDSEIQTTQLAIRTSVQNIKASLLTTIRELRSFNSGFKSSIKSMPGQEQQ
LVNRKRQLTIKENLYNYLLQKREEAALSYAATLTNSRTIDSAYVLPSRLASRWLSYLVALVLGLVVPAGLLQAQAGLSTR
LTTRAEIEAATRVPVLAELALDERDQVGLGALQAPSVLAEQLRGLRTRLMLAPPSGPAASQVVLVTSSVSGEGKSFLSAH
LAASFAQAGHATVLVDLDLRRPKLSHRLGLSGSHLGASDFLAGQADWPATVQPTAISPNLSFIGSGTQLATPDLLEGPQL
AKLLAELRGAYRHIVLDSPPLHLVADALLLAQASDCTLYVVRQGVTNQEELGFIEELRQQEQLPKLRLIFNGIDSQKFGY
GYQYDNQYLRPA
>gnl|bykdb|A0A1G7ZF38 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter soli] (length=743 residues).
MLANKTQIADFQDWTKNPFWKAVRYRWYWFLISPLLSVLLGFTFLRYKTPHYTITASLLVRDDSRGSDFHETALLEELGL
PDATSSVENEIEILKSRTLLSQIISDLHLTTQYFAAGTLKTTELYDKTPYKVRFLKSRPAKPESYLIIRETDSTFRLQTS
DHYYKGSFGKKLSLPHGAAIMDTTRFKPSSHYQYSFKISATETILDHYDRVLRIQAPNKAASLVNLSIQDVLPRKGEAIL
NQLIERYQKASIQEKNKVADNTIAFINSNLTHISSELTQVETNIEQFRKRHRVIDMAEDGRQALQQYHSNASDEKQLAMH
LKIVGLLEAHLREKSATAIPSALYPQESNFAAMVSKYNETQLALTRALASLAPGHPEVQSMEKQIGVLRTSLADAIEHQK
RELTLSIAAIREYGRGFENAITRLPGNQRAFLSQSREQGIQQELYLFLLKKRMETAISRSANIANARVVDAPKASQLPVY
PNRQLTLLIALLSGLLTPVGILYIGQIFNNKITSKEDIARQCDVTIIGEISQQRWRQVGSRSLIKEQFRSLRTNVQFVVG
TRPNTVILLTSAMAGEGKSFIAMHLAQSLALAGRKVLLIDFDLRKPSLALLLNLRPEGVTEYITSEREPLIQRCANGPPF
DFLAAGMPHVDTGELMLSPRVAELIPKLKIGYDYVLLDSPPVGLVADARFLSPYADLTLYIVRQHFTFMHQLTDLHKIRE
QLPDLHLVLNGTRDLRRYQYHYQ
>gnl|bykdb|A0A1G8BVM8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides ovatus] (length=821 residues).
MSKNSEQFDFVDFNDGNSNDNTAIADLLGILWRNRFWFALSIIIAVSIAVFYVRSTPKTYSRTATILIKDDKKGGGGISE
AAAFQDMFSMGSNSVYNEMGILKSRQLMLQVVEQLGLETNYQVKDGLRFKDLYTSSPIEVEYMDDVAKQGMFTITVTLLK
NNKAKLTYNISETRDDGEIISNDVVDDISLDSVVAFSHGKIKIKPTIFMHSGYIGQNIIISKINKMNLAKSLVAKFNIES
VDKQSSLVQLSIIDTHPQRAEDIINTLVTVYEKNAIDNKNQVLSKTVDFITDKTTILENELRSIDSDIEQYKKEKNLTDI
PSVSSMYLDASSRINAEALGLENQLSIANYMKNYLHDNANKSELIPGNLGINNSGIESQIARYNETMTLRNKLLANSTSN
NPIINDLQTSLVSMRSSILSSVDNLVASLKIQLKKYNSEEQKSNSKIADVSSQYKFMVNIERQLKIKEELYLYLLKKQEE
SEIQLTTTESNCTVVDVADGNNSPVAPNKMQIVLIALVLGFLFPAIWLYIRSLLNTGIYTQKDIKNSIDIPFVGELPLEK
NTDKSKNLVVEDGNRNVINETFRLLRDNIEMMNAKGSNMGTVALFTSFNSGAGKTFATSNLALTISLSNKKVILLDMDLR
KGSLGKRFGFDRKVSGLTTYLSGKVNNIDEIINKYGGSSLDVISSGALPPNPAELLKTGKLEVLITELRKRYDYIIIDSA
PYGLVTDTSIIAKYADLSILVVRSGKFDKRQLPALVELYKSESLKNLSVLLNAVDINKVGYGYGYGYGYGYGYGYGYGYG
YGYGNKVTKNLRHYIRLVLGI
>gnl|bykdb|A0A1G9E2A9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Catalinimonas alkaloidigena] (length=808 residues).
MVEPTEIQHLGRPIDNEEEESFLSVIDWPKLLSIVNRSIVWVLLFVALGVLAAWISLRYIKPVYESASLLKLEVKRNANV
LFGRNSDLGSQVENITGEIEFIKSRLVYNRVIDSMDLAVSYYVVGDVVNSEAYHDSPFRVEYKLKSGAIQDRSIELEVLN
EREYRLKYELNGEEIQGNFLFDKSYENQHFRFEIHKTRFFTVPGSIRRYYFVINSRGALISYLAENLTVNVVNANASTIR
IAFKDYTPEKARDIVNKIDSIYLVQTIENKNLATEQTLKFLDDQLDSTAQKLAQQEESIEDFVRENRTLSISSTIGQTLE
QIKNLRFERITYEQQLPALDELEAYVNRVDSTLEVEFIPSTRAIRDEQLLSLVNQLNTKRIEQSTLLVSTKPTTQAYQFG
VTEINKLEKSVKELIDFNRTQTQERIKEIDRLTEELESTFTNLPTKDTEFNRTQRYYGLYEKFYLMLMDRVAEFGIAKAG
TVPEFQILAPASLPGVPISPIKSSYYITAVVIGLGLGIGLIAVRYLLHNRFTNQRDIERAINAPLLGLVPAYKRSPLDVA
RMVVDKNPKSAISESLRSIRTNLEFINSSQGSRLISVTSTISGEGKTFIAVNLAGIIAMTRKRVVVLDLDMRKPKVHLAF
DASNDVGMSTLLIQRNKLDEVIQQTSVEGLHIITSGPLPPNPSELLLRPSFQEAIEALRQRYDVIVIDSPPVGLVTDGLL
IMRRVDVPIYVVRSEYSRKEFAKTINRLINENGIRKLSVVLNGVDSSRAYGYGYGYGYGYGYGHEYYTSDHGNENQEGSW
LKNLFRSK
>gnl|bykdb|A0A1H3EMW1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter psychrophilus] (length=816 residues).
MAAKEDAELEELIRNAGRESEEQEDGGGLDLTTLLAVARKSLPWMVLLIGLGLTAAWLFLRYTPPLYKSTSTLKIDEKTE
AGVLGLGGLGAAVEQKQSLNKLSGEIELIKSDIIYRRLNDSLALDVNYYVQGTVLETEIYGISPFEVSYQATADATFDQK
LALRFLSPTTFELTLPEQLGGGEQQHSFGQPFTVAGFRLTVRPTREYSPEALDGEYSFMINSPGALSNYFNTNLLVDIVN
VDANTISISFTDHNPAKARDIVDAVDAVYLEEKLVRKREQSARALRYINEQLSNNNESLGQAEENMQSFVKRTGSYDVKG
EVGTITGLLQELEVERAKLQEQGEMMGDVGRLLQQEQLTTRADGDVMQSIPALAEVKDGQLVQRITELSDAQLDLKRALL
SYQPGATVAMQIKEQSIADLKKIVRQLLRKNQQLLKAQEAKLLGKRAELETKLRSLPDKYTEQARLQRPLELYEKYNLLM
MDKQMEFGISMAGATADFQVLSPASPAVPISPIKFIIYAIGLATGLVLGLGLIAVRYLLHNTVTNIRELERNTNAPVLGV
IPTYDKEKMAVSKLVVDRNPKSALSEAVRSIRTNLEFIATSRKKRLISVTSTISGEGKTFVTVNLAGIIAASDQRVVILD
LDMRKPKVHLAFDTENTKGISTILIEKHTWQDCVQHTSIPTLDFISAGPTPPNPSELILSDMFDPLIAELHQHYDVIIID
TPPVGLVTDGILIMRKADVPIYVVRANYSKKSFLKNINKLIRTNGFTKLTTVLNDAQTTGGYGYGYGYGYGYGQGYYDED
NTAKGGLLSRLRQRIS
>gnl|bykdb|A0A1H3XSC0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes timonensis JC136] (length=808 residues).
MSINQKRPTQTDDFIRVQDLLYLCLSKWKWFVLSLAVTVGIAVFYLLRTPPVYTQTASVLIKDDSKGKSVSSDLESFSEF
GLFQSSTNVNNELVALQSPAVMTEVVRRLHLDMNYTVPGRFHRQVAYGPTLPVNVSINGLSENESVGFTLQVQPDSTVRL
SDFTRNGNEFDDEISGRLSDTITTPLGILKIETTPYYKSKEPYTLYVFRSSLHGTVGQYSSNLSVALSSEKTSIVNLTFR
DHSIQRAEDILNTLISVYNENWVKDKNQIAVSTSMFINERLRVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQSNQ
TNALILTLNNQLYMTRYIRNYLTNDANKNQLLPANSGIESANIESQIAEYNRQLLQRNSLVANSSTQNPLVVDMDQALTA
MRHAIVQSIDNQIVTLNAQIESLQRSEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNTR
IVTPPSGSMQPTAPVRKNILLVAIALGLLIPVVIIFLRENMNTRIRGRKDLEGITVPFIGEIPLFTHRKKGLFRNKAADV
KAIVVREGCRDIINEAFRVLRTNLEFMIGKDRKSNVIVITSFNPGSGKSFLTMNIAVSLAIKEKKVLVIDGDLRHASSSA
YVNSPKLGLSDYLGGRVVRLADVIVTDTNHKHLNILPVGTIPPNPTELLFDDRLKQTIDTVREQYDYVLIDCPPIELVAD
TQIIEKLADRTIFVIRAGLLERSMLVELEKIYDEKKYKNMSMILNGTEESGGRYGYRYGYRYGYHYGYGSGYHYGSDEKR
RGGEMAGR
>gnl|bykdb|A0A1H4ADG3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Arachidicoccus rhizosphaerae] (length=781 residues).
MQTTTLDQLVPVKETKFDFTKIFHRIRANWYYCVICAIVMVGLAGIYLYVANPTYKAMATVLIKDNTGQNNSPQSNGISS
LQSLGLFPGASNVDNERDILVSYPLIHQVVSDLQLYLNFSTYKDFRSKPLYKKSLPFTTSITGFSTDNLDPSQLSYEFTL
NGKSGFTVSSDKHVWKGKWSVPVVLPIGQLTLEKNELTNDWDGSQNIKMDVSSINAVADGFKENINAEISDKQTSIINLS
LNTTIPEQGIDIMNGLIHVYQLSNIEDNNRITDSTIEFLNNRLFTVGAELDSIEGNIQHFKQHNELADLPTQSQSLIANA
GENAKELAAQQVQLSITNSLIEYMHSQNGNDRVVPASLTINDGSLSAIIDNYNKLLLQKERVLLSATPDHPVVKNLDNQI
KGLRSDMLSGLNSIKYSLEAGIGSMQQNEGALNNKIRRVPAQERTFTEYSRQQAIKQELFLFLLQKREESLIAKSSTVSN
ARIIVPGRVATQPVAPNKKLVLSFAMVLGLIFPFIISFFRNLTNLKVETKEDIANNTQTPVLAEILHNGKPADGAIVVTH
SSRDPVAEQFRILRTDLSYLLPSQHQKVILFTSSMPNEGKSYVALNLSAMLAFSGKKVVIIDFDLRKPKLAERLGLNYEN
GFSQYAIGKATLDDIIYCVDGIPNLSFIPSGAIPPNPAELLITDRTTHLFDQLKQRFDYILIDSAPCIVTDARLLSRYAD
LTLFLVRLGTTYKELLKQIQEFYQQEKFPNLNLVINDLNRKRGKYYNGYQNYGADYGYFEN
>gnl|bykdb|A0A1H4D866 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes timonensis JC136] (length=818 residues).
MTEQQINSPQQQGNDEMTGAVTLHDIIRMVIANWYWFVLSALVCLSLAYYYLASTPKIYSRTATILVKDSRKGGDLELTA
FSDLAGFQNRRSVDNEVFILQSRRLMTEVVKRLDLTVSYSVRERLRRRDLYAQSPVEVTFVNDSDNQSLSMEITPLEGDK
VRLTNFEDRFVTKQETRSSITAAYGDTIPTPVGQVIVRKSLYMKPEYTGVPIRVVKNSLSRTTNAYRNAVKSDVANKQAS
VVTISMNNSVPRRAEDILNTLISVYNEDAIDDKRRVSVTTAEFIKARLAVIGRELGDVDRDIEDIKKDNQMVDITSEAAR
SVSESSKYKAEGLSLENQINVAEFIRTYLNDPKNAGELIPMMASVTNQGISSQIADYNNAILRREKLMENSSDRSPVIQD
LDNLLASVRRSIVASLDSHISTLIIQRDAMRKEETQANRRISTMPSQEKVILGITRQQKIKEELFLYLLNKQEETQLNYA
VAESNARIIDLAYGNTLPVSPRPMLILAIALIVGLAIPFGLLYLIGMLDTTIRGRKDVEDNISAPFLGDIPYSEGGAGGD
SGIVVRETGRDALSEAFRMLRSSMTFMNVSAGNEIHTILFTSSDPHAGKTFVATNLATTLAMAGKRVLLIDLDLRRHALS
SQLGHGNCKTGITSYLAGTTGLDKLIAKTGFHDNLDVIYAGIQPPNPTEMLLSNKLDKMMAELRKEYDYIFIDSTPAMSV
ADAIITDRLSDLCIYIVREGVLDRRQLPDIERLYREKKLHNMAIVLNGTRSRRHGYGYGYGYGYGYGYGYGYGDEYKEVS
YRKRIKSFFRSLSHKIKR
>gnl|bykdb|A0A1H9ZSN3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter actinosclerus] (length=816 residues).
MAAKEDAELEELIRNAGGEPEEEDDGGGLDLTTLLTVARRSLPWMVLLVVLGLTASWLFLRYTPPLYKSTSTLKIDEKTE
AGVLGLGSLGGAVEQKQSLTKLSGEIELIKSDIIYSRLNDSLALDVNYYVQGTVLETEIYGSSPFEVSYEALADAAFDRK
IALRFLSPTTFELTLPEELGGTEQQHTFGQPFTVAGFRLTIRKAADSGAAAPEGQYSFMVNSPGALSNYFNSNLLVDIVN
VDANTISISFTDHNPAKARDIVNAVDAVYLEEKLARKREQSARALRYINEQLGSNNQSLSQAEEAMEAFVKRTGSYDVKG
EVGQITGLMQELEEERAKLQEQGEMMNDVGQLLDREQLTTRADGDVMQSIPALAEVKDAQLVQRITELSDAQLDLKRALL
SYQPGATLAMQTKEQSIADLKKIVRQLLRKNQQLLKSQEAKLLGKRAELEAKLRVLPDKYTEQARLQRPLELFEKYNLMM
LDKRIEFGISMAGATADFQILSPASPAIPISPVKFIIYAIGLAAGIVLGLGLIAVRYLLHNTVTNIRELERNTHAPVLGV
IPTYDKEKMAVSKLVVDRNPKSALSEAIRSIRTNLEFVASSKRKRLISVTSTISGEGKTFVTVNLAGIIAASDQRVVILD
LDMRKPKVNLAFDAENIKGVSTILIEKHTWQECVQHTSIPTLDFISAGPTPPNPSELILSDMFDPLIAELHQHYDVIIID
TPPVGLVTDGILIMRKADVPIYVVRANYSKKSFLKNINKLIRTNGFTKLTTILNDAQTTGGYGYGYGYGYSYGQGYYDED
NTPKDGLLSRLRQRIS
>gnl|bykdb|A0A1I1FXP9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flexibacter flexilis DSM 6793] (length=808 residues).
MLQNAEAINNALVELEEEEELRAEKGINSDKLLSILNKSLWWIIMFVVVATLGAYTYVRYTRPTYEAYSVLKLDIKQQAS
GLLSRVYSATGEEMQSSNLSGEIELITSFMLYNKVIDKMGENIHITYMQKGNFVFSEMYKSSPFRVEYEVKNPAFYDIPV
DVLFIDEKQFSLKYKLGNVNYSRNFNFDKTYENQDVKFKITKTPFYKPDVINYEYFFTINSRNKLLMQMFFNTSAYILNQ
SANTIRIIIKDHHPQKAHDIMVTIDSVYLEQTLEQKNKVNEQTLAFLNSQLDTTAQKLAMSEKEVERFIQVNRVIDVRDQ
VAEMITHVEKLKKDKIELEIQNSLLMDLRNTIINNQDIRKIIPALKHINDQELVDLAEALSDLQNQKEMMSYTAKEGTLA
ARLRDKKIGSMGEDLLKIINETTRFLGKKISLVNSEIRQYENRFLAVPTQDKELNRIKRFYDLNEKFYLLLVEKKAEFSI
AKAGTVPEFQILTAPTVPTVPVLPQRANVYLAWLAVAIIAGSALVIIRYFLQDSIVTQKELEKVAIAPILGVIPTYVKEQ
LKVATLVVDKNPKSSISEALRSIRTNIEFILPQNGNKRILSVTSTISGEGKTFISINLSGILALSNQKVVLLDMDMRKPK
LHLAFSSNNDKGMSTILSGRHQWKECIHNTHLENIDLITAGPVPPNPSELIMRPSFKDLLNELHQSYDTIIIDCPPVGLV
TDGILVMQHVDLPIYVVRSEYSKRTYAKNINKLVRVNGFKNLSIVLNGLDNFKTYGYGYGYGYEYYSEDKSSKKGLDLMW
LRSLFTKQ
>gnl|bykdb|A0A1I2N4S1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter chinhatensis] (length=774 residues).
MDKNKTNSEDNLAVALLYKFLPFWPLFLVLLLLGMAGAWAYIKYYTIPSYAVTASLLIKDEEKGVNASKIMESIDAFSTN
KTVENELNVLRSSALMSQVVHKLKLYAPIYEEDRFKSIPAYNTSPITISLKSPETAVEYPAVYFTYDQATQKVQIDGKEY
PLSTWVVTPYGEMLFEKNLLQNGSAQHPLFFSINNPKAVAKQLISRIYVESPGKASSVVNLYIEDNVPERGEDILNALID
AYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYRASNGAVNLNEQGKLYLQSVDFNDRRMNEINLQLAVLD
NVEKYVLSKEENIGIVPSTLGVSDPVLSQLLQKLYEAEIQYQQLKKTTAENNPLLISLREEIDNMRPGVLENIRNQRSNL
LASRDKVASTSSQYSHVLQGIPQKERELLEISRQQAIKNNAYSFLLQKREETVLSYAPSAEDVKVVDRAEASRGPVSPRP
LYIYLTSVVLALGAGIALVTGKELLNSKVLFRSEIENCTNAPIVAELSAAKYKGKKTLLGPDDVAQVEQFRQMRVTMGLY
GRTFTRKKIMVTSSIPGEGKSFVSSNLAISLASSSKKVVLVDFDLRNPNTSVLFEKANEPGIIEYLMDNAQPGEIIKPSP
YQNLSILPAGINIGDHTELLLNGKIEELFKILEESFDYVIIDTPPLDLVSDAYLLSEFCDITLLIIRHAYTPKSLVLRLT
QDNKLKQLNNVAIVFNGVKPRGFVKGQYGYGYGYGYESKYGNKSYKPRGIAVNS
>gnl|bykdb|A0A1I3J6V0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. unc380mfsha3.1] (length=481 residues).
MELQDYLRILRAHWLAIVLLTVLGGSVAFGWSALQPRVYTASASGYVAAANTGSDTGSSLVGDQLARGKVTSYVDIGGWR
AVAEYAISDLGLAESPEQLVTRVDVSSPLDTVIIHVSASAGSPEEARDLAEAWIRGMVEQIDEIEGDGTAGSAAVTLIPG
DSARLPTSPSLPNTRLNVALGALIGLALGIGYAVIRHVLDRRVRNPRDIERETGVSVVGTLPLEKDLTQDRRILIFDGPT
DNQNSTAMTEAMRELRTNLQFMDVDNPPRVIVVSSPLPGDGKSTTAANLAISLAAAGQKVVLVDADLRRPVLSTLFALPD
GAGLTDVLAGRAEYADVVHTGDVSGNLTLLMAGRIPPNPSEVLGSQRMRDLLAVLREDATVIVDSPPTIPVTDAAVLSTA
ADGVLLVVSAGRTTYEMMHKALENVAKANGRVLGVVLNKVPKRGSAAAYYGYQYHGSYTSQVETLTRKERRKATAAATPA
P
>gnl|bykdb|A0A1I5WSL8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Siccationidurans arizonensis] (length=836 residues).
MAINENTELEELIRNATGGSAAPPETPASSGADPEDDSASLDISTLVLVARRSLLWLILLIALGLTASWLYLRYTKPVYK
SQSLLKIDERNEGSALGLAGQMAPAAADKGRGGKLAGEVEVIKSNIIYRRLKDSLALDVNYYVQGTVLEAELYGTSPFKV
IYKITDPSLYNRKFDLRFINKQRFILEFMGQGRPTSGEYALGQTIDLSGITLQIVGTPALKGDVQDENYHFTILSDGAVN
QYLDKNLAVEIVNPEANTIQISFNDFNPTKAQDIVNKIDSLYLVEKVTRKNEATRNQLKFLDQILDENGQNLERAEDRLQ
SFVQKTGTYDTRAELEAISGKMEKLEAERLKLTDKMILLTEIEVMARQDRLTRDETQTVEQSMPAIVGIEDAQLLQQLNE
LNNLQWNLRRISRSYTDKTETVQRTKADIEYARTAVSRLLRQSQKLLRNELSRLDQQRNRLNGDLQSLPAKGTELARLQR
PMGLYDKFFLQLMDRKVQFNIEQAGTTADFQILSPASPPSAPISPNRLIVYASGLAGGLLLGLGLIAVRYFMHNTITNVR
ELERNTKASVLGIIPTYDKEKMEVSRLVVDKNPKSAISESIRSIRTNLDFISSAKKKRMISVTSTISGEGKTFVTVNLGG
IIALSGQRVVILDLDMRKPKVNLAFGAQNVKGVSTILIERHSVQECIQPTSIESMQFISAGPTPPNPSELILSDKFDQMI
QELYLTYDVILIDTPPVGLVTDGILIMRKADIPLYIVRAEYSRKAFIKNMNRLMRSNNLTRMCTILNDASARGSGYGYGY
GYGYGYGAYGGYGQGYYEEPEARPLTFGEKLKKFFN
>gnl|bykdb|A0A1I6BRK6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Siccationidurans arizonensis] (length=783 residues).
MDSQELFSSDLSQAKAGDLKNIVLQYTRYWYLFLLGAVLSISVAFFYLRYYAVPQYIVSGTMLIKDDKSGQSLSNADALS
DLNTFKATRNVDNEIEVLKSKGLMERVIRELDLVTRYYVEERITDREIYGEALPFRIVRNGLDSTMTGKSIIIHLKKNNF
FDLEDYKGITTSHRFGQKIHKAFGSFTVITAGGQYNVGTKIIVYFQDIYQVANHYSQAINIKPVGKTTNVLNISLIDPMP
ERAKNIVDKLMQVYNDEAIDDKKQLGTSALKFLDERLKFVTTELSTVEKGVASYKSTNSLTDIAAQATSYAEQATNYDSQ
IAEWATQSEVLESLENYLKNNNNSIVPNSLGIKDETLAKLIGRFNEVELERQRMLRTMQPTSVLIQNTNEQLADLRVNIL
ETLRNIKNGLRISVNNLKASSRQFQSKVQRAPALERELQEINRSQAIKQNIYMYLLQKREETALSLAATASAARVLDFAK
GGDYPISPNKQTIYLMAVLLGLGLPMGGIYLSGLLNNKVRTQQDITSTVSVPILGEIAHNDENETLVVTTQSRSPIAEMF
RLVRTNLHFAVAGKENIVLLVTSSMSGEGKTFFSINIGSSYAATGKRVLLLDLDMRMPKVAEQLELAEKPGIADYLTSNK
ILVSDIITSSDKVPGLFIAGAGSVPPNPAELMLSPKFAHFIEELKVNFDCIIMDSPPVGLVADALTLAHYVDLTVYIVRY
DYTKKEQLSIVNNCYKNKTLTRPMIVLNDAKAKNGSNYGYGYGYGYQIDSKSKKRKKPTNYST
>gnl|bykdb|A0A1I7BM74 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Lishizhenia tianjinensis] (length=783 residues).
MNSSKNRFFVNTEFDLDIIRNVLKKNFLFALLIIAFFGALSFLYLRYTKPVYQSQMVIQIDNEDQGANVLDLKNVNNDGN
ISKEIELLRSQFLFEEALKRLNLEVSHFAKGEFLTEERYTQSQFQVQLFKLNEPDLYNLPIYFYKDNSNQYKIKYNYKGK
EYIEEVFLNQAHKNEFFHIFIKSENEEVLKRDINDNELYFVFNNTQSLMARLHGDLTIAPLDVKAKSILISYRSNNAHLS
QDICNAVGESFFDYDDHLQQESSEKILKFINAQLDSLNKELILSRNALTEFQRRENLSDLENIESNLSAKVNTLENELEK
LKIEHQDLKRIKTEINNSPRSTEVYKLLPVLIEKSYQNALKDQIETLFSKLEQRENLLYTVTEESRTITQLDKKISADIE
ITNKIINALEEKTAERIDFLENEVKEARSQFFSIPDKKMELSRLKNKQDLNEKYYTSLNEKKVAYAISNAGYTSENKVLS
KALLNSTPVEPNKFQIYYTYFILGILLALLFLFFKYVSYDELNNLGDLEKLAQNQMNILGSIPFQNSDSPHSQLVVHNNP
KSYLSEAFRGIRSNLKFINPEAKTIAISSSISGEGKTFVALNLSAILAMSGKRVVILDLDLRKPKVHLGVSLDNKLGVSD
FLSQNCTLEECINKDVIPNLDVITAGSIPPNPSELILSKYLTELIENLKTKYDYVLIDNPPVGIVSDGVQLLHDADIPIY
IFKANYSKRQFIKRVLELKEIQKIKSINLLLNGVEQRNSKYGYGYGYGYGYTADQKKNRRFKK
>gnl|bykdb|A0A1J5B2H0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium CG2_30_32_10] (length=806 residues).
MQPKKFSIINEEIDPKLFLFLVKRNLLLFAILFIMAIAGSYIYLRYTPPIYETHSIIQLSSDNEAQKIFQTNNINVEEDN
NLAKQIELMRSSLFLNRVISKLPLDISYYTEGRLLNFELYKSSPFEIKYSIKNPAIYGIPIYINFNDDKQIKISYCISDN
SKIEKTFGLTEKIVFQDVDLDVKVTNPEVVFNKSGILNSDNYYFIINNPSTNLSNYVRPLNISIINEAAKTVSITFRDEN
AQKTSDIVNTIAEEFVIYDIEKKAESTNKIIEFIDNQINRMYDTLAKSENQLERFKKTNKIDTIKLDVVPTLFSRQNELE
NQFSKLELEENMLNEVEITFNASENVDIYKLIATIAGSEFQGIISSLLNNLQDLLLKREQLLYEVTLNSSQIESINYQIN
IQKKLLIESIKSLKNNIQHRKSELKIKIQGYEKLINAKTGDFNAVELNRLQRIYAINEQFHNQLIEKRAEYSIMKAGYVS
QNLILEKSTTPSKPVSPQKKRIYIGAIIAAFLISLIVVLVIYLFYNEIRSVEDISKHSNAPLLGILPKYKYDIPISQMIV
DKKPKSLIAEYLRIIRTNLQFISNESGAKVIAITSTVSGEGKTFIAINLAGILAFSDKKVIILDLDMRKPKIHSGFGSEN
LYGISTILAGQTTLDNCINHSSINNLDFITAGPIPPNPSELILNKRMDDLIEQLKLTYDFIIIDNPPIGLVTDGMKSLIK
ADYPIYVFYANHSKRSYIANVDALINENNIKNLSIILNAVDSQYLSYGKSKNYSNGYGYGYYDDDAIQSKLKKFLSSINF
KNKKWK
>gnl|bykdb|A0A1M3KVR9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas sp. 37-18] (length=804 residues).
MTPVQHNKTEQKQTEDLIRLQDLLYLCLFRWRWFVISLFITISIATFYILTTPPIYIRSASILIKEDSKSQSISSDVASM
FADFGLSQPNTNVNNELIAIQSPSIILETVKRLHLDVNYQIKDSFYKKVLYGPDLPITVSFADLADNESVELVIKLLADG
TFECSDFTSDNKDIANNVIKGKFNDTIDTPLGKIIVVPTSYYTKNEMPLIYISRTNLYSATDLFKQNLTASLSEEKATVI
DLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKRQNLVPDVEAASSMYM
AQSRETSNLMLDLNTRLSMARYMRNHLMTSTNNNQLIPANSGIESASVENQITEYNTIQLQRNNLVSNSSEQNPLVVDLD
QSLQSMRKAIVSSIDNLIVTLNTQTKNLQSNEQETTAQIAANPDQAKYLLSVGRQQKVKEALYLFLLQKREENELSQAFI
AYNTRMITSPYGNLNSIAPQKRNILLVAFVLGLLIPVVIIFIRENTNSTIRGRKDLDNLILPFIGEIPLFYPQKRGWRFW
KKQPEESKVVVKEENKDVINEAFRVLRTNLEFMTAKKDNLNVIILTSFNPGSGKTFLTINMAISLAIKGKKVLVIDGDLR
YASTSSFVNSPKQGLSDYLGKQIDNIYDTIIVDEKYTNLSILPVGTIPPNPTELLFDERLETLINDMRSKYDYIFIDCPP
IDIVADTQIIERLADRTLFVVRAGLLERSMLSDLNNIYKEERFKNMALILNGTTSGIGYHKYGYRYGYQYGYYGSNNQTK
KRDK
>gnl|bykdb|A0A1M4XZ45 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Mariniphaga anaerophila] (length=836 residues).
MTQSEINKNNQINSSSDDDTIDLKKIIFKLLHNWYWFVLSIIVALSLAFLYNRYTTPVYEIKASMLVEEGKASSPLSGAM
GGAQQSIFQGLGGMNSMQNIYNQMVVLSSTPIISRTLNELDFEVSYYALGRVAIAERYEEVPFQVIWDEDHPQIINADFY
LTIQPDGKLRVEMDQEDVAVYNYLDEKIVERLPQFSFSRDISAGTKLKAEQFSITILLNEKFNPNAANSYKFRFNTKKSL
VDKYRKSLEVTLSGKETSILNLTLRDYNVSKGVAFLNKLTEVYQLDNLEKKNENANRTIHFISSQLQSISDSLSVSENRM
ETFQSENQVLDISMQSQQLLEQMRDLDQQRVALETQNKYYHYLRDYISTSSSQEMETVIAPSAMGIQDPLLNSLILQLNE
LITEKSSQTSIRKGSEHPTILRLNAQIESVKNSLRENVNNIISQSDMALGNLNQRIRQFEGEIRRLPATERNYVNIERKY
KLNNETYTFLLQKLSEAQIAKASNIPDSQMIEEPQMTGTGPIEPKTMMIYAIGLLLGLALPAGCIMLGDFFNTKIVSQDD
IESISDFPIVGYVFQNHNENNRRSLVLDKPNSPASEPYRAIRTKLSFVTKGKPNPVIAVTSTFPSEGKSYNAINIASSFA
LMRKKTVLLDLDLRNSKMKDEFKLDSDLGVANYIIGKATIDEITFNTKHPWFKIIPAGPIPPNPAEMLTDDKLHQLLEAL
KKQYDVIVIDSAPVGYVGDLFQLHDLIDSNLFVVRHKYTNKMALKIALEEVTKHQLKGVGIIVNQIKIGKKAYGLNSGYG
YGYGYGYGYGYGYGYGYGQKNDGKKSNRKFLNPEEV
>gnl|bykdb|A0A1M4YED3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cnuella takakiae] (length=775 residues).
MSAPKHTQEPQEENILSILQFRFAPYWPLFIILAIISGVASYLYLKYTPPVYSAYSTMMIKDEKRGVNESKMEESLDFYQ
SNKVVENEIVVLSSKGLMEKVISNLNLYTEIKEETQWGLRSAYNTSPVKVIAQNPADLKRTEEIDLSVNATTNVVTVDGK
SYPMNKFVTTPFGVLKFTKNDKANAAPQGALKLFLYNPESLASSYANRVSIPPNPKSSTVLTLYFQDESAYRAKDVLNEL
MNVYTINGLSEKDALAANTLATIEKRLTFVAKDLDSIERTIQQYKSQKGIVDISEQGKEFLRTVSDNERQATSINMQVST
LDQIERYVTSRNNKDGVAPATLGLNDRGLTSLVERLAEAEANQIKLRQTMGENSPQVVATQNEIDRLRPAILDNVRNQKA
SLQASKGDLARTNGMYNSMLRSLPSQERELLEISRQQVIKNNVYAFLLQKREETALSSSSATPDGKIIDVAASSFSPVSP
NKTIGYLAGLIIAFAIGIFVVLAKEILSGKILFRQDIEKYTQLPIVAEIISVKGNAGIVVNQPDKVYISEQFRHLRAAMG
LYGRVVTRKKLLVTSSIPGEGKSFIADNLAMSLALSGKKVILVDADIRGPKTSSTFNLYQKAGLANYLHNEVSLEEVIYP
GGHDNLNVLAAGFTDENPTELLLNGKLPELFGKLEKLYDYVIVDTSPVDPVTDAYVLSEFCDRTLFVVRHGHTPKAIVKI
LDENNKIKGLKSMAIVFNGVKKRGFLKSSFGYGYGFGYEYVYKKAGKEKAANKTV
>gnl|bykdb|A0A1M4YZ07 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides faecichinchillae] (length=805 residues).
MSINQKNTKPGQPDDFLRIQDLLYLCLARWQWFVLSLVVTVGAATVHLLRTPAVYTRTASVLVKEDSKGKSVSSDLKSFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDGKDIKGNLLDSIPTPLGKIIIHTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLTNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVMDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPTVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPEKGLSDYLGGRIDNLDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQAIDAVRERYDYVLIDCPPIEL
VADTQIIEKLVDRTIFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGHYGYRYGYRYGYHYGYGSGYHYGSD
EKRGG
>gnl|bykdb|A0A1M5B2J8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides faecichinchillae] (length=804 residues).
MATIQKKIQVHNTQDFIRIQDLLYLCLAKWHWFVLSLAVCLGVAIAYLLRTPPVYTRSASILIKDDSKGKSASTDMESFA
DFGIFTTNTNVNNEMGTLQSPDLMREVVTRLHLEMNYLVEGRFHKNTIYGDQLPVAVTLTDFPDNQSAAFQLHLGKDGHY
TISDLTRNGTPVEGEVNGQLGDTIQSPFGKMAVTATAHYRKGQETEIEVIRSTIKGAVGDASSRLSVVQNDEKSNIISLS
FQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYKSQHLLPDVQAAANMYMAQA
SEANAAIKSLNNQTYMARYIRNYLTSETNRFQLLPANSGIDNPNIASQINEYNNQLLERNNLVSKSSVKNPLVVEMDASL
AAMRKALVSSIDNQLVALEAQIRSQQSYGGQATSQIASNPKQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAYN
TRIISQPDGSMAPTAPVKKNILLVAFALGFLIPVVIIFIRENTNTVVRGRKDLESLTVPIIGEIPQYFSYKRKWLFRRRV
KPNTKAIVVKEGNRNVINEAFRVLRSNMDFMLAAQKEQNVFVITSFNPGSGKSFLAMNIAMSFAIKQKRVLVIDGDLRHG
STSSYVDSPETGLSDYLSGMTDNWKRLIAYDNRYENFHILPIGKVPPNPTELLENGRMETLIEQLRSEYDYVFIDCPPID
IVADAQILEKIADRTFFVIRAGLLDRSMLPEVESIYQEKRFKNLSLILNGTESTGGRYSYRYGYRYGYHYGYASYYSSKE
KRGG
>gnl|bykdb|A0A1M5BA90 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavisolibacter ginsengisoli DSM 18119] (length=778 residues).
MEPKRHATEKEKNAVEAFMYRYLPYWPLFALLLILAGTAAYMYLHYIAKPVYQISANILIKDEKKGADESKILEALNITS
NKTVDNEVEVIQSGELLNEVIDSLHLYAPIFEDGPIVSRSAYTSSPVTIELEYPNNIQDTDRIDFVYNKGNNTVAIEGKM
YSLNKWISTPFGVARITRNLNLKTASTNPLYFSLNNPKMVLNSLVTNLRVIAASKLSTVIDLAIMDEVPERGENILNTLI
QAYYRSAAKEKNVLAANTLSFIEGRISNVAKELDSIENRLQKFRNQKGVVDLSEQGKLYLQNVGDNDRKMTDINMQLAML
NEVEKYVLSKNNQIGIVPSVVGVKDPLLSSLLQKLYDSQMQYERLKKTIPGGNPAMFSLEAEIDNMRPAILENIQNQRMS
LQASKANLNSGTSTYVSMLQTIPQKERELLDISRQQTIKNVAYSFLLQKREEAALTYTAVIPDSKTINFASASLEPISPK
KMLVYLTALTLALFIGFGIVSGREHLTNKILFRSDIESLTTIPIVGEVMNIKGGNPIILSNNNNRQLGCIEQFRQLRISS
GLNGRHQKNKKILITSSIAGEGKSFISNNLALSLAGSGKKVLLLDFDLRNPKTSALYKLTGEKGISQFLENSKQPLNEII
YHTGNNELYIIPVGFSTINPTELLLNADLENLFEYLDSNFDFIIMDASPIDPIVDAYILSEYADSTLFVIRHGLTTKGMV
ESLDESNKSGTLKNISIIFNGIKPRGFLNKNYGYGFGYGSKNIYGKKTYKVGSMVNNT
>gnl|bykdb|A0A1M5RLA9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Chryseolinea serpens] (length=777 residues).
MLETPKNIQPQQSQANEALDLNKLKTTLKRNWLWLIILFLVINSVAYLKVRYTKNLYESSSELKLDIKNEATEFGIKPTV
EDPNFNLLSGEIELIESRLFLGRVLDSSDLNVSYFSVGRVLNDELFQNAPFLVRYKAQNESSFNVPIHLDDSGSDEFTLQ
VGDEGQKTTGRYNSKVSLNGVDLYIEKNEAFRKGDEIGYFFVLNTRDALLGYLLRSLTAEPLNYNAHTLRISFKDNNPTK
ATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFTLQNKTNNLDEDLKKTVSAINRLDSQRY
ELTNRIVEVNTLMDGMKAGDLSISLTQLHALPPTVAKNLEQLEDLYRDQEKLKLSYNEATFAYRQRQKDIETLRAKASRQ
LEEQRAEWIKRLDQINQKKARLEHEFVNIPDKSTQFSKNLRFYKLYEQFYLSLMQSKSEFEITQAGSVPDYKILSPANLS
YTPISPNKLMITGIGFVGSFVAMLLLVGLLYVLNNKVTSLLDIERVTSVPMLGVVPSSRQFTKNGLHVLDHPKSMVSEAI
RTLRTNLDFFNINGQRKVIAVSSTVSGEGKSFIALNLGAVMALSKKKVVLLDLDMRKPKQNLPVTVEDPSKGISTVLIRK
NTWQECVSTTALSNFDYIPSGPHPPNPSELLLNGEFEELLNDLKTQYDYIILDTPPVGLVTDGIMAMKRADISIYIFRAN
YSKKDFVLNLQRIININKFSNITTLLNALPSTGEQSYGYGYYEEPGTRPWLKKIFNT
>gnl|bykdb|A0A1M6DHW8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter daecheongensis DSM 21074] (length=822 residues).
MAINENAELEELIRNAGGGDTEAEGEEGSGLDIATLLLVARRSLIWIVLLIALGLTASWLFLRYTKPIYKSTSLLKIDEK
TEAGALGLSGTMGKGIEERQSINKLSGEVELIKSNIIYRRLKDSLDLDVNYYVEGTVLENELYGTSPFEVEYRIKDASLY
NTKFNLVFTGSQRIRLSYLYAGQERSGEYSLGQPIVLPGMELLFIGTSFLNAEALDKKYHFVINDEGTLNAYLSSNLSVD
IINADANTIQIAFTDFNPAKAQDIVNKIDTVYLQEKLTQKQQATAQTLQFLEKTLSENRKQLQLAEENLQSFVRDNKTYD
VKADVAAITEKLAAQAEEQQKLAEKARLLSNVARLVEQDRLIASDEATLEEGIPGIALLDDSPLTQQLSELNDLQRNLRR
ILRSYTPATEAVQQQQSTIAFLKGSIRRQLQQNRQLLQNQLGQMSQLQAQFNSELQALPQKETELARLKRPFELYEKTYL
MLMDKIVEFNMAKAGTTADFQILSPASRPGAPISPVRVMVYAVGLAAGIILGLLLVAVRFFMHNTVTSVRELEQSTAASV
LGVIPTYDKEKMSVSKLVVDKNPKSAISESIRSIRTNLDFISSSKKKRLISVTSTISGEGKTFVTVNLGGIIALSGQRVV
ILDLDMRKPKVNLAFGTENVKGVSTILIEKHTVLECLQHTSIPTLDFISAGPTPPNPSELILNPKFDEMLEELYQHYDVI
LIDTPPVGLVTDGILIMRKADIPLYIVRANYSKKTFLKNINKIMRANNFTRLCAILNDANASGVSGYGYGYGYGYGYGYG
QGYYEETKPADGTFARLRKRFT
>gnl|bykdb|A0A1M6GR99 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tangfeifania diversioriginum] (length=782 residues).
MNQQKLPEQNILNIQDIFKLFFKNIWIVISCIIVALGIAYFYNWYSIPTFKVSATLLLKDNSGSSSSSGESRYINSELLS
RSQNIQNELEIIKSFPNISQTVRNLNLEVSYYEYKNYQYYNAYNESPFKVFIFKEHPQLVGPVFDVILNSDGSYALKVEK
QDAMVYNYNTGHKIGERKDLEFSINGNVGQVVETDDFKILVTINENDSLLSSDNRRFAFKLSTIKQLVSHYEQKLEFNIP
DRLGTFIEISMKTNSVQLGEDIINELIQVYSESNLEKKNHLANMTLEYIDEQLDEVSASLNLTENNLQKFMSQNKLMNID
EQSTRLAQQRLDLQNQLAELMTQKRYYDYIKEYNSDNSDDTQIVPPSAMGVQDPLLNNLIEELSTAQTQKDNLIQNNQQR
NPIVNRLDIQIKNLKNTVSENIAAAARSNEISINEMQSRIERIEREMSELPETQMQMGGIQRNYNLNNSIYNYLLEKQAE
AKITKASNLPDNEVIEPAHMVGLSPVSPKNMMNYLIALFLGFTFPFSILLFKSFLKSTITTQEDIENITNAIVVGKVFHF
SERKEKNVFVSSPNDKTAETFRTLRTNLNFAMNGSSHKTILVTSCLSGEGKSFNALNIAASYAQMGKKTILLDFDLRNSH
SVIKKVDKTTGLSLFLNEEVALNEIIQKTEFKNLDFIHSGPVPPNPLDLMEKEMVVNLFDFLRKNYEYIILDSPPLAQVS
DALAIIRYSNLNLIVTRYNVTKKKLLRLVLSELKNKDINNVYIVLNDNKLVSEQMGYGYYKK
>gnl|bykdb|A0A1M6I2S6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercorirosoris] (length=811 residues).
MIEKKTAVGKPADDFIRIQDLWGMFVPRWHWFALSLFAALAIAAFYLLSTPNIYTRTAAILVKDDTKSGSSTTMSEFSDL
GIFKSNTNINNELLTLKSPTLMTEVVRRLGLNETYTVRKGLKDVGLYKSNPVAVSYRHQDETPVSFKIDFSSKEEFTISD
VMINGEELETEFSGKMGDSIRMEVGTFVINPTKYWNDSFVGTSIRYNKGSVRAVTDYYATALRADLGNEDATIINLSIDD
VSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAEN
KKELLALNSQLSTAQYIRRELNNKELSQLLPTNSGIANVNIESQIGEYNTMVLDRNRLIANSSEKNPLAKDMANSLQSMQ
RTIIQSVDNLIVSLNTQIRSIRQQEAATTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRVI
TAPRGSMFPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLEDLSIPFIGEIPQYFSKERKLGFKRKKQSYM
KTIVVKEGSRDIINEAFRVLRSNMDFMAGKDKGQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGSVSS
YVDSPRIGLTDYLGNRVENWKEIIVADKKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVAD
AQIIEKLADRTIFVVRSGLLDRGMLPELENIYQEKRFRNLSVILNGTESAGGRYSYRYGYRYGYRYGYHNGYSSYYGNKG
EMGGGKWLVIK
>gnl|bykdb|A0A1M6K7I9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercorirosoris] (length=823 residues).
MNEEQKVQSNMTAQEEQINIADLLLILRNNWKWFAASIFVCMALAFVYLKSTPKTYSRKATVLIRDDKKGGGMGESALFA
DLNLFGGARSVDNELLVFQSRSIMENVVRRLSLNMSYKVRIGLRTIELYTQSPIKVAFPDAEDNQYIHVCVTPLSENKVR
LSELLMIVNNEEIQSVDEPEVALGDTIKTAIGNIVVTPTLYYTNEYYGDKILVQKFVTERVVDDCMATLSVSLASKMATI
IDLEYKDESIARAEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIESYKRENQLTDITSETGMY
LQTTTKYKQEGLSLENQLSLAEYIKQYLVDPSKVADLIPANTGITDAGVEKQIAEYNEILLKRDKFVTGSSDRNPVVMDL
NNSLGAMRQSILRSVDNLIVGININLKNLREQERQTAKRIEAVPTQQKYVLTVERQQKIKEELYLYLLNKREENALTQAI
TESNARIIDPASGSSRPVAPRSMIILLASMILGAALPAGLFGVLSILDTKVHSRKDLELALSIPLLGDIPEDRDKPKKGE
ERRQIVVRENGRDSVSEAFRIIRTNMDFMRVKSENLQVVMFTSSNPGAGKTFVSSNLAMSIAQMNKKVILVDVDIRKGTL
SGLFANPNSRMGLTNYLSGKTNNVNDIIGQSEEYRKLDLIFAGPVPPNPAELLMSERFDHLIEELKKHYDYIIIDNVPAG
VVADASIVNRVADLTIYVVRAGMMDRRQLPELETLYRQNKLKNMSVVLNGVSYSRKGYGYGYGYGYGYGYGYGYGYGNEK
KHKRKGIMHRIRRQIRFLRNRIG
>gnl|bykdb|A0A1M6KFV3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercorirosoris] (length=788 residues).
MVEKKKPADDFIRIQDLWGMFVPKWYWFAGSLFVTLTIAALYLLSTPPIYTRTAAILVKDNSKSNSSTNAMSDFSDLGIF
KSNTNINNELLTLKSPTLMTEVVSRLGLNESFTVRRGLKNVDLYKSAPVAVTFLDKMEAPLSFTIEFSSKDTFAISEFEV
SGVDTRETFSAQTGDSIHTPAGTMIISPTQAPSDAFMGVPIRYVRRNVRSVSDAYAKELVAELGNEDATIINLSINDAST
RKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLDVIENELGHVDENISNYKSEHLLPDVQAASSLYMAQSAENKKE
LSALNNQLSTAQYIRRELNSKQLNQPLPANSGIVNANIETLISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSMQRTI
IQSVDNLIVSLNTQIRSILRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRLITAP
RGSMFPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSMPFIGEIPQCSGTGKKWELKKRQKTDTIVV
NDGNRNIINEAFRVLRSNMDFMAGKDNSQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILIIDGDLRHSSISSDIDSP
KIGLSDYLGNRIENWREIIVPYKEYANLHIIPIGTVPPNPTELLEDGKLAALITALRPEYDYIFIDCPPVDIVADAQIIE
KLADRTIFVIRSGLLDRSILPELETMYTGKRFKNLAMILNGTESAGGRYGYRYGYHYGYGSYYGGKGK
>gnl|bykdb|A0A1M6R305 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter psychrotolerans DSM 18569] (length=825 residues).
MAVNENAELEELIRNATGSGGASTVSAESEVVEEGGGLDFDTLLMVVRRSLIWLLLLIGLGITGSWLFLRYTKPVYKSSS
LLKIDEKTEAGALGLGGALGEGVAGRQSISKLSGEVELIKSNIIYRRLKDSLDLDVNYYAEGTVLETELYGVSPFRVDYE
GDILYNTKFSVVFTSPQKFRISYLQGGQEQTSEHTVNQPFRIGGMTLRLRPTAYMGATTLDNNYHFTINDEGTINSYLDR
NLLVEIVNPDANTIQISFQDFTPAKARAIVNKIDTVYLQEKIAQKQAATAQTLQFLQQQLAENRQNLAVAEENLQSFARQ
NKTYDVKATIGDLTGRLEKQEEERLRLVEKIRLLNEVAALAEQGTITAREDLTVEESIPALATIENPQLSQQLTEVNSLQ
WNLRRLSRSYKETTEAVQQQREALSYVRGNLRRTLKQSRDLLAGQLAALDRQRNSITSELQTLPQKATELARLTRPLELY
EKSYLMLMDKMVEFNIAKAGTTPDFQILSPASMPGEPISPVKLMVYAIGLASGIVLGLALMAVRYFMHNTVTNVRELERA
TSASVLGVIPTYDKEKMSVSKLVVDKNPKSAISESIRSIRTNLDFISSAKKKRLISVTSTISGEGKTFVSVNLGGIIALS
EQRVVILDLDMRKPKVNLAFGAENVKGVSTILIEKHTIQECIQHTSIPTLDFISAGPTPPNPSELILSTKFDDMLAELHQ
IYDVILIDTPPVGLVTDGILIMRKADIPIYIVRANYSKKAFLKNINKVMRANGFTRLSTILNDSTASGLYGYGYGYGYGY
GYGQGYYEDTKPEEGMVKRLRKRFS
>gnl|bykdb|A0A1M6TTV4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Reichenbachiella agariperforans] (length=794 residues).
MNFSPEHNVLNQTNNQNADSSGSPLDDLDFDKIKQVFVKNVIWMLLILLLINASTVLYVRYTKPIYSSESILKLDIKSEA
GILGIQNPMDQDIKGLSGEIEILKSRLFASQVVNAVGMDVSYFRPGRSHLSDERYGNSPFQVLYNELSSELLDRRIYIEF
VGDNHFYLSLDHDQTEGRPKYKFGEMISHRLGELTIQKTSNFASQKNLVEFYFIINSEDALINYFQKNIVVEPINFNANT
IKIALSDPNKYKAKSLLQAIDTIYLNFTKAAKNLAVEQKISFLDRQMKKTQVELEQYEDYFEKFTIQNRTTDLSRDLNNT
IQLLNQLDSQRFKIRNQITAIELASEQLDEGTPISPVDMPKEIMQLLVDYNKLKNERMLKLESYNENTQVIQRLNQRLEI
SQNSAKFRLTSYLDNLISTQKELAEKRKFLESNFAELPSMGTSYNKNRRLHSLQEEFYFSLIHSKIELEIAKAGTVTNFV
ILSPASMPNEPIKPKKLIIYGAGAIISLVICFLFGAIAYISDDKISNSRELEKHLMAPLLGVVPKYRAEKLPTTRLVVSN
NPKSSMSEALRSIRTNMEFMSSGNGRKIISITSTVSGEGKTFITVNLAAIFAYSGLKVVVIDLDMRKPKVHLAFGKQETS
KGVSTILIGKNTVDECLNTTEVEDLHYISAGPTPPNPSELLLGKRYDEFISELKEKFDIIMLDTPPVGLVTDGILVMKKS
DLPLYVVRANYSKRSYLKSVHGLIRNNKFHNMSVIFNSASNKGTYGYGYGSGGTSGYYEETVKSKKRSFFRKKS
>gnl|bykdb|A0A1M6XHU0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rhodothermus profundi] (length=790 residues).
MAHYRHHSLIVARGGQRGGLPPASSETRDEGRINFAEIWHTIRRGKWIILLTTLVVAGVIGAYTYTLPPVYESSAIVFVD
TRGSGNAPVSVAAFTPIERRALSNELGILKNSAELATRVAKAIVATAETAGAKERFPILAPTEDGREPSIREIAFRLRER
VRFRPLSDQDMIVITAESTTPEEAAVIANRYAEEYEKYSRERSRESLAAAREFVEKQVEQRRQELEALERQWEAFARSRQ
VVRLGPQGERLVAEVAQLEAQRDAARFQLEQEKSALQFIEQELQKLEPGLVNELVKSRQVATLEAQIDALSKKIAELKVQ
AEQYYVFNPKLRGNEEKLGDQQLVEIVRQIDHFEKQREALQAQLVQEMLGRSGQTPATEPLSYVEQLRARRIEKQLAIQE
LERQIEAFNQELAKYEDQLARLPRQQIELEQLERRRAMAEQWYTTFVQELQRIMIAEQSELGYVKIVSSAFVPTVPVRPN
RAQNIVLGILIGLGLGLGLAFLKQAMHTQLDDPEQVREHGYTLLGVVPAMEPYIRKHFRGRKVVEVDNRPRSTTLITLLD
PWSPIAENFRLIRTNLQHTQANKGRATTWLVTSPEMGDGKTVVAANLAVASAHGGQRTLLIDADLRRPRAHELLGLADQP
GLAELLLGKMRPDPESWATDIPNLYFLPAGVVDQPPPELLGSPRMAQLVEFLRKHFDVIVLDSPPVLAVTDSVLLAQLAE
ATLMVVSAGRTDIKALDIARQTLESVNVSIAGVVFNRYRADKRKGYAYGYGYGRRYHKSYGYYAREAATG
>gnl|bykdb|A0A1Q3GX01 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][marine bacterium AO1-C] (length=814 residues).
MEEQNHILPNNNSSENDDFFSSIDLEKIWEILKKSILWMLLLPLLTLSVAHIWLRYTKPIYESSSNLKLAIKDEGVQMLG
IKQLITNNNSNGNLIGEIEFIRSQIIFNAVINTMDLWVSYYEQGNILEAEYYTNAPFKVVDYKIKAPVYYDKKFNIRIKN
QNEFELSFQVGTNLKKQIYKFDQTINHSGLSFKVIKTPFYKKRFHNIPFYFKLNSRQTLIDYLNKNLQVGILNRSARIIG
VNFRDYNPLKASNIVHVIDTIYLQKTLENKKRANIQQKEYLNRRLNEIEDSMRNYEGKIQAFKLKLKTNDVNEKLEKSVQ
EIEELLKQKLALSDELAGIKELENLMEQDKELVLYLPETSAGLQGLTQIMNQINKLQEEKKLLDLKVNNSSMVFKDVNKK
LDIQKEKATRIITKARKSIYKKIVDIQSRIRELENAFGALPAQEAEYKRIERLYGIYEGYYLQMLNRKAEIGISEAGIVP
EFVVLKEANVPVTPISPRKFLIYAIAGGFGIFLSFALVVIRYLLHNKVTNLRELERATKVPILGTVPRYRHRKLKYTKLL
VHHNPKSSLNESLRSIRTNLAFLLPQAQASSKDSRSNIISVTSTISGEGKTFIATNLGGIIAMSDRKVILLDCDMRKPKV
HIAFDEDNNVGVSNILIKQNSLQECIKSTEIKQFDFIAAGPTPPNPSELLLREDFDQLIEDLKSIYDVILIDTPPVGLVT
DGVLIMQKVDVPLYVVKAHYSRKIFGKGIDKLVESHNFRNLSIVLNSVKHATGYGGYKYGYGYGNYYGGGYYEDKQTNNG
LLAKLFSIFKRRKK
>gnl|bykdb|A0A1Q3PII2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter sp. 50-39] (length=752 residues).
MLATKIPSTDLALSRDWTANPLWKTVRYHWYWFAISPLLSLLLAWAFLRYQTPHYTIKASLLVRDDSRGSDFNESALLEE
LGLPNATSSVENEIEILRSRTLLSQVVADLHLTTQYFASGHLKTTELYEKTPYKITLLKPRTAKPTTYHIERRTGNTFTV
RTPSNIYKGTFGIPMALPHGLSIIDTTRFKPASHYLYSFKISTEESVLDLYTRVLNIYAPNKTASLVNLSWQDVLPRKGE
AILSQLIARYMKASIAEKNKVADNTIAFINQNLQRISSELAEVETSIEHFRKHHRVIDATEDGRQILERFHANASEEKEL
AVRMKIVELLAAHLRAKPTMAIPSALYPREDNFADLVTKYNDMLLSRVKALSQLSPGHPDFILLEEQISVLRNSLFDAIQ
YQKQELALSIAAIRTYGKEFDTQIARVPEHQRAFLAQSREQGIQQELYLFLLKKRMETAISRSANIANARIVDPPKASTV
PVYPNRQLTMLVALLAGILAPAAVLYLGEIFNNKISSKEDILRLCDVPVIGEISQHSPSAWFQRDDGRSLVKEQFRSLRT
NIQFITGMRHHNVLLLTSAMANEGKSFIAMHLAQSLALACKKVLLIDFDLRKPSLATLLNLKPEGVTEYIALERGPLIQQ
CGNGPPFDFLAAGAQYAETGEVMLSPKVASLISTLKTRYDFVLLDSPPVGLVADARLLGKHADITLYVVRQHFTFLHQLA
DLQELRKQSQLPDLYVVLNGMRDLRRYQYHYY
>gnl|bykdb|A0A1Q3Q573 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium 37-13] (length=828 residues).
MENKLDLTGSGGSAPKGQQTNFAEGFNLGLLIYILNKSILWIILIVAITVFASFIYLRYTPRIYEATTKMILQLEKSTQI
LGIDNLVFEKDPTEINREMQVLKSTMLLGKIADKLPLDISYLKEGKSKFITEDLYQSAPFEILPEQIAPEFYGNPVYIRL
VNKNSMVVSYSFNGDEFEKEIKPEQKLKTPYFQATISLKPDKLSDGSFNSLYFVKFNDKQTIINDINSKITIEPIEAGNN
TLAITYADQNPEKAKDIANALATEFIDYDLNKKREGMGNILRFIDGQIDSFSREQQAIQDSVAQFKINNEIFSDDNSSQG
ILTSANALQQALIASENQLYLLQNFKMLLQKTKDYSTLPILQFKEEEMSIAGEIENINQLQRSREIKLLERTEDHPEVRL
LDKQIFSSKNQLLKRTEYVIDNAELELGKQRERYQKLMSKIYSLPELQENLKRLNRIADAKNKFFYNLFDQRSNYSIAYA
GIVPDYSVLAVAQLPKTPVSPKETQVKIGGFVLGLLLGILLVAIRYMLHQSIISTQEVEAKSKVPLLGIIPSYYTPMDRS
QIVVTKNPKSTITEAYRAIRSNLQFLNSSEGTKIITTTSTIPGEGKTFTALNMAAIFSMLNKKVIILDLDMRKPRLGKIF
GVEQLKGMSTILSSQSTYEESIVATEIKNIDLVTSGPVPPNPSELILTDKLDKFIEYLKGKYDIIVMDTPPIGLVTDAIT
LLQKADYPIYVLRASYSNKAFIDSINKLYEESEIHNLGLVLNDYGRGPSGYSSNYGYGYGYGYGYGYGYGYGMYGSSYGF
KTGYYTDDPGAKPKKKSLFQRIWNTLKP
>gnl|bykdb|A0A1Q3ZMZ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriia bacterium 40-80] (length=736 residues).
MGYIYLRYTKSVYESSAIIQIQDNDQGKEVLELENINSKKSLSSNIELLKSPVLFENAIKKLDLAVGFFNKGSILTSQIY
QSSSLGYKSLLIKDSSIIGQPVYLILQDENLIRYQSKGKTYTFPFVFGKLISTPHFEVIINGDKESFSSSRDNDLYFIIQ
DPGLLTRQMMSSLKIIPLNPEAQTIEIKFESHNANLSRDVVNVIIDEFFAFDEMLKKQSSENVLNFLNNQLDSLAIELNK
SRDSIVFFQQKNKLNNPDNVADQLIQKIDEANEESYLANNNLSTLKDLKRRINSTSSETEISNILIEIANEEYSGIIRTQ
IETLQEMITDRDILLNKVQKSNPEITIKEKQIDQKIREIKKSIEVLEKKYDRTYSSAIEKRNALELEYILVPEKKIEFSR
LKSTEDLFNKYYSMLMEKKTQYAISNAGYQPGGRILSKAVENFSPVKPKVSMIYALCIVLGGIIGVIIIFLKYITYNEID
SAKDIVQLLKDKVNILGELPIATMNSEYSQIKIKKNKNTRIAEILRGIRSNIQFINPNYKTISVTSSVSGEGKTFVALNL
ATIISYSGKKVIILDLDLRKPKVHLAFNAANNVGVTNYLIHQNTLEECIKKTDIENLDLMTSGSIPPNPNELILKKEYDQ
LISELSKHYDAIIIDTPPVGIVSDGISIMSKADIPIYVFRANYSKRDYVERVEEIISLLKFNSVNVIVNGVNLKKSGFLK
NVKNDYIKNYYIDDEE
>gnl|bykdb|A0A1Q6E6I7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. 56_11] (length=815 residues).
MTENNQDIIDGRKEEENKSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSDLTG
FMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSPLKLTADTIRYTFNIHIKSIEDAD
GSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFRLERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQK
FSNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKSDNSAVDIISE
TKLSLETSRQYEDDLLKTEIQLEMLSAIGDILNGKEEIGILPVNIGIENQALSNAINKYNELVLERMRLGTETSDDNPVI
REMNAQIISMQHSLKKSIENVANSLQIQNESLRQQLAQVSDKVSNIPYLERETVSIERNQEIKAALYTYLLNKREETALS
MVATTPVAQVIDKALVNPIHVAPHRSMIVLLFFAIGLILPAIIIYLIEQLRVKVGSVSEVEDNIHVPIIGAIPSKTAGMH
NDKIVSPNSRDVVTEAFRMVRTNLDFTMPQGGKVIMVTSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKI
SGRRQTKGLVNYLVKKEENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLVTDT
MLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETSTYGYGYGYGYGYGYGNEKKMTLK
TRFRLFWKNLKKRKE
>gnl|bykdb|A0A1Q6E9S3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. 56_sp_Nov_56_25] (length=818 residues).
MAEQQINSQIQTNNEELTNTITLHDIIRMVIANWYWFVLSTVCCLCAAYYYLASTPKIYSRTATILVKDSRKGGDVDLTA
FSDLAGFQNRRNVDNEVFILQSRRLMTNVVKQLNLTVNYSVSDGLRRRDLYGQAPIDVKFINDNDNQSLAMEITPIDDDK
IRLSEFKDQFVTKHESRSVITAAYGDTIPTPVGQVVVQKSLYMAPDYIGVPIRVTKSSLGRTTNAYRAAVKSDVANKQAS
VVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKKDNRMVDITSEAAR
SVSESSRYKTEGLSLENQINVAEYIRTYLNDPKNVGELIPAMAAAGTNTAIAKQIEDYNSAILRREKLLENSSERSPVIQ
DLDNLLAAVRRSIISSLDSNISTLEIQRDAMRKEETQANIRISTMPSQEKVILGITRQQKIKEELFLYLLNKQEENQLNY
AVAESNSRSIDYAYGSNAPVSPRPMMILGIALIVGLAIPFGLLYLIGMLDTTIRGRKDIEDNVNAPFLGDIPYHEGGGKA
GIVVRETGRDALSEAFRILRSNMTFMSVSAGTDIRTILFTSSDPHAGKTFVATNLAMTLAMAGKRVLLIDLDLRRHALSS
QLGHSNSKTGITSYLAGTVSDVESMIQNSGFHQNLDVIYAGVQPPNPAEMLLSDKLDKLIAEMRGRYDYVFLDSTPAMSV
ADAIITDRLADLCIYIVREGVLDRRQLPDIERLYREKKLHNMCIVLNSTRARRHGYGYGYGYGYGYGYGYGYGDDYKEVS
YRKRIKHFFRSLAHKVKR
>gnl|bykdb|A0A1Q6EIY0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. 56_sp_Nov_56_25] (length=810 residues).
MTEQNINPHLLNGESENTNGITLHDLIQMVLANWYWFALSAIICLGTAYYYLASTPKIYSRTATILVKDSRKGGDTDLGA
FSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVREGLRTADLYGRSPIEVDFINDNSKQKLSLEVTPLRNGK
IELTDFEDKFVTRQETKRVILAEYGDTVATPVGQVVVHKTLFMDSTYLKKPITVIKNSLAATTNAYRAAVKSDVANKQAS
IVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKKSNKMIDITSEATR
TITESTRYKAESLTIENQISVADFIREYLNDPSHAGDLIPMVASMTNNGIVAQISEYNEAILRREKLLENSSERSPVIQD
LDNGLAAVRRSIIASLNSHISTLEIQLETMRKEEAQVNRRISTMPSQEKVMLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDMAYGSARPVSPRSTIILGISLLAGLAIPFGILYLIGMLDTTIRGRKDVEENLSAPFLGDIPFLEGDNKGG
VVVRETGRDALSEAFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLAMAGKRVVLIDLDLRRHALTTHLGRSNSKNG
MSGYLAGTITDIDQLVTNMGFHENLDVICAGIQPPNPTEMLLSNRLDKLVEQLKERYDFVFIDSTPAMSVADAVITDRLA
DLCIYIVREGVLDRRQLPDIERLYREKKFHNMCIVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYGDDHQEVSYRKRIKLF
FSKLARKVKK
>gnl|bykdb|A0A1Q6FL18 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 44_46] (length=808 residues).
MGKDRFEDLDFIDFNDSRQQESTVIADMLSAVYRNRKWFILSVVVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLNVSYKEWDGLRKKELYTSTPFTVNFLDADPAQKISLTVTMTDN
GKVTLTDMVLQNELEEEEFDESLTVQPGDTVNTPVGKIAVQPTLFTNESYIGKSVYVAKGNLKEVAEEYNKALNAGVTNK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKKKNKLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTDPIPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSEGNPL
VRDLNGTLMSMRLSIAKAVDNLIANLEIQAANMKNKERENSDKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
HLSITESNCRIIDSAEGVDLPVAPKKAQVILISLLAGIMLPALWIYIRSLLNTSVHTKKELKTGVSIPFLGEVPLEKSKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTAGKVVLVTSANPDSGKTFITLNLAMSMALANVRVVILDLDLRKGSL
SKCVGIGMKKIGISNYLSGKVDDVKELVQVCGEDSRLHIITSGALPPNPAELLKSGRLDRLIEELKKNYDYILLDNPPYG
IVADTQLCGRLADQTIYVVRSGLFDKRMLPELQELYDSGKMKNMSLLLNGIDYVKTGYGYGYGYGYGNYGNDEERKNKKP
LYKRIFGI
>gnl|bykdb|A0A1Q6G7L3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides oleiciplenus] (length=788 residues).
MVEKKKPADDFIRIQDLWGMFVPKWYWFAGSLFVTLTIAALYLLSTPPIYTRTAAILVKDNSKSNSSTNAMSDFSDLGIF
KSNTNINNELLTLKSPTLMTEVVSRLGLNESFTVRRGLKNVDLYKSAPVAVTFLDKVEAPLSFTIEFSSKDTFAISEFEV
SGVDTRENFSAQTGDSIHTPAGTMIISSTQASSDAFMGVPIRYVRRSVRSVSDAYAKELVAELGNEDATIINLSINDAST
RKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMAQSAENKKE
LSALNNQLSTAQYIRRELNSKQLNQPLPANSGIVNANIETLISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSMQRTI
IQSVDNLIVSLNTQIRSILRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRLITAP
RGSMFPTAPRKMNILLVAFAIGLLVPAVLIFMKENMNTKVRGRKDLENLSMPFIGEIPQCSGTGKKWELKKRQKTDTIVV
NDGNRNIINEAFRVLRSNMDFMAGKDNSQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILIIDGDLRHGSISSDIDSP
KIGLSDYLGNRIENWREIIVPYKEYANLHIIPIGTVPPNPTELLEDGKLAALITALRPEYDYIFIDCPPVDIVADAQIIE
KLADRTIFVIRSGLLDRSMLSELETMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYGSYYGGKGK
>gnl|bykdb|A0A1Q6GA32 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 41_26] (length=821 residues).
MSTEQKINKESKASKSSEKEEEINIADILQLIWSNRYWFILSIFLCVGIAFFYLQSSSKIYSRKASVLIRDDSKGGGISE
SSAFADLGLFGGKRNVDNEVLIFQSRHLMEEVARRLHLDISYKIKEGLRNKELYTHSPIILSFPEAEERQSILVTVTPID
SARVRLSDLKMSVGDGEVTSNEVLEVNLHDTIQTPVGAMVVMPTLYYSDNFYEKPISVTKSNMERVVDAYQSSMEVSLAS
KTATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKRENQLTDITS
ETGMYLANTSLYRQEGLSLENQLSIAKYIKDYLVDPQKNADLIPANTGISDNSVESQISEYNEMLLKRDKLVSGSSSKNP
IVIDLNNSLAAMKQTIIRSVDNLIVGLNIKLKNNREHEEQTQKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENA
LTQAITESNARIIDPASGSSKPVAPRTMVILFAAILIGGAIPMIFFWLQKTLDTKVRTRKDLEDALSVPILGDIPQCSEK
DRKESPIIVHENSRSPISEAFRIIRTNMDFMRVKTENLQVVMLTSSNPRAGKTFISCNLAMSIAQMNKKVILVDVDIRKG
TLSNIFTDIPARMGLTNYLSGKTDKIEDIIITNDKYKNLDIIFAGPVPPNPAELLLSERFDRIVTELKKHYDYVILDNVP
VDIVADASIINRVVDLTIYVVRAGIMDHRQLPNLERMYELDKLRNMAIVLNGVNYDRKGYGYGYGYGYGYGYGYGNDEGR
KSKNKSLTKRLKKRISNLFNK
>gnl|bykdb|A0A1Q6GBF5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 41_26] (length=814 residues).
MNTEQKNNNNPGQESEINITDIFRFVLANWYWFVLSVLVCTGIAYFYVKSSSKIYSRKASVLIRDDSKGGAVSESSAFAD
LSLFGGKRNVDNEVLVFQSRHLIEEVARRLHLDMSYKVKNGLREDELYTHTPVTVSFPEAEERQVIKVAVVPVDSVTVRL
SGFSLAVGGGIIHSEEILDVHLNDTVSTPIGTMVVTPTLYYTDVFYDKPVHVTKSNMESVVENYRNRLKVSLASKTATII
NLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIARYIKEYLTDPLKNSDLIPANTGISDNSVESQIKEYNDILLKRDKLVAGSSSKNPIVMDLN
NSLSAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDSASGSSAPIAPKAMTIFLASIVLGLAIPMGVFWLLNMMDTKVRTRKELDGVLTIPFLGNIPRHGSKKGEDSD
GIVVRENGRDSVSEAFRIIRTSMDFMRVKSDKLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKVDDIVGTSEEYEKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYDYIIVDNVPAGIVA
DASIVNRVVDLTIFVVRSGVMDRRQLPELENMYRQEQLHNLSVILNGVPLEHRGYGYGYGYGYGYGYGYGYGNDTHKHTK
MSHVRKILFRFWKR
>gnl|bykdb|A0A1Q6GDH2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 41_26] (length=814 residues).
MNTEYKNTDVRKQEPEINITDILHLIWVNWYWFVLSVLVCGGIAFFYLKSSSKVYSRKASVLIRDDSKGGGMSESAAFSD
LSLFGGKRNVDNEVLVFQSRHLMEEVARRLHLDMSYKVKNGLRNDELYTHAPVTVSFPEAEERQIITVVVTPVDSVTVRL
SGFSLAVGGGGVHSEEVLDVHLNDTVSTPIGPMVITPTLYYTDAFYGKPVNVVKSNLESVIEGYRGRLKVSLASKTATII
NLVLDDVSTARAEDILNMLISVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIAKYIKEYLTDPQKNSDLIPANTGISDNSVESQIKEYNDILLKRDKLVVGSSSKNPIVIDLN
NSLSAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDSASGSSAPVAPKTMMIFLASIVLGLAIPMGVFWLLNVTDTKVRTRKELDGVLTIPFLGNIPRHGNNKGEDSD
GIVVRENSRDSVSEAFRIIRTNMDFMRVKAANLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLIDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKVDDIVGTSEEYEKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGVMDRRQLPELENMYRQEQLRNMSVILNGVPSDHKGYGYGYGYGYGYGYGYGNESHSHNGKH
KSLKNFFSRFLKRS
>gnl|bykdb|A0A1Q6HCG0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 43_108] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A1Q6I3T6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. merdae-related_45_40] (length=790 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRMVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A0A1Q6IT42 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium 43_8] (length=780 residues).
MEEKYTSERKNDNIDIVALWRAACRKWYLFAGSVVVCVALVVCYLKIAKPVYEVSADILVNEDEKKGGGGLSSLMGGISG
GGFSLDGMIGGGSVNDEILVISSHSLIREMVQRLDLNISYTSKKNFFKKKEYYRNSPFTVDIPESMADTLSSGFVVKVQT
GGSDDKIKVLLKKGFFTTLAEMEAASFPIKVDYGEGIVIDKTQFYEPGKKLKFVAHVNGYDGEAEILEKRLDIDLSNKKA
NGISLKIRESNKQRGKDMLSTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHDAENIVERYKRENDLSDIDAEAK
IILEANSQYRKLLLEAETQYSIISMVDSFLNKPENKYSLVPVTTGLPDRGAAEAINEYNKLLLERMRLLRTAKDSNLALR
TLTAQIDVMRENILNTVSKAKESSDIARTDLKKQEQEFRARLRGFPEQEREYMDIKRNQLIKNELYTFLMKRREESAMTL
AATSPKCRIVNPAYSKNKPVEPQSLTLLLIACGIGLVLPVVYLYGKTVFSVKFNNKNDLRRLTDLPIAGEICHSSASGYV
VLRENSVSPAAEMFRLLRSNLQFMLPGGGKGILLVTSSEQGEGKSFVSLNLAYSIALMRKRTVLIDLDLRNPKIADYLGL
SVTTGLTNYLVSNKEGGENDLIHHVAQEGFLDVITAGPVPPNPSELLLSEKLDSLMARLREKYDYVIVDTAPVERVSDTF
SLTRFVDATLYVCRADYTHKNSVFNVEDFVAEGSLKNVMFVLNDTEIKKTYGYSVKHTRG
>gnl|bykdb|A0A1Q6IUW9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=796 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGNRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPEVGLSNYLGGQVDKLSDIIVTDKQHPSFSFIPVGTIPPNPTELLFDDRLQDAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGAGGRYGYRYGYRYGYGSGSYYGSSSK
>gnl|bykdb|A0A1R4AFZ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis] (length=822 residues).
MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFFLSLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMIGNSEVENEILMLKSKRLTAIVVDKLDLDVSIYKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IQINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLNTTLFFADSWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKRNNITD
ISTDVGTYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYDRLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNKEMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSSEPISPRKPVIFFAAFLLGLVLPSTFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKNRYDYVFLDSV
PAMSVADAMITNRVADLTIYVIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRSTYGYGYGYGYGNKEYDKQG
KKLRRRSAKKTKKFKMDPMKKS
>gnl|bykdb|A0A1R4DVZ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis] (length=822 residues).
MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFFLSLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMIGNSEVENEILMLKSKRLTAIVVDKLDLDVSIYKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IQINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLNTTLFFADSWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKRNNITD
ISTDVGTYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYDRLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNKEMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSSEPISPRKPVIFFAAFLLGLVLPSTFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKNRYDYVFLDSV
PAMSVADAMITNRVADLTIYVIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQG
KKLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|A0A1S1Z228 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flammeovirga pacifica] (length=829 residues).
MSDFEKEWEDLDNNEESSANDIDFDKLEYVVKKNIIWVILLLMLSGIAAYLYIRWTPEIYQAHTLNQVKLTSSSQEFAEK
FGIANSSLEEGKLESEMALITSGVMYERITDSLIDLSVDYYSVGDVRDSELFGDGVPFTLTYPSGKQPAFKDIPLFLQFL
NGGDQYQVTYKTGDQENTISGKSGEQIILGGQPLIVTPKNKILETNKYSFTFNSKSRIIGFLKANLSVMIYDPRAKTIQI
SFTARNRKKAEAVLEAINKSYGQLSREGKALVYERALGFLYSQIDITKDSLNNLEKTMRELSFNKDLSSYMEAGPIVGNI
QELEKSLNQLKSEKKKYQKLRHFLEADSSIVYIQAYATILTDGSISSSLSELAKLETEALRIKESYTSNTVASNSTLELY
KKLRFEVAESIKFAEQFLDDNIKDLQKEISKLRRVFFQNIGGDPDLKKIEKRVSIYTDISDLLTNKLIEVSMAQASTIES
SSVIDAPRASAAPIRPKKLIAIAICLAIGIFLSVLLVVINYLLMDKINGLKHLERRTNMPILGLIPKYQKEEMSVSKLVV
SQDPKSTMSEAFRSIRTNLDFMISDFLDDDPAIEKEQKTSKVISVTSTISGEGKTFVASNLAGIIAMSDKKVIMVDLDLR
KPKVHLAMGGSNVNGASSILVGQNTIEECLQKTDIPSLEYISAGPIPPNPSELILSNNFKRFIKQLKDKYDVIMLDSPPV
GLVTDGMIVMRHADNPIYVVRADYSKQSFIDNANNLYKSGKFKNISIVLNSVPDRRSYGGYGYGYGTMTYSSNGYGYGYT
YGYDSDLNEEDIAYFDNKKVPFWKKIFKK
>gnl|bykdb|A0A1S9B3W0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. CRA2] (length=831 residues).
MAVNENAELEELIRNATSGGVNTPAPPASESDDDNVGGGLDLPLLLSVTRRSLPWMILLILLGLGASWTYLRYTKPIYQS
SSTIKIDEKTEAGQLGLLPPGAADPRQSMSQLAGEVELIKSDLIYTRLRDSLPLDVNYYAEGTVLETELYGVSPFHVTYT
VREPSQFNLKFSVKLLDAQRFKLSYPAGAGETEGEYRFGQPITTPGFTLELQPTKHFNPQDTEGAYYFIIKDPGSINGYL
GSNLGVSVINPDASTIGISFTDNNPAKARDIVNKIDSVYLQVKLARTNQATQQTLTFLDGQLVENRDKLQNAEEALQNFV
KQNKTYDAKSDLGAITQELSELQKEREKLLRKATVLTEITRLVEQERLTKDDETVEQSIPGLAALEDPVLSQQIGFLNEQ
QREMRKVLQSYQPNATTAVRIKEDQLQKTKSNIQKLLQQDVKLVREEISALDRRNGEFNSQLLALPQKETELARLRRPLE
LYEKSYLMLMDKKVEFNIQKAGTTADFQILSPASTPGSPIYPVKLMVYAIGLALGTVLGLGLVAGRYLLHNTVTNIRELE
RNSSAPVLGVVPSYEKEKLAVSKLIVDKNPKSAISEAIRSIRTNLEFMANSKQKRLISITSTISGEGKTFVAVNLGGIIA
LSDQRVVIIDLDMRKPKVNLAFDAENTRGVSTILIDRHSVQECIQHTNIPTLDFISAGPTPPNPSELILHPQFDRMLEEL
KRTYDVIIIDTPPVGLVTDGILIMRKVDVPIYIVRAGYSKKAFLKNINKLVRGGSFTKLTTVLNDAKAGGMYGYGYGYGY
GYGYGYGTGYGYYEEAQAPKGLLARLRRRFS
>gnl|bykdb|A0A1T3IYP5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia meningoseptica] (length=791 residues).
MDTIKQKNYIIENKKEQSINVLDLLKYLLHHWKWFTLSILIFGGFFYYQYSKTPFIYNQSEVVMIKTPSNTPTTARITRS
SVANVVSVKDEIIQLKSKELMRLVVDKVGADKSYKIHSGLRDYELYKKSPVHVKIEGKTQESSYSFIITPFDSKTVILKG
WDQSGKDVKVALNQLVETPVGKVFVTPSKNYKDYYGTDVFVAKYPREVIMSQFVANLKIKQMEEDASLLQVSMEDQSPER
AADVLTALINVYNEVYLQDKNKIAENTANFIKDRLEIIEGELGSVESNIEDLKIANQGIDIATAGGTFLTEKNQYRSEGA
KVETDIRLAEMMRSYLSAKGKQNNLIPNNTGLVDASVENQIAEYNTTLLKRNRLAEGGNNLNPVVLDLDDALSAMRNNIS
RAVDNVLKGLRIKLNNAQREEGVAQSKVLQMPQKERTMLSIERQRRVKEDLYMFLLNKREENALNEAITEANLRIIDPPV
GNSSPISPNRLKKISTGIAIGMALPAVILLSMLLLNTGVRGRQDLENVLTVPFLGEIPLATGKRQGKGDVLVSQAGRDPL
TEAFRILRTNINFMSKEGLPPQVLTFTSFSAGVGKTFSVLNLAATLSYLNKKVVVVDLDLRKGTLSSRVNLLQGKGTSHY
LSEVSVTLDQVLHKSELIENVDVIPIGAIAPNPVELLLGKRLDQMIAELKSRYDYVIIDGVPVGVVADASIIDRVVDLTM
FIIRIGKMDRRQLPEIEKIYNEGKLSNLAIVLNGMKLQGYGYGTYGYGGYGYGYGYGETKKKSIFDWFKRL
>gnl|bykdb|A0A1T4NAJ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas cangingivalis] (length=795 residues).
MDEKVTTYKRNVEEYFSLKEIFRLCLIRWKWILLSLLITVGAATAYLMITPVEYKRSASILIKESDKPGASLAQDIGGFA
DMGLFSKSTNVHNELVSLRSPATLLEVIKRLNLDIDYKVDGRFHRSTLYGSELPIMVSIDRFYGALEWSLSLTVRGDGMV
EVSDMILDGEPMGEGQIFLGELVDSIPTPMGIVRVGLNSAYSDEMSIQTPMTIHVSRSNLSTTMAECQKRLQVGLINDKT
SILELSYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISSFKSKNLIPDVRTASE
MYMTQAGEAGTQILALNNQLYMARYIRGHITGGQGRELLPVNSGINSPVIEREISEYNETLLQLNRLLSNSSEKNPLVID
MDRTLTAMRRSILLSIDNEINSLSNQIKTLRAQESKSTSRIASSPTQAQYLLSVERQQKIKEALYLFLLQKREENELSQA
FTAYNTRVITPPMGELTPIFPRKRNILLGAFLLGLLVPVAFIYVGAVTDTKVRGRKDLEGMTTPFLGEIPQSGDSKGLRA
IKRRRKHERYEIVVQAQNRNAINEAFRVTRANLEFMLGVDGHQKVMMLTSLNGGSGKTFVTMNLAASFAINNKRVVVIDL
DMRRGMLSTYVDSPEVGLSALFSGQLEDWRSIIVPSDDLPDLHVLPVGKIPPNPTELLYSSRLSQLLEALRQEYDYIFID
CPPVEIVADAYIIEKLVDKVIFVIRAGLTDREMLSVVDAFYNNKKLNNMSLILNGTSSMHGNHGYGYDYKQYISD
>gnl|bykdb|A0A1T4PT95 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas circumdentaria] (length=831 residues).
MNSNPYSNSSDVIMEKHQEIPEENMISLSDIFYLLQQNWYYFIFWLIIALAGGYIYIKSTPNSYEKTASVLINTESNMSG
PLADIMKISGAELGFKGTDKIENEIIIFRTHNMLSQVVNRLNLRVNYQRKEGISSKKLYKDSPIHLTLLEFPEDHSGSFI
LSFEGSDKVRLSHFKGDFSKTSPLSDRVVLFGETIETPIGSFVLTGNPSTEVEDKEIKITISSREEIISDLAKRLTIAQS
SKGSSIIDLRFRDENPHLAEDFLNTLINEHDTTSRLEKLKIARSTEAFINDRITIISKELGDVDHEIERFKQNNQIANIE
SEAEIYIESSKEITKQTIEINNSLAIARFIKEHLTNPSTAGGLIPASSGLEDLSSNTLINEYNTLYLYRERLLSESGQTN
PLIETQQKQLESLQKAIIKSIDNYIKSLNIKLNSINKQSNKNESKISSVPMQERIISSIYRNQKIKEELYLFLLNARERN
ALSIEGAESDVRLIQPAVGSSTPVAPKKAIIMLAALVLGLLIPTGHLYLRFIINNKVRGRKDLETYTPQIPILAEIPHST
RLEKKQNILVQNFLDLFRSQQKRLKKKRYQRRSNMLLGQLFESDYVSESFSVLRSNMAFMLPAKACKVIALTSALPNSGK
TFVSGNLAHNLCMRGTNKVLLIDADIRKGSMTATLRKGLSVQKFGLSEFLHKEELSIEDVIVPFNKQIIFDFMPAGEAPP
NPSDLLLSPRLGELIQDLRKKYDYIVIDTVPFLNMADAQIIGEHADLNIMVVREGNLPRALLKEINLMYKNKYFKNMALL
LNDAGASQHISGRSYGYQSYTSEYNSYFKQQ
>gnl|bykdb|A0A1T5CS78 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salegentibacter holothuriorum] (length=771 residues).
MKYNSNTGKEDNLFRYIIKTFFPFWPLFLVLVVVCVLGAWGYLKYVTPIYEASASIMIKDEEKGVDNSRIMESINPFDSK
KIVENEIEVLKSRDLMKSVVRDLDLYAPIYEDGRIKAISAYTSSPIKVIVKEPNRISISNEEPEKHFFNYNFNEENVVFS
GKEYSLNKWFEISNGQTIMFVKNDNVNKKASNPLFFYLLNPKIISTSLLDELDISTSNKLSSVVNLSIKDEVPERAENIL
NRLIYQYNQKIIKDQNELALSTMTFIDERIENVEEELDELEYKIQQYKSNEGVVDLSEQGRLYLQDVGENDKQISELELQ
LAVLNNVENYVISKGSAGGMVPSTLGISDPILSQLIEKLYNLEVDYERLKKTTGENNPILTSISNQISKIRPSILENVKS
QRQNLQSRLSSLNSNNRRFNSTLRNIPGKERTLLEINRRKTIKNNLFSYLLQKREEAALANVPTNENSAMIDKAEASIYP
VSPKPLFIYLIAILLAVGIGTGYVVGKEVLSGMVLYRDDIEGLTDIPVIAELFYAKKSKNKKFKKPQDFVLIEQFRQLGA
RLGLYRQDIQNKRILVTSGISGEGKSFVSSNLAFSLAQTGKRVVLVDMDFRKHNTSELFNLSNSKGIIGLLKGEVTYDEI
IHPSEVNSNLFVIGTGARADDYTETLLNGKLEFLMDSLSDDFEYIIIDTAPVNILAEVNLIAEFSEKTLFVVRHGYTSKE
SLKRLDESAGLQSLKNVSIVFNGLKVRGMVLTDYGYGYDLKHVMSYANQKT
>gnl|bykdb|A0A1T5K9D4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium WCE2008] (length=794 residues).
MENGNNQKNSGQINLVDIFFYLLNHWYWFVLCIGLAVAFTSYRYAKTPFSYRSNATIIIKNPSNTRATTKLDNYSNLINS
VSMSNEMLQLKSKTLMAEVVKDLNIDVNYIHHVGLRNIELYRNAPIRIFFSREDNPIGYFTIKATPRDSKTIELDLSSLG
QKNVVVSYGDKVKIGDGSFTIDKTRNLGKHWFGEAIYIQKIPVSQAAAAYSSALSISQNNSAETVLNLSIQDFSLQRAND
ILTAIVYRYNEEAVKEKNKVAVNTAEFIDSRIKIIRKELSDVEDMMSGYRSTKKLLDANADAAEYLSESRSYGSDISQVE
TNLSIAEYLRDYVRGSMDSFEVIPANTGLNDANLDQAISQYNDLVIKRDRLEKASSSVSPAVMQIEDAMISMKQNILGTI
DNLMTSLNVQKRDLLRQEATAMEKFTEMPEKAIEMRQMERQLSIKEDLYIYLLNKREENELSQAMVDDNAIMFDSAEGSP
VPVYPSRQRMMLLAVLMGLLVPAVVMLFKMFLDNKVYSRKDVEEIVKVPFIAEIPMKKQKKWVKRAKNDSISLAYDPNSK
GLFTEAMRILCTDLDFMKPEGKENMVISTTSLMVGAGKTFLTTNIAACLADAKKKVIIVDLDLRKRSVSSLFGMKHRTVG
LTNYIYDEKVEVASIIYDDVLNGVDLIPAGHIPPNPTELLSRKRFDDLIDELKKTYEYIILDCVPFNVVADSMIINRVVD
MNLFIIRSGQMDRRNLPTIDELNNSGKLKNPGIILNGGILRHGFGYGYGHGYGYGYGYGYGYGYGYGYGYGEKE
>gnl|bykdb|A0A1T5MMH4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Ohtaekwangia koreensis] (length=783 residues).
MELAKNNIHHQPLPSEGIDFNKLKVIVRNNLVWIALIFLVINLTAYLIIRYTQDRYESFSEIKLDVKDEASELGISILAG
KDQQNTDLISGEIEMIRSRLFLDQVLDSLNIDVTYYSKGEVLNHELFGNSPILVSYKIENPAFFNQPFFLEKESPETFSL
VWGEGTQKISGRYGAPVHISGIELTLRKNENFLDENDIDLFFIINSPDALLGYLISGLSVEPLNYAAQTIRIAFQDNNPL
KAHAIVDAINKTYLHYSYEQKKLTTKQKIDWLNNELQQIELKMEGFEDYFERFTLKNKTNDLQEDLRKTIESINKIDSQR
YELSRRLDEINKLMDGLQTGNFSVNPSIRQALPEYMFKDIDEVQSLLLQQERLKLSYNENTLAYREKQQEIENRTDKTSQ
QLAELKKEWMRRLQEMNQQKSSMESAFVNMPDLNTQYSKNQRFYKLYEEFYLSLMQTKSGFEIAQAGTTPDFKILSPATL
PFTPISPNRLIVLGIGFVTSLVSIFFFIGVLYLMHNKITNIHELERLTGVPVLGVVPSSRYSANEGLHVISHPKSMVSEA
IRTIRTNLDFFKINGSQRVIAISSTISGEGKSFLALNLGGAMALSRKRVLLIDLDMRKAKTYLPVHIPDPSKGMSTVLIR
RDRWEDCVLQTNLDFLHYIPSGPIPPNPSELLLNGEFTNLLEELKKQYDIIILDTPPVGLVTDGIQAMMRADISIYIFRA
NYSKRESISNLQRIVSINKIVNVTTLLNALPSTKKSSSYGYGYYEDEGQSNVDRIKSLFKIKA
>gnl|bykdb|A0A1V3WH27 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter himalayensis] (length=732 residues).
MSSYTTDNYGAAAPQQHEVDLVRLLVEMIDHCTMILCVTFLFILCAGLYAWIAPPVYQADAMVQIENKHDNNLLKGLSQL
GTDVSPDVAPEILLLKSRMILGETVDKLALTQQAKQRVLPVVGRLWQRLQGREQGKITLGELQIPQVEGNAQELTLTVQE
AGKYHLTGENIEADGQVGKTLVTQGIVLLVTSIEAEPGTQFSLKSLTRLETINALKKRLTVAESEKQSGIITLTLTGEDP
DSIARVLNAIAENYLQQNIARQEAQDSRSLDFLQAQLPKISADLDQAEARLNAYRAQRDSVDLSLEAKSVLDQVVNVENQ
LNELTFREAEISQLFKKSHPTYRALHEKRQTLERERERLNNRVSAMPSTQQEILRLSRDVESGRTIYLQLLTRQQELNIS
RSSAVGNVRIIDEAVTLPDPIKPRKALIFVLGALFGLMLSMGTVLVRQAFKRGITLSEQLEAQGMPVLATLPRSQWLWSK
TQLRRKNPFSRRWKHKTSDVPFLPVDRPADMFVEAVRGLRTSLHFTMMEAENRIVMISGPTQDCGKTLVATNLAAIAGQS
GQRVLFIDADMRQGYVHNIFGLENRHGLSCLLEGKRDLAEVIQHAEKGGIDVITCGPEPLRPLELLLSERFLSVMSWVNE
QYDIVIIDTPPVLAVTDAALVARAAGTTLMVARFDKTSVKEMENTVKRLQHVGVKVSGTILNDIVKSAALYYSSGYSQYE
YGYASRKKGERR
>gnl|bykdb|A0A1V3WH52 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter himalayensis] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVIEAKWWVLGITAIFAVAAIVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVHDLGLDIAVTKNTFPVFGAGWDRLMGRSNDTVKVTDFVIPKGAGDQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKEGVSIKVSAIQAHEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLSKQLPEVRARLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGISVYASIPLSEWQKSRD
SVKTVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMMTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEISESAKPTSIPKFDLIPRGQVPPNPSELLMSERFTQLIEWASKNYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A1V5IPN7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.BinA104] (length=763 residues).
MDQNNQPSTVPQPEEIKISDYLRILLQYRYLIILIFVVVLAGTIIYTLRQPRIYSASGRILMENQSSGADILLLTNQGGG
KNSINNQIELMRSKPILNAAYEIMKKNPDWESYPISGSAYPVGNLRRIQISSKRDTDILNLSFESTNRGEAMAAVNAIAD
AVQQQNTQMARLEFTTIREFLGEQLDLISRRLQISEDDLRAFKNENKLIEISETTRKWIEQTTQVESQYEAALTEQAVKA
KTLDVLRKQLQDQDSLLVKVENVLQAPYIGELRRQITNTQATIARLRTNENYSENHPQMKLLQEELAKTKNTLDTEIQKF
IAISLSQDPLSARNEVLMRIVQAEVELEIARTHVNGLEQTKAIFEDRLITLPDKELEYARLLRSMTLDEKIYGIMMEKYE
DARIAEQAKIGNIRVLDYAEMPSAPIKPRVSMNMLVGLFLGLGLGIGAAFLVHSLDTKLRTLEDMENYVRLPIMGTIPVI
QESESRIVEFNNMIEQAEGENKEQLSKSLHFVMMQLVSHYAPKSPIAESYRTLRTNILAKKPAGSTTLLITSSGPKEGKS
TTIVNLAITLSQMNSKVILVDMDMRRPMVHNKFGVEKENGLSDYLIDNDVPLEQVVKASGIPNLDVITSGFIPPNPSELI
SSSQTDKLIEDLRARYDFILFDTPPIIAVTDALILTKKVDLTFIVVRCGYTEKGIIKRTKELMENIDATIDGIIVNGVYV
QKYYSKQNYYYYYYYYYYYYGEDIPQKHKKSAARFLRKNKPVS
>gnl|bykdb|A0A1V5N756 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin408] (length=814 residues).
MANIKISYLNDEFDLKLLLSIVKKNIPYVLIIFAFFFTLAFLYLRYTYPKYETSGTIQIYTEEEVRQVFGKKTQVDLAKK
VELLNSSMFLSRVFSKLPLDIAYYKKGRFLNTEMYRSNHYNVHYVVKKPVIYNVPINISFLSNSNIHIDFEAEKKSNQYE
FSILDTLKTEYFDMFVTLKDPGYFKNISFIDKDDYFFVLKKPSDILSSYIPNLSVFVVNENSQSIMVMYSDRNPVKAADI
VDTIISEFNLYDVEKQAMSTDKILKFIDEQLEIFNQKLFETKNDIQEFKKENKIDLIFQPLPEVYSIIKEFNSEILKLEI
EIAKLKRVEEFVNQSKDLDVYELYALVAGSQFQSSVSGNLQAIQNLLMQKEELLYNVTAYNSQIKQINYKLDIQKKLFAE
SIKIALDNIINKKKELEKQLASYNKTIYPSIDEQNVGELSILQKVYEANEALYNELLNKKAQYTIDRAGFISQNIILENA
AIPEKPVYPIKSKIYIFSLIFSLILSLALIAIRYLLSNEIISAKDIAKYTNIPILGVIPKYNSIIPINHIIVDSKPKSLV
AESLRAVRTNLQFIKDEPGSKIISITSTISGEGKTFIAFNLACIIAFSYKKVVVIDMDLRKPKIHLGFGVENKKGISTIL
SGISNIDDCIFNSHIDNLDFISAGPIPPNPSELIQTEKMIELIQYLKQKYDYIIIDNPPIGIVIDGMRSIQLADYPIYIF
KAKYSKRQFIQNIEKLFEGSNIKNLSVILNAVDYAYSKYGLQNYSYDSSYGYGYGYGYGYGYGYGYGYYEEEGEKKKKAT
FIQKLKNIIDSNDV
>gnl|bykdb|A0A1V5W8T5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin217] (length=796 residues).
MFNDSFDVSKLIHILRQNFIFYIIFGLIAGISAFTYLRYTPPIFDAYTVIQINEEQNEDLLKIDNIYGQTSITNLIELIR
SREFLKRTLHKLNLYTSYYLEGKFLTSELYNKTPFFVEYQDVQSAIFNKNIYLDYNKKTDKITIEYSLDGEKSIKHEIKR
NEWTQIQGLKLYVNIINVEQILENKGNKFYFRILDDKGAFAEHITGLDVSILNFDAKTIRIYYTSNNAQKTSDLVNTISE
DFLTYNIEKKQERAEKVLAFIEEQMSVVYNKLDESEKQLDQFKKSNNITGSIFDDKAAIQNALMDNSQQIKQYDTQLQSL
QKVNKQIAAGKDFNAVELISILSGSSSESMVLNFLNGIQQLQKQKEQLLITVTPDNHKVKVIDQQILEQKKLLLDFIKIS
NDRIKTELDAAKAKTKVEKAIEIDEIELAKLKRIHSINQNYYDQLVTKRAEFMISKAGHVTNNLILQKSDVPQFPISPIP
SFIIFIAVVLSFMAMVMLTLIRYMLYNDITSLNDISRFTDVPVAGLIPVSKQTNKINRFVVENKANSVITEAFRTLRSNL
EFMHQVSNEKKIIAITSTISGEGKTFIAINLGGVLSMGGKRVILIDLDLRKPKVHLTFKSNNEHGLSTILIGKDHYKDCI
IETEFENFNIITSGPPPPNPAELANSESFDRLLETLKEDYDIIIIDTPPIGIVSDAIFSFKRADLPIYVTRANYSKRNFI
NNINYIAEQKSIKNISIVLNAVEIMTSKYGYGYKGYGYSQYGYGYGYGYGFGYGYYSYGPEKEKKKKSILKVFEKE
>gnl|bykdb|A0A1V6CN82 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin123] (length=854 residues).
MTEYNDTDRTQDSAAQEELPVFNYKRLVSELISHWYLFVLFMGIGLAGAWLYNRYTTTMYSARASIMILEEGSTTFWRQA
GGFSGEALRGFGTSYQGIQNQMIIMKSQPVVAKAIRELGFEVSYHNEGKLSTAENYTDAAFRVEWDRNHPQLIGFDFRIS
VHPDRSITLSGFGEGVGVYNYSENRGAGYFPEVKIEQKVQSGEEVVIPGQCSFKINLNEGFFPPVTDYFFFRFHTPDELI
NAYRSRMTVSLRDWETSIVDIDLKDYHPQKAVDFLNKLVEVYRIDNVEKKNQYADQTINFIEYLLEGVSDSLAVAEGELL
SFQSRNRIFDIGSQSGQLLSEMSELDSKKQELETQNKYYNYLKTYILENRDVGSILVPSSVGINDPLLSGLLSQYNQLTV
EKSKMSDVLISPRLTQLNDQLGNVKEAMLENINNIVDHNHQMLADLQRRTAMVEARVGKLPVTERDLFKIERRYNMNNET
YTFLLEKLSEAQIAKAANQPESQLVESASSMGAIGPEKNKAYSYGLFAGIVPPALFVLLLVLFNNKVISKEDVEMLTSLP
ILNMVFFNKQKEPTMTPVLDKPNSPDSEAYRSLRGKLDLMTKGKVKPVIAVSSTAPGEGKTYTSINIASSFALTRKKTVL
VDFDLRNSRINQDFELDASKGVVSYILGKDSLAQITHQVKHPNFFIIPAGPIPPNPGEMLMDEKIGKLLTELKEIYDVII
IDSAPIGYVTDLFQITDQIDSTVFVIRDSYTNRKLLKQALDEIKMYRIKGVGIIINAIRTTGGLFPAYVLSYVNGYRYGY
GYGYGDYGYGYGYGYGYGGYGSKHKRKRFRLMPPKVEVEETNGNGNHHGRPEMS
>gnl|bykdb|A0A1V6I2U9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium ADurb.Bin028] (length=816 residues).
MDENKTSLFNQKFDARTFLIIFKKNVWVVILLILISLGAGFAYHRYSTPRYKTSTIIQVKNENKTNQILGISSNLMEKDL
APVIELIRSNEFLKTVVEVLPLDISYYRKGTFLSTELYGSTPFEIKYNIINTEIYDQNIDLEFKDYKCHIAYTLGNQKYE
YTIQPEELQTIYGMDIYVHFPSKKDLEQELDPQNKSQYFFTINNPNTTLKNLSKRLNVQILNETAGTIKITYQDFNARKS
TEITNTIAEKFIEFDEAKKKESATNIIKYIDQQMENVFTQLNATEKDLHNFREQNNILNIKDEYLFNKSNIYSSQISDIE
SKILNVDFEIMTLEKMLDKLKSNPEINTYELLAMLSGQKSEVFLSSMINSLQELLNRKEVLLFDLTSNSHKIQTLDEQIK
SKKETIIDFTRSTIKRLNAEKVELDKKNKELENIAFKESKYDEIEYARLQRLYAINEDFYAQLIKSKAETLISQAGYVSN
NIILEKANIPSSPDFPIFSTIMTIAFIISLILSFIYLAIKYLLYNKIISIDDIINHTNIPVVGGISLSKTNSEISQMVVH
LRPKSMLSEAFRNIRTNLEFYPIKDKSRIITVSSTIAGEGKTFLALNIGAIYAMSGKKVIILDFDLRKPRINECFNVDNI
KGVTSILLGKNSFQECVRNSSLEGLDFITSGPLPPNPGEFILTNKYNELIEQIKQYYDIIIIDTPPIGIVNDALASYRLA
DNQLYVMRAGYSPRAFVNNLNYFSKSSQLKNLAIVLNGIEKSIASYGYGYKAGYGYTKRSAYYGISYLNDTHNSYYGEED
KAKSNFFNKIRKKFKK
>gnl|bykdb|A0A1V9F098 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Niastella populi] (length=797 residues).
MQTNKKTGNEMNIISVVTNWYLPYWPMFLVLLILGLAGAWAYLKFYSIPVYETYATIMVKDEKKGVDESGVLEALQIYPT
KNIVENEMEVIHSRKLMEKVVEQLQLYAPIYEAAGNKGKIKPTSAYNSSPVTIIARKPDELKSTGDSVVHFQVNYYDDNN
AGEFRNVDEPKVKEVVIGKKVFPINQWVSTKYGELKFEKNERQTEAPGGPLFFRLSKPKNVAPGYIASLEVKSSSKLSST
INLTFRDEVRDRGEDVVNKLLVAYNRLSIEEKKGTAANTLEFIETRLAKVEKELDSIEQRIQTFRTDKGVVDLSAQGRQY
LENVGSNDRKMADLSMQLASLNEMERYVNSKENKGDIIPATIGISDPVLTELMQKLYNGKLEYEKLMKSTGENNPFATAI
AKEIEQIRPIILEKLRAQRINLEASKKDLASISGGYNSMLRTIPRKERELMNISREQVTKKSIYNYLLEKREQSALASSS
AISDSKIIDMASSSGDPVAPKKTLIYFAVLAVSMGLGIGLVSAKEMLNKKILFRSEIEALTIVPVIAEISANKENESLLN
TGSKTSVVAEQFRHLRAAIGLVGRQKSLDIKRILITSSISSEGKTYVSTNLARSLALAGNKVVLVDLDIRIPKTSSIMGV
ADKPGVAEFLEGSKDPEEIISNTMDENMFVVSAGNGKDNSRELILSGRLNHLLTYLTATFDYVVLDASPIDPVSDSYIFS
EFCDLTLFVMRHNRTPKTMVQLLDDNNKFKALKNPHIVFNGIRSRGVMSGMYGYSYGYGYENVYREKQRKRSKLQSV
>gnl|bykdb|A0A1V9F383 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Niastella yeongjuensis] (length=811 residues).
MQPNINTKNEKNIGSLIVNWYLPYWPLFLILIIVGVGSAWAYLHFIAVPVYETNATVMVKDEKKGVDESGSMEALQIYPT
KNIAENEIEVIHSRKLMEQVIVQLLLYAPINEGPEYSMGKFNETSAYVSSPVSIVAKDPDELIETGDTDIVMSVNYYTDK
ERRAATNVYKDKVKEVVIENRKYPLRVWCNTRWGELKFIPNDRQTTAPVGPLFFELNKPKDVAPGILLNLQVNSPNKLST
TIDLTLRDPIPRRAEDILNKLLIAYHLQSIEEKKGMAANTLEFIEARLLKVERELDSIESVVQTFRTDKGVVDLGEQSKM
YLENVGDNDRKIADLSMQKAALDEMENYVTSRSNKGDLVPATLGITDPVLSDLMQKLYNKKVEYETLLKTTAENNPYAVG
VAKEIEQLRPLVLEKLKNYRLSLEAGKRNLASISSGYNSELRTIPQKERELMSISREQAIKKGIYSYLLEKREQTALASS
SANSDSKIIDMASSSITPVSPKKMLTYFGALALFGGLGIGIVSLKEMMNKKILFRSEIESLTSVPVIAEISVNKDKESLL
HSNSKVSIVAEQFRHLRAAIGLFGRKKEINIKRILITSSIPSEGKTYISTNLATSLALAGNRVVLVDLDIRKPRTSAIMG
IDQQAGVAEFLDGSKTPEEIITNTEVNNLFVVSAGRGEDNSRELILSGRLDILIAYLHDTFDYIVLDASPIDPVSDSYTF
SDFCDITLFVIRHNRTPKTMVQILDNNNKFKALKNPRIVFNGIRSRGILKGMYGYSYGYGYENVYRDRENKRSKFQKIFH
FPSKKDKKIRV
>gnl|bykdb|A0A1V9FHD0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Niastella vici] (length=793 residues).
MQTHKKTGNEMNIISLALNWYLPYWPLFLILIVLGSAGALVYLNFFATPVYETYATVMVKDEKKGVDESGMGEALQIFPT
KNIVENEMEVIHSRKLITDVINQLHLYAPVSEAADFGSLKMHATSAYLSSPITIVAQDPDQVKETGDTDVLFSVNYFPGP
NGKASKEIKEVVIDKKAYPMNTWCNTPYGVLKFEKNARQTTDSTGQLYFDLYKTKNLAPTISLNLVVTSENKLSSTMDLT
YSDAVPQRGEDIMNHLLLAYNQLSIDEQRGTAANTLAFIETRLKSVRHELDSIEGKIQTFRTNQGVVDLTEQGKQYLENV
GTNDRKIADLSMELAALDEMERYANSKDNNTETVPSTMDIPDPVLTDLMQKMYTAKVEYGKLMKTTGENNPAAIELAKVI
EQTRPMILEKLRMHRINLEAGKKDLTSTSGNYNSMLRGIPQKEKELLAISREQAIKRSIYDFLLEKREQTALASSSAVSD
SKIIDMANSSVLPVSPKKMLVYFAVLVGFLGLGIAYVSAKELLNKKILFRSEIESLTNAPIIAEISANKEDASLIKTGSK
VSVVAEQFRHLRAAIALVGRQKELAIKRILVTSSISSEGKTYISTNLARSLALAGNKVVLVDLDIRIPKASSIMGVANEA
GVAEFLEGTKTPEEIISSTTDDNLFVIGAGQQKDNSRELILSSRLKSLLQYLSNTFDYIVLDASPIDPVSESYVFSEYCD
MTLFVMRHGRTPKAMVQILDSNNKFKALKNPHIVFNGIRSRGVLKRMYGYSYGYGYENVYREKRSRKHKLQHA
>gnl|bykdb|A0A1W1VRL3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter roseosalivarius DSM 11622] (length=815 residues).
MAAKEETELEELIRNANGIETEDKEDEGDGLDITTLLQVARKSLPWIALLIALGLTSSWLFLRYTKPVYQSSSVLKIDEK
TEAGLLGLGAGGSVEKRRPGANLEGEVELIKSNLIYRRLKDSLALDVNYYVEGTVLESELYTRSPFQVTYKIKNPAFYNR
KFNVNFSSPTQFRLSYLEGEQEVSGVYSVGQPLNLAGLDLRLTTHGTYFDANALDAQFYFVILDEGTLNTYLNTNLSVQI
VNPDANTVQISFKDFNPAKAQDIVNKIDTVYLQEKLAQKKKASDQSLQFLSEQADAFNNKLQLAEDNLQSFARENRTYDV
RADAATVNGKILAQEEKRQNLLQKQGLLADLSSLVEQDQLTANEDSTVAQSIPGLAELEDGRLTQEIEALNDQQWDLRRV
LRSYKETTEAVKQRRVQLDFTRSTIRRLLEQNKLLLQEQIEKMNRQRDELNAKLDGLPQKATQQARLQRPFELYEKTYVN
LINKDLEFRLGQAGTTADFQILSPASLPSEPISPVRAMIYAIGLAGGIVLGLGLIAIRYFLHDTVTNTRELERMTSASLL
GVIPTYDKEKMMVSKLVVNKNPKSAISESIRSIRTNLDFIGSSRKKRIISVTSTVSGEGKTFVTVNLGGIIALSEQRVVI
LDLDMRKPKVNLAFGGENARGISTILIEKHTIEECIQHTDIPTLDFISAGPTPPNPSELILNPKFDELLAELHQHYDVIL
IDTPPVGLVTDGILIMRKADIPLYIVRAGYSKKAFLKNINKLMRTNNFTRLSTILNDASATGLSGYSYGYGYGQGYYDEP
TPPKGVISRLRQRIS
>gnl|bykdb|A0A1W2GF52 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Reichenbachiella faecimaris] (length=776 residues).
MNPRNVHIPQDIRSHHNPENDGAFENFDFEKFRQVFASGWPWVLGILITTMSLSFLYMRYTKPIYSAESILKLDIKNDAN
LLGLQNPLEQDIKGIAGEIEILRSRLFFSKVVDAIGMGISYYHPGRSHLVDERYGNSPFEVQYDLTNSALLDKRFDIEIL
NETDFYISSEYLGGRIGEKQQFGNPIVTKDFSFTLEKTNFFDDQKNLIDFYFVLNSKESLINYLESHVTVEPINFNANTI
KISLSDFNQTKARNLLQAIDTIYLAFTKNAKNQAVEQKIRFLETQMAKTSKELVEYEDYFEKFTIKNRTTDLSSDLTKTI
ALLNELDSQRYNLREHLAEVDLVGENFRNGQQVSIFKMPTRITELVNSYNDLVNDRALKLNSYNENTQVIKRLDQQIEIA
KNSANSRLLAYKNNLAQDLADLNKKRTILENNFVELPSMGTSYNKNRRLYTLQEEFYFSLIQSKIELEIARAGTVTNFVI
LSPASVANTPIHPKSLLIYGLGLVVGLMISILFVAIQFLLHDKITSQKELEKIMHAPILGLIPNYKQEKLANSKLIVTNN
PKSSISESLRSIRTNMEFMATNGKNQLVSVTSTVSGEGKTFIAVNLGAVFAYAGQKVVIVDLDMRKPKVHIAFESEKVQK
GMSTILIGKEKVEDCIQESELENLHFISAGPMPPNPSELLLSPRFDEFLEKLKKKYDVIFLDSPPVGLVTDGILVMKKAD
LPIYVVRADYSKRSYLKSVHSLISNNKFEHLSVILNGVKSGKGSYGYGYGYGYYED
>gnl|bykdb|A0A1X7J248 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Marivirga sericea] (length=790 residues).
MSNQQTRYQRNLEGNNSHRPQNQETEVVDFFKLKTILKKNLPWAILLIIIAVFVAFLYVRYTNVKFQSYAELKLNKRSEA
SVFGFNPLSEESSNLNTLSGEVELIRSKLFLKQVINKLPLDVTYHVIGRFKDDERYRFTPFTVSYDKSCAAYGEKFFVDI
IDKTNFKISTNQDGEEWVSQKFGQEFIVDGCKYKLEITPHFFNTESLTFTISTPESLMSYVESNLSVAPENLNANTIKIT
FEDYNPYKVQEIVETVSELYTEYSKEQKNKANQLKIQFLNKQLKQTESELANYETYIEDFTIENKTINPSDDVSRLIAEM
VKMDSILYGINYQLGEIENIQKQLEKDTLSFDKINYLVLPSNMQPLFEEFSELKEEYQLSKTRYKKESQVLLQRKIEINV
LKDRINNYLSSKVSILKDRKVTALARKRKIESNFNQLPAKTNELNQKMRFYSLYEELYLSLMQKKTEFEIAQAGTLSEVD
ILTPANLPKNPIGPSTNLIYIGSFAVGFILSFIFISFRYLLYDEINSIHELERLTTIPIIAKISRLSRYVAKKSGVIVSE
KPRSQISEAFRTLRTSLDFIGIKEGKKVLSISSTTSGEGKTFVSVNLAAILAMSNKKVIILDLDMRKPRAQYAFNLDQNE
MGVSSILSGGIHWKECINNTKTENLHFIPSGIIPPNPAELLEGEYFDHLLKELKEEYDIILLDTPPIGLVSDGIIALKKA
DHSLFVVRADYSKRSFIDDLHRSLNLNKIQNISIIFNAVRKENKGYGYYQDYYNDNNSKSISTLKRLFNI
>gnl|bykdb|A0A1Y3QTW7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes onderdonkii] (length=820 residues).
MTEYNNQQQHLQNDENENGSGLTLHDLLQMVLANWYWFALSVLICLGMAYYYLASTPKIYSRTATILVKDSRKGGDMELG
AFSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVRDGLRTLDLYGRSPIEVDFIDDDNQRLSLEVTELEDGR
IKLADFDDKYLTKQEKRRVIRGQYGDTIPTPLGQMVVHKTPFMDSTYVDRPITVTKSSPMVTTNAYRATVKSDVANKQAS
IVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKKSNQMIDITSEATR
SITESSKFKVEGLSIENQISVANYIRDYLNNPTHAGELIPMVASLTNNGIVAQITEYNDAILRRQKLLENSSERSPVIQD
MDNVLAAVRRSIIASLNSHVSTLEIQLTNMRKEEALANHRISTMPSQEKVLLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDQAYGSPRPVSPRSMIILGISLLAGLAIPFGIIYLIGMLDTTIRGRKDIEENISAPFLGDIPFLEGENKGG
IVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLAMAGKRIVLIDLDLRRHALSTT
LGRSNSKKGITSYLAGTITDIGELITPMEIHKNLDVICAGIQPPNPTEMLLSDRLDKLVAELRESYDYVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFRNMCVVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYDDYKETS
YRKRLKIFFSKIGRKIRNKK
>gnl|bykdb|A0A1Y3V692 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=810 residues).
MIEKKTAVGKPADDFIRIQDLWGMFVPRWHWFALSLFAALAVAAFYLLSTPNIYTRTAAILVKDDTKSGSSTTMSEFSDL
GIFKSNTNINNELLTLKSPTLMTEVVRRLGLNETYTVRKGLKDVGLYKSNPVAVSYRHQDETPVSFKIDFSSKEEFTISD
VMIDGEELETEFSGKMGDSIRMEVGTFVINPTKYWNDSFVGTSIRYNKGSVRAVTDYYATALRADLGNEDATIINLSIDD
VSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAEN
KKELLALNSQLSTAQYIRRELNNKELSQLLPTNSGIANVNIESQIGEYNTMVLDRNRLIANSSEKNPLAKDMANSLQSMQ
RTIIQSVDNLIVSLNTQIRSIRQQEAATTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRVI
TAPRGSMFPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLEDLSIPFIGEIPQYFSKERKQGFKRKKQSYM
KTIVVKEGSRDIINEAFRVLRSNMDFMAGKDKGQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGSVSS
YVDSPRIGLSDYLGNRVENWKEIIVADKKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVAD
AQIIEKLADRTIFVVRSGLLDRGMLPELENIYQEKRFRNLSVILNGTESAGGRYSYRYGYRGYRYGYHNGYSSYYGSKGE
MGGGKWLVIK
>gnl|bykdb|A0A1Y3VCJ1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. An66] (length=823 residues).
MAEIQFNTQTRDKIHDQTPAIDLHDIIRMVIANWYWFILSILVCVGAAYYYLAKTPKIYTRSATILIKDSRKGGDVELSA
FSDLSGYQSRKSIDNELFILQSRKLMTEVVRRLNLTVNYTVDGRFQDRDLYGQSPVEVVFVNDNDNLTLSLEVTPVDDQN
IRLSNFHDPFISKQESEDRVSARFGDTVASPIGQIIVRKTLYMEPSYRETPIRVSKGDLKTIANMYRGAVKCEVTNQQAS
VVTLSMNNAIPKRAEDVLNTLIEVYEQDAINDKRRVSVSTAEFIKSRLEVIGRELGEVDRDIENLKKDNRMVDISSEATR
SLTESSQYKAEGLSLDNQINIAEFVRGYLADPAKSGELIPAMAAISNGAVTAQIDEYNATILQREKLLDNSSPNNPVIRN
LDNLLASIRRAIIASLDSHIATLEIQRNAMRNEEESANRRISTMPSQEKIILGITRQQKIKEELFLYLLNKQEETQLNYA
IAESNSRTIDVADGSPVPVSPQPTLILGIALIVGVAIPFGLFFLIGMLDTTIHGRRDIENYLSAPFLGDIPYHEGASQDG
IAVRETGRDALSEAFRILRSNMSFMSVSAEKEMKTLLFTSSNPHAGKTFIAMNLAMTLAMAGKRVLLIDLDLRRHALSTL
MGHGKDKKGITGYLSGSIADFRELIAKTNFHENFDMIYAGVQPPNPTEMLLSEKLDKLIAKLRETYDYVFLDSTPSMSVA
DAVISDRLADLCIYVIRDGVLDRRQLPDIERLYQERKLHNMCIVLNGARIRRHGYGYGYGYGYGYGYGYGYGYGYGDEEY
HEESYRRRIRNFILSLTRRKEKH
>gnl|bykdb|A0A1Y3WE15 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella sp. An55] (length=807 residues).
MELIQETKNEKKNEGGITLRDIVELIFDNWYWIVLSVAVCVLVAWLYLAKQTPLYKRSAVMLVKAENKSNNDMSAIMELN
GGISGSGVDNEIYILQSRQLMREVVERLHLDVTYQVKDFLHNKQLYAESPIRVDFLDDYTAPVSMKIKPVDENRFLLKQL
SIGGGKKSESEQEIAFGDTLVTNAGRMVVTAVPEFLPNYYTLLIEVSRMDLNTAANIYHSLISAALAGERTTLVQINCID
SNTSRAEAILNTLIDVYRETIIEDKNRIATSTAQFINERVEIISRELGDVENELTNFKQQNRIVSIDAAASQFMSENSKM
RDELVQLETEYAIAQAVQRAFANEKGDKQLIPNVSGVGDAGLQKQIESYNEMLLQRERLAANSGENNPLVRDLDNNLASV
RVNLASSLSNYISTLKLKLEKARKVEAQTLDYIETVPQQEKQALGIIRQQNIKEALYTFLLNKREENAMQLAITEANIRV
IEAPFGSSAPVAPARRMFLMGALIIGLIIPLAIQLLRLMWNTSVRGRKDVEDYTSMPILGEIPAMKGKTDEQAIVVAENK
TSSVAESFRLLRSNMDFVAPKAQVIMFTSTIPGEGKSFVSRNFAVTLAMANKKVVLLDMDLRKRTLSKTLDLTTKNGVST
WLSGKNESVSELIQPSHVHDRFDMISAGIMPPNPSELLMSDRFPALIEELKKKYDYIILDCVPAMVVADAGIIGRVADLT
IYVIRTEVLDRRYLPELEKLYQDNKFKHLTVVLNGIEMESKKYGYGYGYGYGYGYGYGYGYGADHGRRKKRNVIYKWAHK
IVRMFRG
>gnl|bykdb|A0A1Y3WMT8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella sp. An55] (length=772 residues).
MEENYTSERRNDSVDVLALWRAARKRWYLFAGSVFICVVLVACYLKIAKPQYAISADILVNEDDKQGGGGALSSLVGDVT
GGGFSLDGMIGGGSVNDEILVISSHTIIREMVQRLELNKIYTSKKNFFNKVEYYGNSPITVDVPESMLDTLVSGFVVKVQ
TNKGSDKIKVLLKQGFFTTLAETEATSFPIRVDYGEGIVIDTTRYYNPDKKLRFVAHINGYDTQTELLEKRLEIDLSDKK
ANGISLKIKDSNRKRGQDILDTLIECYNEDAVLNKNLKAQNMLSFIDDRLATVENELHEAERVIEQYKRENDLSDIDTEA
KIILEANSEYRKLLLEAETQYSIISMVDSFMNSPENKYSLVPITTGLPDRGAAEAINEYNKLLLERMRLLRTAKDSNLSL
RTLTAQIDAMRDNILNTVSKAKESSEIARADLRKQEVDFRNRLRGFPEQERAYMDIKRNQMIKNELYTFLMKRREESAMT
LASTSPKCRIVNAAYSKNKPVAPQSLLLLAIAFGIGLILPVFYLYGKTIFSVKFASRNDLRRLTNLPIAGEIGHNALPDS
LVMKNNSHQPVAEMFRLLRSNLQFILPGSDTRVLLVTSSEPGEGKSFVSLNLAYAIAMTGKRTLLIDLDLRSPQIANYLG
LSSQTGFTNYLISKNGMDESSLILSQTESLDVITSGPVPPNPSELLLSSRLDDLIAGLRAKYDCIIVDTAPVERVSDTFS
LTRFADATLYVCRANYTPKNSVFNAMDYAAEGSLKNVIFVLNDTEIKHTYGY
>gnl|bykdb|A0A1Y3WWY9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. An54] (length=829 residues).
MIEQQPNNIPQQAFNDDQAGTINLHDIIRMILMNWYWFVLSVLVCLGVAYYYLAKTPKIYSRTATILVKDSRKGGAPELS
AFSDLASFQTQRSVDNEIYILQSRRLMSEVVRRLNLTEAYSIHEHLRDRDLYGQSPIDVDFINGDDNQSLSMTVTPRGEQ
QIEISQFQDGFVSKQESRSVVTAQYGDTIPTPIGEIVVHKTLYMNPKFNGVPIRVGKSSLKALTDTYRGAIKCDVAKQGS
VVTISMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLKKDNQMVDIASEATR
SVTESSQYKAEGLSLDNQINVAQFIRSYLSDPSKAGELIPAMASVTNAAVSAQIDEYNTSILQREKLLENSSENSPVIRD
LDNLLAAIRRTIIASLDSHISTLEIQRDAMRREEELANRRISTMPSQEKVILGITRQQKIKEELFLYLLNKQEENQLNYA
VAESNSRTIDTAYGSNAPISPRPMMILGIALVVGLAIPFGLLFLISMLDTTIRGRKDIEDHLSAPFLGDIPYHEGENQDG
VVVRETGRDAISEAFRILRSNMSFMSVSAGNEMRTILFTSSNPHAGKTFIAMNLTMTLAMAGKRVVLVDLDLRRHALSTL
MGHGKTRNGVTGYLAGSIADIDSIINKTSYHENFDVVYAGVQPPNPTEMLLSEKLDRLIGELRKKYDYVFIDSTPAMSVA
DAVITDRLSDLCIYIVREGVLDRRQLPDIERLYREKKLHNMCIVLNGARTRRHGYGYGYGYGYGYGYGYGYGYGYGDDYH
DESYRKRIKDFLLSLTRRHHKDHDHKHKH
>gnl|bykdb|A0A1Y3X4I9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. An51A] (length=799 residues).
MSTLSDKETELFLDELEKSSSSGINFKDLMYLCLAKWYWFVISLVVLLGFTALHLLTTPPVYTRSASLLIKEDSKGNSLS
NSAGVLGDLDLFQTNTNVNNEMQSLQSPAVMYDVVKRLHLNINYSTDGTFYKQVLYGQACPYEVEFFDLLDNEGASLTIL
PVSGNKGVELTDFVRGEEESGQAVKALFNDTVSTPVGRLLVKPMAGAETWKEAVYVSRSGLQSTAAAYSDKLNVALNDEK
STVINLSLEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDENISSYKSENLLPDVQAAA
SMYMTQSSETSSQILALNTQLAMTRYVRNYLTGGNSRNQLLPANSGIESSGIEKQIADYNALQLQRNNLVANSSESNPLV
VDLDQSLQNMRRAIISSIDNHITTLNTQLRALQQSERQTTARIAANPSQGKYLLSVERQQKVKEALYLFLLQKREENELS
QAFTAYNTRVIMPPTGSMVPTAPNKKKFLLIAFALGLFIPIGVIFAREQLNTKVRGRKDLESLSLPFAGEIPLAGGKKKG
DKEETAKTVLIQQGSRDIINEAFRVLRTNLEFMLDAGHTGKADVILFTSFNPGSGKTFLAINTAASFSLKGKKILVIDGD
LRRGSLSHYLRSHAKGLSDYLGKREENPQTLIQEMPGYPGLHILPVGTIPPNPTELLAEPRLSTLIERMRDEYDCIFIDC
PPIEIVADTQIIEKLADRTLFIVRAGLLERDMLPELQRAYQEKRFKNMAVILNGTEGGGNRYGYRYGYKYGYHYGYGKK
>gnl|bykdb|A0A1Y3ZDB3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=801 residues).
MAIQNNTKPGQADDFLRIQDLFYLCAAKWQWFVLSLLVAFGIGYYYLLKTPPVYTRTAELLVKREYRGRSISSDIEGFDN
FGLFRSATNVNNELVALQSPSVMTEVVKRLHLDMSYYAPGRFHDRLLYGMTLPFQANIAGIQENDFAGFTVNVYKDGRVQ
LSDFVLKGELLKEVKPVTGKFPGTLNTPLGKVTLEATSGYVRGTEYKVHVVRSGLYGAVGTCSSRLSVALNDEESTVLSL
SYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKSEHLLPDVQAASNLYMAQ
SSQTSSQILALSTQLSMVRYIRNYLATTAEQNQLLPANSGLENVGIEKQISEYNTLQLQRNNLVANSSEQNPLVMDLDQS
LATIRGAIISSIDNLEVTLNTRIRNLQRNEQQTTDRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIITPPMGSMVPTAPVRRNILLVAFALGLLIPAVIIFMRENMNTKIRGRKDLENLSLPFAGEIPLCGQKSRRAILTKK
VKEKNSVVVKEGKRDLINEAFRVLRTNVEFMSGEEKHSQILVVSSFNPGSGKTFLTMNLAASLSIKGKRILVIDGDLRHG
SASAYVGSPKTGLSDYLGERLEQLDEIIQPVPDYANLFILPVGTIPPNPTELLEKERFVTLMNSFRKEFDYILIDCPPVE
LVADTQIIESQADRMLFVVRTGLLERSMLNELEIFYKEKKFKNMALVLNGTEVNNRSYKYGYRYGYHYGYGCGYPYDSDK
R
>gnl|bykdb|A0A1Y3ZIA4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii] (length=789 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLQAVPVSGKEVMLS
GFTLGDQEVSDGKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVALRFQSGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKNSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKAMMILLASVVLGCAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKNEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKEKNMQVVMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLDIRKGTLSSHVQVSDM
GVTNYLSGRIDNVDEIIQKGELYDKLDIIHAGPVPPNPAELLLSDRLEALIAELRERYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYREGKLRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGQRKKK
>gnl|bykdb|A0A1Y4AAB8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. An31A] (length=841 residues).
MIEQTPNTQHAPQNETSEAGMFSLHDLIQMILANWYWFAISVIVCLGAGYLYLARTPKVYSRKATILVKDDRKGANMDIS
AFSDISGFQSRNSVDNEIYILQSRRLMQEVVRTLRLTTGYSKRSGLRTQDLYGRSPIEADFVDEGENQSFSFRARPLAGG
EQVELTDFDDGYISDEERGRVVTAAYGDTVSTPLGRMIIRKTLYLSPADEGTAIQVAKSSLEAATSAYRAAVKCAVEDKQ
TSVVGIAMNDAVPKRAEDVINTLITVYNNDAIADKRRISEETADFIHSRLEIIGSELNDVDRDIENFKRDNRMVDLASEA
TRNVEESSQFKAEGLSLENQINVAEFIRSYLLDREHAGDLIPAMAAIANSGITEQISAYNEGILRREKLSENSSANNPVM
QELDNNLAAVRRSIIASLDSHIRALEIQRNALRSEEEQANRRISTVPSQEKEMLGIARQQKIKEELYLYLLNKQEETQLN
LAVAESNARVIDLAYGSGAPIAPKSSMILGIALIVGLAIPFGLLFLLSMLDTTIRGRRDIEENLSAPFLGDVPLYEGETT
KGIVAVREAGRDALSEAFRMLRSNMNFMNVSSQSRLQCVLFTSSNPHAGKTFVAVNLAVTLAMAGKKVVLLDLDLRRHAL
SSEFGHGKDSRGITAYLSGSITDAGQIISRSGIHDNLDVVYAGIQPPNPAEMLLSDRLDTLIAELRTRYDYIFIDSTPAM
SVADAISTDRLCDLCIYIIREGVLDRRQLPDIERLYREKKLRNMCIVLNGARSRRHGYGYGYGYGYGYGYGYGYTYGYGY
GDDYQETSYRKRILNFLRRLLTRSGEEQSHRHHHHRKHDRA
>gnl|bykdb|A0A1Y4AIY1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. An322] (length=794 residues).
MKVENPSNGPRWNEANSGVTLGDIFQIVKAKWYWFALSIGICLGIAYIYLLQAPKVYTRSASVLIKEDRRSSRSMSAYGF
SDLNNMLGIQRNVDNEVIVFKTYRLMEKVARRLHLDVSYTEKRGLRTVELYRQSPVILSFPDASETQSFSLTAIPLSKEK
VRLFDFVTVNEAGEPVEIKNPQEVVLNDTVTTPVGRIVVQPSLYYTDTYYNKEVHVRKSNLKGIATGYQNALVSELVAEY
ATIIKLSLSDVSASRAEDVLNTLIAVYNEDAIEDKNRITVSTSEFIAERLVIIEQELGSVDTDIETFKREHQLTDITSET
GMYLQNTSQYRKEGLSLENQLSVAQYIRDYLSDPQKALDLIPANTITDVTVEQQIAAYNEMLLKRDNLIRNSSNKNPVVM
DLNNSLSAMKQTIIRSVDNLIAGLNISIRNVQAQEEQLQKRIAAVPSQQKYVLTVERQQKIKEELYLYLLNKREENALSQ
AMTESNTRILDAAHGSNAPVAPRSRSVILVAFVLGACIPGGILWLLFTMDTKVHTRKDVLDATTIPFLGEVPIQSKKEKE
KLVVRSGSHDAVSEAFRIIRTNMDFMRVKDQQDMKVVIFTSLNAGAGKTYISSNLAVSLVLTQKKVVLVDLDIRKSGFGR
HTQHGQKGVTNYLADKDLSVDEVITKDSLTEGLDLVYSGPIPPNPAELLLSNRLDQLIAELRKRYDYIIVDNVPAGIVAD
ASIVNRIADLTICIVRAGAMDRRQLPELERMYTNGMFTNMAVILNYVNLHRGSYGYSYGYGYGYGNENKKEKKQ
>gnl|bykdb|A0A1Y4CHN5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculum sp. An287] (length=810 residues).
MADNISANNQVKQSEDFISIQDFLYMCLSKWYWFAISLVVLIALALIYIMRTPPEYTRSASMLIKEEGKGQSISSDVSSA
FASMGLVQSNTNVNNEVIALQSPAIMTDVVKRLHLDVNYKVDGRFYDRVLYGQNLPVSVSFLDLNDNESASFTIKPAADG
TLGFSDFVRNGEESDAEATGKLNDTIETPVGRIVVSTTPYYSGTFDSDVYVSRSTIYGAVQSYSQRLSVGLANEDATIIN
LSITDVCIQRAEDVLNTLIAVYNENWLKDKNQIAVSTSMFINDRLKVIENELGTVDADIASYKGENLLPDIQAASSMYMS
QSQETNAQILELSMQLSMAKYIKSYLAAGESQNQLLPANSGISGGNIENQISEYNTAQLQRNNLVANSSDENPLVKDMDN
ALKSMREAIITSIDNLVVTLNTQIETLEQTNEQIMAKIAASPSQAKDLLSDERQQKVKEALYLFLLEKREENELSQAFTA
YNTRIITPPTGSMLPTAPVKRNIFLIAIALGVLIPIAVIFIKEMFNTAIRGRKDIEGMNVPFLGEIPLIGKKKRFSRLAG
MRQRKKKYEKEVPEIVVRAQSRDVINEAFRVVRTNLEFVIGKEEGPKVIMVTSMNPDSGKTFVISNLAASFAIKKKKTVI
VDLDLRKATLSSYVGNIKTGVSNYLADKDVSLFSIIFKDKSILDLDIIPVGTIPPNPAELLFSERLGQLLSELKQKYDYI
FIDCPPVEVVADTSIIGRHADYTLFVARAGLLDKRMLPQINGFYADNKFKGMLLVLNGTEVAQGRYGYRKYGYSYGYNYG
YGSYEGYVQK
>gnl|bykdb|A0A1Y4D5Z0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. An277] (length=796 residues).
MIDNRENTQRDYAQENENTLNLWDLLQILKANWYWFVLSVVACLGLAYLYLKQAPLVYTRSASVLIKEENRWGRSRSLYG
FSDLDMLSLQRNVDNEVIVFKTYRLMETVARRLHLDISYTVKQGLRTVELYRESPVVLSFPEAGEGQSFSLTVTPMSDKE
VVLSKFITRNEEGKLVEIEKAQRVALNDTVTTPVGKLVVVPSLYYTDLCYGKSITVRKSNLSNVARAYLNKLQSTVASKT
ATIINLSLSDVSISRAEDVLNTLIAVYNEAAIDDKNKVTISTSDFIADRLVIIEQELGDVDANIEAFKRENQLTDISSET
GMYLQNTSKYKQEGLSLENQLAMAKYVREYLSDPHKASDLLPANTLSDVNIEQQIAEYNTQLLKRDRLISNSSNKNPVVM
DLNNSLNALKQTIIRSVDNLIVGLNINIENVRAQEAQMERRISAVPGQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNMRVLDSATGSRVPVSPKASMILLAALVMGCAIPAGILWLLWSLDTKVRTRKDIQHATSIPFLGEVPAQERKKGK
EQLVVRSGSRDAVSEAFRILRTNMDFMRVNAPDMKVIMFTSLNEGAGKTYISSNLAASLVLMKKRVVLLDLDIRKGTLSG
HGEAHGAGITNYLSDKNTLDEIIRKDALMEGLDMIYAGPVPPNPSELLLSERLDILMASLRERYDYVIIDNVPYGMVADA
SIVGRVADLTICVVRAGVLDRRQLPDLEHLYRTGPFKNLAVVLNYVEHKRVGYGYGYGYGYGYGYGYGYGNTSKKK
>gnl|bykdb|A0A1Y4DYA7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. An279] (length=798 residues).
MNENNTKSDLFLQESLNLKDLLFSLLKKWYWFVISILISITIAIFYIMCTPPIYTRSASLLIKEDNKSNSPSGNAGVLYD
LDLFQTGTNVNNEIQSLQSPAVMYDVVKRLHLNINYYTKGVFYNHILYGQNCPYEVEFFDLQDNDVASFTIFPVSGNKGV
ELTDFIHGGEESDKRIVVEFNDTISTPVGRLLIKPTHGIKDFKETVYISHSGLQATTSVYSGKLTVALKDEKSTVINLSI
EDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLEVIEQELGHVDENISSYKSENLLPDVQAAANMYMTQSN
ATNSQILVLNTQLAMTRYVRNYLTNNNNKNQLLPANSGIESSGIENQILDYNTLQLQRNNLVANSSVNNPLVADMDQSLQ
NMRNAIISSIDNHITTLNTQIKALQQSERQTTARIAANPTQGKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNT
RIIMPPSGSMYPTSPNKKKIIMVAFVLGLILPACIIFAQKQLYTKVRGRKDLEFLSLPFVGEIPLAYKKKNSQESGKEES
HFTILIKQGSRDVLNEAFRVLRTNIEFILNANNTGMADVVIVTSFNPGSGKTFVTINIAASLSLKGKKVLVIDGDLRRGT
LSHYLRSHTKGLSDYLGKREDNPQTLIQDVPNYPGLSILPVGTIPPNPTELLAESRFSEFIEKVRVEYDCIFIDCPPIDI
VADTQIIGQYADRTLFVIRAGLLEREMLPELQRAYDDKKFKNMAVILNGTDRGSGRYGYKYAYHYGYGNENYLAKDKN
>gnl|bykdb|A0A1Y4FNK8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. An269] (length=798 residues).
MATQNNPARPKQADDLIRIQDLFYLCLNKWYWFVISLAVTIGVAVVYLLTTPPVYTRSASLLIKEDSKGNSMSDAAGVLG
DMNLFQTSTNVNNEIQSLQSPSVMLDVVKRLHLDINYYTDGGFYKKVLYGGTCPYSVSFNDLQDNESVSFTVNPSSIGQV
KLTDFVHNGEDVDGEVTATLNDTADTPIGKLSIKAMNDTVTYQEPVYVTRISYQAATSAYASNLSVALNDEKSTVVNLTF
TDVCTQRAEDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNVDENISSYKSEHLLPDVQAAASMYMAQSS
ETNAQILALNTQLSMARYIRNYLTNATSKNQLLPANSGIESPGIEQQIANYNTAQLRRNDLVANSSEKNPLVIDMDQSLE
NMRHAIVTSIDNHITTLNTQLRSLRQSEQQTTARIAANPTQGKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYNT
RVITPPSGSMIPTAPVKKNIALVAIVLGLLIPVVIVFIRENMNTKVRGRKDLESLSLPFAGEIPLAVSGKGKKKVHNAKK
IVIRQGNRDIVNEAFRVLRTNLEFMLDAKTDGKASVTLFTSFNPGSGKTFLTMNTAATFALKGKRVLVIDGDLRRGSASA
YLGSHYKGLSDYLGKRENGLDGLIQENPDIPGFFLLPAGTIPPNPTELLAEPLFKEIIEQLRGHYDYIFIDCPPIDIVAD
TQIIEKLTDRTIFVVRAGLLERDMLPELQRMYDEKRFKNMALLLNGTEGGGNRYGYRYGYKYGYKYGYGSKSYYGSTK
>gnl|bykdb|A0A1Y4GLF5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella sp. An22] (length=801 residues).
MAINKDTTKNKQTDDFLRIQDLFYLCLAKWKWFVISLVVTCGIAVLYLLRTPSVYTRTASVLIKEDSKGNSISSGMETFS
EFGLFQSSTNVNNELLAFQSPAVMTEVVKRLQLGTTYYLPGKFHRVVAYGKNLPVTVTLCDLPEDETGSFTVEIRPGRSF
GLSDFTRNGDDMKSDKITGTLADTIATPLGRMVVNATANYVDAPCTLYVDRSTLYSAVNAYSANLSVSLNNEKASVIDLS
FKDLSTQRAEDVLNTLISVYNENWVKDKNQVAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASNMYMMQS
SETNSQILALNNQLYMARYIRNYLANDANKSQLLPANSGIDNGNIESQISEYNRQLLQRNNLVANSSTDNPLVVDMDQAL
KSMRKAIIGSIDNQIETLNAQIKSLQYSEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAYN
TRIVTPPHGSLNPTAPIKKNILLVAFAVGLLIPIIIVFMRETMNTRVRGRKDLESLSIPFIGEIPLCVHKKKGWFKRTVS
RPKSVVVKEGSRDIINEAFRVLRTNLEFMTGSDKNRNVIILTSFNPGSGKSFLTMNIAVSLAIKDKRVLVIDGDLRHGST
SAYVNSPKLGLSDYLGGRVSQLSAIIVNDTKYKNLDILPVGTIPPNPTELLFNERLKQVIDSVRSQYDYVFIDCPPIELV
ADTQIIEKLADRTIFVVRAGLLERSMLAELETLYDEQKLKNMALILNGTESNTNKYGYRYGYRYGYHYGYGYGYHYGSDE
E
>gnl|bykdb|A0A1Y4GQU1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella sp. An22] (length=781 residues).
MEENYTSERRNDSVDVVALWRAICRKWYLFVGSVVVCVALVACYLKIAKPQYEVLADILVNEDEKKGSSGSLSSLMSGVS
GGGFSLDGMIGGGSVNDEILVISSHTIIREMVQRLELNKVYTSKKNFFSKKEYYGNSPITVDVPESMLDTLVSGFVVKVQ
TDKSSDKIKVVLKRGFFETLAETEATSFPIKVDYGEGIVIDKTSYYKPGEKLRFVAHINGYDVQTELLSKRLEIDLSDKK
ANGISLKIEDSNRRRGQDILDTLIECYNEDAVLNKNLKAENMLAFIDDRLITVENELHEAERVIEQYKRENDLSDINSEA
KIILEANSQYRKLLLEAETQYSIISMVDSFLNRPENKYSLVPVTTGLPDKGAAEAINEYNKLLLERMRLLRTAKDSNLSL
LTLTAQIDAMRENILNTVSKAKESSDIARADLKKQEAEFKNRLRGFPEQERAYLDIKRNQMIKNELYTFLMKRREENAMT
LASTSPKCRIVNAAYSKSKPVSPQSLLLLAIAFGVGLVLPVIYLYGKSIFNVKFATRNDLRRLTNLPVAGEIGHNLSTDY
VVMKGHSNSPVAEMFRLLRSNLQFILPGNEKRVLLVTSSEPGEGKSFVSLNLAYAIAMTGKRTVLVDLDLRSPQIANYLG
LSSTSGLTSYLIAKNGMDESSLIQSPVESLDVITAGPVPPNPSELLLSSKLDRLMNDLRERYDYVIIDTAPVERVSDTFS
LTRFADATLYVCRANHTPKNSVFNAMDFAAEGSLKNVIFVLNDTEVTHTYGYSEEKHTRRV
>gnl|bykdb|A0A1Y4GUK3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella sp. An22] (length=805 residues).
MELIQENKNEKKNEGGITLRDIVELIFDNWYWIVLSVAVCVSVAWFYLAMQTPLYKRSAVMLVKAENKSNNDMSALLELN
GGISGSGVENEIYILQSRQLMREVVERLNLDVTYQVKDFLHNKQLYAESPLRAHFLDAYTLPVSMKVSPIDENHYALKEL
NVGGKKTNEGNQQIAFGDTLVSDAGRIVVESVPEFLPAYYNVPVEVSRMDLNTAADIYHSLISAALAGERTTLVQINCVD
SNISRAEAILMALIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFKQKNRIVSIDASANQFMSENSQM
RTELVQLETEYAIAQAVHRAFTNDKDNKQLIPNVSGVGDAGLQSQIEAYNEMLLQRERLAANSGENNPLVRDLDKNLASV
RINLASSLSNYISTLKLKLEKARKVEEQTLNYIESVPQQEKQALGIMRQQNIKEALYTFLLNKREENAMQLAITEANIRV
IETPFGSSAPVAPARRMFLMGAFIIGLIIPLAIQLLRLMWNTSVRGRKDVEDYTSMPILGEIPSMKEEKGERAIVVAENK
TSSVAESFRLLRSNMDFVAPKARVIMFTSTIPGEGKSFVSRNFAVTLAMTNKKVILLDMDLRKRTLSKTLDLTTKNGVST
WLSGKNNNVAELIQPSNIHKQFDMISAGIMPPNPSELLMSDRFPALIEELKKLYDYVILDCVPAMVVADAGIIGRVADLT
IYVIRSGVLDRRYLPELEKLYQDNKFKNLTVVLNGIEMESKKYGYGYGYGYGYGYGYSYGADQGRKKKRNVVYKWAHKIA
RIFRG
>gnl|bykdb|A0A1Y4IH41 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=801 residues).
MAIQNNTKPGEADDFLSIQDLFYLCAAKWQWFVLSLLVAFGIGYYYLLKTPPVYTRTAELLVKREYRGRSISSDIEGFDN
FGLFRSATNVNNELVALQSPAVMTEVVKRLHLDMSYYAPGRFHDRLLYGMTLPFQANIAGIQENDFAGFTVNVYKDGRVQ
LSDFVLKGELLKEVKPVTGKFPGTLNTPLGKVTLEATSGYVRGTEYKVHVVRSGLYGAVGTCSSRLSVALNDEESTVLSL
SYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKSEHLLPDVQAASNLYMAQ
SSQTSSQILALSTQLSMVRYIRNYLATTAEQNQLLPANSGLENVGIEKQISEYNTLQLQRNNLVANSSEQNPLVMDLDQS
LATIRGAIISSIDNLEVTLNTRIRNLQRNEQQTTDRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIITPPMGSMVPTAPVRRNILLVAFALGLLIPAVIIFMRENMNTKIRGRKDLENLSLPFAGEIPLCGQKSRRAILTKK
VKEKNSVVVKEGKRDLINEAFRVLRTNVEFMSGEEKHSQILVVSSFNPGSGKTFLTMNLAASLSIKGKRILVIDGDLRHG
SASAYVGSPKTGLSDYLGERLEQLDEIIQPVPDYANLFILPVGTIPPNPTELLEKERFVTLMNSFRKEFDYILIDCPPVE
LVADTQIIESQADRMLFVVRTGLLERSMLNELEIFYKEKKFKNMALVLNGTEVNNRSYKYGYRYGYHYGYSYGYPYDSDK
R
>gnl|bykdb|A0A1Y4JYM9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides clarus] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A1Y4JYS9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides clarus] (length=808 residues).
MGKDRFEDLDFIDFNDSRQQESTVIADMLSAVYRNRKWFILSVVVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLNVSYKEWDGLRKKELYTSTPFTVNFLDADPAQKISLTVTMTDN
GKVTLTDMVLQNELEEEEFDESLTVQPGDTVNTPVGKIAVQPTLFTNESYIGKSVYVAKGNLKEVAEEYNKALNAGVTNK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKKKNKLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTDPIPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSEGNPL
VRDLNGTLMSMRLSIAKAVDNLIANLEIQAANMKNKERENSDKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDSAEGVDLPVAPKKAQVILISLLAGIMLPALWIYIRSLLNTSVHTKKELKTGVSIPFLGEVPLEKSKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTAGKVVLVTSANPDSGKTFITLNLAMSMALANVRVVILDLDLRKGSL
SKCVGIGMKKIGISNYLSGKVDDVKELVQVCGEDSRLHIITSGALPPNPAELLKSGRLDRLIEELKKNYDYILLDNPPYG
IVADTQLCGRLADQTIYVVRSGLFDKRMLPELQELYDSGKMKNMSLLLNGIDYVKTGYGYGYGYGYGNYGNDEERKNKKP
LYKRIFGI
>gnl|bykdb|A0A1Y4PQK7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei] (length=801 residues).
MTIQNNTKPGQADDFLRIQDLFYLCAAKWKWFVLSLLVAFGIGYYYLLKTPPVYTRTAELLVKREYRGRSIASDIEGFDN
FGLFRSATNVNNELIALQSPSVMTEVVKRLHLDMSYYAPGRFHDRLLYGMALPFQANITGLQENESVGFTVNVYKDGHVQ
LSDFVLKGESLKEVKPVTGKFPCTLNTPLGKVTLETTSGYVRGTEYKVRVVRSGLYGAVRTCSSRLSVALNDEESTVLSL
SYRDVSPARAEDILNTVISVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKSEHLLPDVQTASNLYMAQ
NSQISSQILALNTQLSLVRYIRNYLATTAGQNQLLPANSGLENVGIEKQISEYNTLQLQRNNLVANSSEQNPLVMDIDQS
LATIREAIISSINNLEVTLNTRIRDLQRSEQQTAGRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRVITPPTGSMVPTAPIHRNILLVALALGLLIPVVIIVMRENMNTKIRGRKDLENLSLPFAGEIPLCEQKSRRGILVKK
VKEKNSILVKEGKRDLINEAFRVLRTNVEFMTGEKKHSQVLVVSSFNPDSGKTFLTMNLAASLAIKGKRILVIDGDLRHG
STSAYVGSPKKGLSDYLGERLEQLDEIIQPVPDYANLFILPTGTIPPNPTELLATERFVTVINSFRKEFDYILIDCPPVE
LVADTQIIELQADRMLFVVRTGLLERSMLNELEIFYKEKKFKNMALVLNGTEVNSGSYKYGYRYGYHYGYGYGYPYNSDR
R
>gnl|bykdb|A0A1Y4U5L4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. An116] (length=827 residues).
MIEQQPNNIPQQAFNDDQAGAINLHDIIRMILMNWYWFVLSVLVCLGVAYYYLAKTPKIYSRTATILVKDSRKGGAPELS
AFSDLASFQTQRSVDNEIYILQSRRLMSEVVRRLNLTEAYSIHEHLRDRDLYGQSPIDVDFINGDDNQTLSMTITPRGEQ
QIEISQFQDGFVSKQESRSVVTAQYGDTIPTPIGEIVVHKTLYMNPEFNGVPIRVGKSSLKALTDAYRGAIKCDVAKQGS
VVTISMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIENLKKDNQMVDIASEATR
SVTESSQYKAEGLSLDNQINVAQFIRSYLSDPSKAGELIPAMASVTNAAVSAQIDEYNTAILQREKLLENSSENSPVIRD
LDNLLAAIRRTIIASLDSHISTLEIQRDAMRREEELANRRISTMPSQEKVILGITRQQKIKEELFLYLLNKQEENQLNYA
VAESNSRTIDAAYGSNAPISPRPMMILGIAVVIGLAIPFGLLFLLSMLDTTIRGRKDIEDHLSAPFLGDIPYHEGESQDG
VVVRETGRDAISEAFRILRSNMSFMSVSAGNEMRSILFTSSNPHAGKTFIAMNLTMTLAMAGKRVVLVDLDLRRHTLSTL
MGHGKTRNGVTGYLAGSIADIDSIINKTSYHENFDVVYAGVQPPNPTEMLLSEKLDRLIGELRRKYDYVFIDSTPAMSVA
DAVITDRLSDLCIYIVREGVLDRRQLPDIERLYREKKLHNMCIVLNGARTRRHGYGYGYGYGYGYGYGYGYGYGDDYHDE
SYRKRIKDFLLSLTRRHHKDHDHKHKH
>gnl|bykdb|A0A212GC82 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis SJD12] (length=821 residues).
MNLIEDSKNTLAESRSRIYTKEETSFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL
ADKNATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKSNNITDI
STDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSES
NPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKREE
NALRLAITESNAKIVDAADGPSAPIAPRKPLIFMAAFLLGLVLSSTFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYSG
ERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAITIALTSKKVIVVDLDIR
KGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSVP
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYDKQGK
KLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|A0A212K7W5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][uncultured Dysgonomonas sp] (length=790 residues).
MKRNTEEDFIQIQDLWKMSVEKWHWFAISLTICLIFAFLYIAITSPVYTRMAAVLIKDNSAKGGMLSDNINTFSDMGLFK
SNTNINNEILTFKSPLLMQEVVQRMKLDEDYSTKGFFRNKPLYKNSPVIVSIDSTNVNESFSFYIELLPQNKIRLANLTL
NGEELDFPDEEINLSESVNTPLGSIRINPTAFYSKVYYNQQILFVKSNLRSIVNHYTNALNVGLSNEDATIIDISLNDVS
AQRAEDILDTLITVYNKNWIQERTQIAVNTSSFIEERLNVIEKELGGVEDSISRFKSQNLIPDIQAASNMYMARSNENDT
KIQALSTQHTIAKYILSHLKDSRTKDMLLPANLGIEGTNIDRQINEYNTLLLKRNTLLANSSDNNPLVLDIKQSLLFVRE
AIISSVDNLLISLDTQIRNIQKSETKINERIASSPEQAKYLLSVERQQAVKEALYLFLLQKQEENQLSQTFTVYNTKIIT
PPSGNMFPTTPRKTSILLVAAAIGFLLPAIIIIIVENMTITLRGRKDLSSLSLPFIGEIPQIINGKKKLLLKNRSTKNRD
DIIVKEGKKDYMNEAFRVIRTNLDFILSTNGEAQQKVIMFTSFNIGSGKTFTTINLAISMAIKGKKVVVIDLDMRKASLS
SYIDSPSAGISNYLGKMIDNPDQIIRKGAIHPNLDIIPAGTIPPNPVELLLDDRLQQLLDELREKYDYIFLDCPPVEIVT
DASIVGKVTDITIFVVRAGLMDRRMLPEIEEMYQKDQYNNMTLLLNGTQYMRGKYGYNRYGYTHADNYLA
>gnl|bykdb|A0A212UCJ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter gelipurpurascens] (length=816 residues).
MAVNEDIELEELIRGAGGDAEEDQGGGLDLTTLLMVARKSLPWVLLLISLGLLASWLFLRYTSPVYQSSSTLKIDEKTEA
GVLGLEGLGKMVEQKQTMTQLSGEIELIKSDLIYRRLRDSLDLEVNYYAEGTVLETELYRASPFKVEYQTKGGGQYNTKF
GLRFLTPQQIELTYQENGQEVIQKAILGNQIETLGFWFRIYPTSLFRPSDTERNFYFVIRDEGFINQYLSSNLQVQIINP
DANTISISFTDNNSLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLADQSNDNRQLLRQAEEQLQEFMKQNRLFDAETE
LGSLTTILTTQQEERQKLQEQLTLLRSLNSQIAQNRIVASEERSAEQSIPALAELKAPELAARIGELYDLQLQINRVSNS
YTPETQTIKNLQGQITFTKQNINQLLRQNEQLLQRQLNEMDNKANSLQGRLAELPELKTQIERLKRPRELYEKYSLLMMD
KTLEYNIARAGITADFQVLSPANLPSLPISPIKLMAYAIGLASGLVLGIGLIAVRYLLHNTVTSVGELERNTLSSVLGVI
PTYDREKMSVSKLVVDKNPKSAISEAIRSIRTNLEFMASSKRKRMISVTSTISGEGKTFVTVNLAGIIAASDQRVVILDL
DMRKPKVNLAFDAENIKGVSTILIEKHTWQECIQHTTIPTLDFISAGPTPPNPSELILSPKFDEMLEHLYQSYDVIIIDT
PPVGLVTDGILIMRKADVPIYIVRANYSKKAFLKNINKLVRTNGFTKLTTILNDAKAGGMQGYGYGYGYGYGYGQGYYEE
PQPQSGVVNRLRKRFS
>gnl|bykdb|A0A238WIA7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter mucosus] (length=816 residues).
MAVNEEVELEDLVRNAGGEADEDDGGGLDLTTLIMVARKSLPWVLLLVMLGLLTSWLFLRYTRPVYQSSSVLKIDEKTEA
GVLGLEGLGKMVEQKQTVTQLSGEMELINSDLIYRRLRDSLELEVAYYAEGTVLETELYKTSPFKVEYESKNGSLFNTRF
NLKFLSPNRVQLTYLEGGQEVVKETGFDAPVETTGFRLRLYRTAFYQPSDLERNLFFIIHDEGTINGYLSQNLQVQVVNP
DANTISIGFTDYNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQDFMKRNNLFDAESE
LGTVTSAITTQQEERQELQEQINLLRNLSNQIESNQFVAREDVSAEQSIPALAEIKAPELTERIGELYGLQLDLNRASVG
YKPTTTAIQVIQDQIAFTKRSIRQLLVQNQQLLQRQLAEMDAKQGALQGRLQELPELKTQIERLKRPRELYEKYSLLMMD
KTLEYNIARAGITADFQVLSPATLPSAPISPVRLMVYAIGLAAGLVLGIGLIAVRYLLHNTVTNVGELERNTSVPVLGVI
PTYDKEKMAVSKLVVDRNPKAAISEAIRSIRTNLEFIASSKKKRLISVTSTISGEGKTFVTVNLAGIIAASDQKVVILDL
DMRKPKVNLAFGAENVKGVSTILIERHTWQECIQHTAIPLLDFISAGPTPPNPSELILSPRFDEMLASLFQTYDVVMIDT
PPVGLVTDGILIMRKADVPIYIVRANYSKKSFLKNISKLVRSNGFTKLTTILNDAKAGGAYGYGYGYGYGYGYGQGYYEE
TKPTRGVLNKLRKRFS
>gnl|bykdb|A0A243WAB1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. MIMBbqt21] (length=780 residues).
MNTRELFPLNSEQVEEKDIKRMVGQYIRYWYLFLLGGMIGLGITYFYLRYYAVPQYHVYSTLLVKDDKSGQSVSNAEALS
DLTMLKSARNIDNEIEVLRSESLMEKVVSELNLVANYYVEGKFVNREIYGRELPAKLLIDKLDSTAIGKSITLHLHPDNS
FQLEDYDGTVTSHSFGQQIAKPYGLFTIIAASGGNTADRKVIVSFQDIHQVADHYNKAIAVQPVGKSASVLSLSLVDPIP
EKAKDILDKLMEVYNDEAVVDKNLMATSTLKFLDERLKYITAELSGVEKGVEKYKSVNGLTDISTQASDYTAQASDYNKQ
LSEWGIQIDVLESIENYLKRTNGQYSMVPSTLGIKDETLLGLIGKFNELQLERERTLRTTQPSSLLVQNLNEQLANLRIN
ILENLRNIKKGLQITSNNLRSTSGQFQSKIKRVPEMERQLLEINRQQSIKQNIYVYLLQKREETALTLAATASAARVIDH
ARGGGFPISPNKQTLYLMALLLGLGIPFAGVYISTLLNNKVQTQYDITKVVNAQIIGEIAHNKKGETLVVTKSNRTPIAE
MFKLVRANLHFAALGKKNIVMMVTSSMSGEGKTFFSINLGASLALTGKRVVLLDLDLRDPKVATELNLPESLGITDYLVS
SDVSIHDIVKPSEAVSDLFIVNSGPIPPNPIELIMSSKFSHLIQELKENFDYIIIDTPPVGQVADAFALRSFIDFTIYLV
RYNYTYKAQLNIIKNICKENTLSKPMIVINDAKEANGNNYGYGYGYGYGKKYVKKKKALL
>gnl|bykdb|A0A243WHR7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. MIMBbqt21] (length=816 residues).
MAVNENAELEELIRNAGGNEAEVEDDEGAGLDLVTLLLVARRSLIWVVLLIVLGLTGSWLYLRYTKPVYQSLSILKIDEK
TEAGALGLGGALTGDIRQSGNKLSGEIELIKSNIIYEHLKDSLALDVNYYVEGTVLENELYGLSPFKVNYKIKDGSLYNT
RFDLTFSNPQQFRLSYQYKGQEISAEYRFGQPIVTPAMELVLASTPWMNESVVGKKYFFVINDDGTISNYLNKGLNVQVV
NPDANTIQISFTDFNPSKAQAIVNKIDTVYLQEKLAQKQEVTQRQLKFLETQIVENKDSLQGAEKNLEKFTDRTKTYDVR
GDLASISDKLLEQEKERLQLQQQIDLLDEIVALVESNQLTNSEEASISESIPGLKQLGDEQVTQQINRLNDLQWNLRRIL
RSYQPTTFTVQQLQADVNLVKKSTQRLLQQNRRLLAQQLSEKSAEQNELKNKLQQIPELATQQTRLQRPFELYQKTYTRL
VEKKIDFGIAIAGTTVDFQILSPASNPGAPIAPVRMVVYAIGLAVGIVLGLGLIAIRYLMHNTVTNVRELERATTASVLG
VIPTYEKEKMSVSKLVVDKSPKSAISESIRSIRTNLDFISSAKKKRLISVTSTISGEGKTFVTVNLGGIIALSGQRVIIL
DLDMRKPKVNLAFSAENIKGVSTILIDKHTVQECVQHTSIPALDFISAGPTPPNPSELILNARFDEMIAELYQQYDVILI
DTPPVGLVTDGILIMRKADIPIYIVRANYSKKVFLKNINKIIRANNFTRLSTILNDARSSGLYGYGYGYGYGYGQGYYDE
AKPDKSLVQRLRKQFS
>gnl|bykdb|A0A246FQC0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter amundsenii] (length=818 residues).
MATKEDAELEELIRNAGGEEVEEDDGGGLDLTTLLMVVRKSLPWMVLLIALGLTASWLFLRYTPPLYKSTSALKIDEKSE
AGVLGLGALGGAIDQKKNLNSLSGEIEVIKSDIIYQRLKDSLDLDVNYYVQGTVLESELYASSPFIVKYKPINNAVFDLK
IGINLLSATTFQLILPDGLGGGEQEYRFDEPFTAAGFRLVISKAANYNESVLEEQYSFRINSNSALNEYFDTNLLVDIVN
LDANTISISFTDHNPAKAQAIVNGIDSVYLVEKLVRKQEQATRAMGYINDQLGDNNQKLNQAEEAMQSFVKRTGSYDVKG
DVGQITGLLMELEEERTKLQQQADMMNDVARLVEQDRLTVRPDGDVMQSIPALAEVKDGQLVQRITELSDAQLDLKRALL
SYQPGATLAMQTKEQNIADLKKIVRQLLRKNQQLIQEQIAKLSGKRAELDTKLQQLPDKYTEQARLQRPLELYEKYNLLM
MDKQMEFGISMAGATADFQILSPASPAVPISPVKLIVYAIGLAAGILLGLGLVAVRYLLHNTVTNIRELERNTHASVLGV
IPTYDKEKMAVSKLVVDRNPKSALSEAIRSIRTNLEFMATSKKKRLISITSTISGEGKTFVAVNLAGIIAASDQKVVILD
LDMRKPKVNLAFDADNTKGISTILIEKHTWQECLQHTSLPTLDFISAGPTPPNPSELILTPNFDILIAELHQYYDVIIID
TPPVGLVTDGILIMRKADVPIYIVRANYSKKTFLKNINKLMRTNGFTKLTTILNDAKTTGGYGYGYGYGYGYGYGQGYYD
EEQKPEGGLLSRLRKRVS
>gnl|bykdb|A0A254MU12 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis] (length=821 residues).
MNLIEDSKNTLAESRSRIYTKEETSFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL
ADKNATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKSNNITDI
STDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSES
NPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKREE
NALRLAITESNAKIVDAADGPSAPIAPRKPLIFMAAFLLGLVLPSTFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYSG
ERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSHDLKAVMFTSANPESGKSFMTVNLAISIALTGKKVIVVDLDIR
KGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSVP
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQGK
KLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|A0A255RCT5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. P5-126] (length=808 residues).
MATIQKKTQVQNTQDFIRIQDLLYMCLAKWYWFVLSLAVCLGVAIAYLLRTPPVYTRSASILIKDDSKGKSASTDMESFV
DFGIFTTNTNVNNEMGTLQSPDLMREVVRRLHLDMNYLVDGRFHKVTIYGDQLPVAVSFADFPDNQSASFRLHLGTNGRY
TLYELTRNGEHVGGEVKGKLGDTVQSPFGKMSVTATAHYRKGQEADVEVLRSTLKEAVAGASSRLTVSQDDEKSNIISLS
FQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISSYKSQHLLPDVQAAANMYMAQA
SEANAAIKSLNNQTYMARYIRNYLTSETNRFQLLPANSGIDNANIGSQITEYNNQLLERNNLVSKSSDKNPLVVEMDASL
ASMRKALVSSIDNQVVALEAQIRSQQSYGGQATSQIASNPKQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAYN
TRIISQPDGSMLPTAPIKKNILLVAFALGLLIPVVIIVIRENTNTVVRGRKDLECLTVPIIGEIPQYFSYKRKWFIRRMV
KLDTKTMVVKEGNRNVINEAFRVLRSNMDFMVAPQKNQNIFVITSFNPGSGKTFLTMNIAMSFAIKQKRVLVIDGDLRHG
STSSYVDSPETGLSDYLSGMTDDWKRLIAYDNKYENFHILPIGKVPPNPTELLENGRMETLIEQLRSEYDYVFIDCPPID
IVADAQILEKIADRTFFVIRAGLLDRSMLPELESIYQEKRFKNLSLILNGTESTGGRYSYRYGYRYGYRYGYHYGHASYY
GSKEKRGG
>gnl|bykdb|A0A255T941 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. P2-180] (length=811 residues).
METNNNNQTNEQNDDFLRLQDLWGLCLPRWRWFVLSVLICASAAVLYLLRTPNIYTRTASILIKEDAKGKSSNLISDFAD
MGGLFKSNTNIKNELSTIKSPNLMTEVVKRLRLNEVYSVREGLKRVELYGTSPVEVMMRKQSKYPFSFVIKLNDEHSFTL
YDFKMYTEDGKVEYDKEVKGNIGKVVMTPIGQMTVHGTKTAREDFIGEKITYSKQNIDDLADALSTKLVAELDNKEGTVI
TLTTEATSPKKAEDILNTLIEVYNENWILDKNQIAISTSQFIGERLGVIEGELGHVDANISSFKSANLLPDVQAASALYM
NQSAESKKAILELNSQLTTAQYIRHELTSKSIDQTLPTNSGIANANIETQINNYNNMVLDRNRLISNSSEANPLVQDLTS
SLQSMQKTIVQSIDNLILSINSQINSNRQQEATSINKLASSPNQAKYLLSVERQQKVKEALYLYLLQKREENELSQAFTA
YNTRVITTPRGSKSPTAPRKPLILLVAIVVGFAIPAVIIYLLENMNTKLRGRKDLDKVNVPFLGEIPLYATGKKASKSIF
FKKKKEKEDGLKTLVVEEGNRDVINEAFRVLRSNMDFMAGSDKNKNVLVMTSFNPGSGKSFLTMNIAASFAIKNKKILVI
DGDLRHGSTSSYVNSPSKGLSEYLSNRTDNWKDLIVKYGKMDNLHIMPIGTVPPNPTELLENGKLGKLIEELRPLYDYIF
IDCPPIDIVADTQIIEKCADRTVFVVRAGLLERSMIPELENIYQQKRFKNLSLILNGTESAVGRYSYRYGYRYGYRYGYH
NGYHNGYHNGY
>gnl|bykdb|A0A285T4L1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AR29] (length=775 residues).
MQNNTLSNKNEQSINLVDLFVYLLSKWKWFVLSVLLFGGLAWYHYATSPLVFFRNVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVEEGLRMNELYNQSPINVSFINVMPERYISFTVTPKNAKQVLLSDFTGI
PAANDKTYTMRLNDTLTIGSERILITGTDRWGQAWTERDIRVSKNPLNAVAGRFQGSMGIRQEEDESSILVLSLKDDSPL
RAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIERELGGVETELEAFKQSNQLMDIGSLAGQYMGEAQTYSADA
LEQETQLKLAQFIKEYLTDPTKNRDLIPSGTGISDASVEGQINQYNALKLKRDKLIADSSESNPVVEELNNAIHALRQSI
IRAVDNMIVSINMKRNDARSRQAQAQARFTTVPTKERQMLSIERQQKIKESLYMFLLNRREENALSQAMADNNARTIDSV
DGPVGPIAPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVRSRKDLKGAVSIPFLGEIPQDKEAAKTGVAVGRDDGMLSE
SFRILRTNMAFMAKKDKPMQVITFTSFNEGAGKTFVSRNLAMSLVLTKKRVVLVDLDIRKGTLSRHFSKHPVGVTNYLAD
ESIALDDIIHTDEKSGGLDIISSGTVAPNPAELLMDSRLDTMMAELRKRYDYVIVDNVPVGIVADATISNRISDLTIFVV
RAGKLDRRQLPDLEELYRDNKLCNMSLILNGVDPSRRGYGYGYGYGYGYGKRKNK
>gnl|bykdb|A0A285TGL6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AR29] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLDKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSAKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIIFIRENMNTRVRGRKDLDGLSVPFIGEIPLSIRGKKRVKSYE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAISLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGHIDKISDIIVTNEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|A0A2A3UE91 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacteriaceae bacterium] (length=806 residues).
MFNPQVESANNQLKDITEKFNSGFDIGVIAFLFMKSRIYIVLFFVISFSLAFLYLRYSQPIYESRAIIQINDANQADDIL
KLNSLSNNGNVLAEAIEQIRSKVFLKRVVEKLDISVNYYSEGVFKNNELYDSSPYLIKINAKKGTVYGSQIKVELNKQLT
GGVLKIGTQKLNFALNSWLKTADFDINIYLNPNIQASVINEIVKDNKGFYFIVHDVDAVTAQLQAKVELKLLNELAKTIL
IRVKDVNAAKSSDIVNAITEEYLAFDVERKSESSRNIISFIDSQLGNVYDALKDTEGDLQKFKKDKNISEKDKIITTELM
RYSTIEDQMLQAQMEETLITEIQANIAKNKNIDIYQLISLMSGTEYESVIKDVTQNIQKLLSEKENLLYAVTPNSENIKQ
VNYQLENQRKLLLESLDGVRLKYKSKYKSLLEKSSSYKNRLTQSPEDEVEFSRLTRLYSISEKYYTMLLEKKTEFRISNA
GYVSKNIILEKALGLGTQVSPSQRNAVVIAFLVSLLFSMGLVFIRYIFHDKIYSLADITKHSSGNVSLLGIIPKYENDIP
VSQLIVDKNPKALISEAFRTVRTNLGFISAKEGTKIVSITSTISGEGKTFVAINIAGVLAFTGKKVVIIDLDMRKPKIHK
GFGVNNNIGMSTILTGITAVEDCFMNSPMDNLKFITAGPSPPNPSELILSSKLDEVLDYLRTKFDYIVIDNAPIGLVTDG
IATIQRADYPIYVFRAGYSRKLFTQILDRLKNESQVKNLSVVLNDVDVSRKIYSYNYGYGYGYGYGYGSGYYSDDEKFKN
RTKKKK
>gnl|bykdb|A0A2A4G4B1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sediminicola luteus] (length=770 residues).
MISSGSPLKHDDEMEIDLQELLGFVLSQWKKMVLGGLIGALLAFGYLKTVNPKFRVETSVLLKSVTNSIPDELSVFDDLG
MVSGSASTLEDEIQLFRSRPLIKQMVEKHNLHIRYYSKNSFKNTELFLDKPFKLEWLSPINDSYTFDFALLDSENFSLSI
NGSEEMPLHFNKEIGYENVRFRIIPLLDINALKGQSYQIYCTPISKTVNQIINNLQINPLSDKTHGLTLTMEVEQAERGQ
LILEELVATYNKLEQDDKNLISENTAAFIDSRLKGITKELVMVEGHLESFKTQRVLTDLDMESGLYLRDNAQSRQEINTL
STQLELALLMKKSVLEGGIQLLPTNIGLDHSGVKETIDNFNQLILEKNQLLESASENHPTILTMNERLTELQKGIAISLE
GYIGQIGQQIKGAGSFQGQTSTALRAMPKKEREYRSIQRQQHVKESLYLYLLKKREEIAISLASVAPNAKLINNPHVHES
PVFPKYHLILAAGTGLGSVIPLVISFLLFFLNGKISNGQELEAMVGIPVLADIAKHKSKVKYLFGDDDFSSTAESFRLLD
ANLDFMLDTHPDDTCRTVLVTSSISGEGKSFVALNYARSLALAGKKVLLLDTDVRASKLMGYLGVDHEFGLSDYLRYPHI
SVSDIVFKAEGIPKLDVIGAGQLLKSVSDFMTNRKLRELIEQLQLDYDYLIIDTPPVATLSDTLRLKDYADICLYVVRAN
YVDKKLLHFPKKLFQENRFRHFALIMNDVDYTKTDYYKYGYLYTEKGEVG
>gnl|bykdb|A0A2A4PYG9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=808 residues).
MYNQTTSGTDNVNAYQDRMSNFSQEFDLGVFIGILKKQFKWIVLFFLLAGIGAFLYLRYTPLLFEASALLQMTSQNTAQK
VLNVENIYEQDVAGEIELIRSRAFLSNALSRIDLGISYYSKGKILDSEIYTASPYTVEVRNVGPGLLGKPIYISFPSTKK
IYTSYYVGEEQFNKPIXIGXWXALEHLEVKIDVTDFSLISTQQNQFAQNPYFFIVNNTAAEIDKYYHLIDVRILNQAAKT
IQVTVRENNPQKAADIVNSMASEFVEYDVEKKAQSATKILEFIDSQLLQVYDKLRSSENKMQGFKRENKLSQQGDFITVY
VXKLDNIENELMDLELETSMLDEVADMIKKKDDIDVYNLLPALTGSSFQDEISDLVQSLHKLLAKKEEILYTATKESEAV
KGVNYQISVQKKLLIGSIKSLSRKFDAKKETLGAKIKQIEDKFYNLPTQELEYARLLRLFTINEKFYTNLLEKKAEYSIS
KAGFVSKNVILESAAAPSSPISPDRKKILALFITVAIICSALLLVIRYLMHNEITSVSELDKGSQGAFLGIVPMYKKDIP
VSQLLVDKNPKSLIAESFRSIRTNLQFINNDPGSKMIALTSTVSGEGKTFXXINLAGIIAFSDKKVIVLDLDLRKPKIHL
GFNFENDKGXSTILSGKDTLDDTIHQSSIANLDVITAGPMPPNPSELIISNKMDSLLEELKTRYDVVVVDNPPVGIVTDG
ISMIQKADYPIYVFRANVSKKNYIGNVDRLISESKIKNLSVVLNGLDTENGYGXSYNYGYGYGYGYGYGYYDEEAGFXKK
SAWQRLFG
>gnl|bykdb|A0A2A4YXP3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=814 residues).
MEENTSSNNLNEERARKRSNLNTESDPILFFHLLKRNLLLFAVIIICCLLVSLVYLRYTAPVYEAKLVYQVNSLNTASSV
LNVGGGFKESNSLAKDVEILRSKLLFKRALRKIPIDVSYYNQGEILTNELYRSSPIKVEHQVKDSSILGQHFYVKFIDTH
KFELVVNKLVLGEYQTNTTIHLPKVDLKITLLRKENYEILKEGNLYFRINSYEEMTNAWDYKLSVFPLNNAAKTINISFE
DHNPKKAVDIVTAVANEYIIYDIEERSRSSKNALQFIDEQLDRYYNKLRLSEDKIKDFHQGTNYTSMDRSSSYFDRSNRL
ENELIDVDLQQSVLKEVKKSISLNNDDIDVYDLLPILAGTDYAGGIMSLITSLKEFLIQKENLQFEVTKDSEIIKSLDHK
IKVQKKILFESINSSNDKLTTKRIELLAKIDKLEGKFKKVPAQELEFARLQRVLSIDEKFFTLLMEKRTEYSISDAGYVS
EHIILDRAIMPKSPVFPNKKVFISFGFIVGFVLSLVLLLVKYITKNTISSIDEIVRHSYAGITVLGIVPKYKHDIPVSQL
VVNKNPKSIIAESFRAIRSNMQFIDGSKGAKLLAVTSTVSGEGKTFCAINIAGIIAYSGKKVVILDLDMRKPKIHLGFGV
ENNVGMSTLLIKSKKISECVHHSELENLDFITSGPVPPNPSELIINGELDNVIKELHLEYDFVIIDNPPIGLVSDAMEIL
KKADYPIYVFKNEYSKKYFVNNVDRLMIDNGIGGLSIILNAVEHGKSAYGGGYGYGYGGGYGYGGGYGYGYGGYYEDEPK
DKTSFWNGIFGRKK
>gnl|bykdb|A0A2A5B3B0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=813 residues).
MEENNSSNNINEEKTRKRSNLNTESDPILFFHLLKQNLLSFAIIIAVCLMGAFIYLRYTTPIYESVLVYQVSSLNTASKV
LEVREFQETNSLSKDVEILKSKLLFKRALKRIPIDVSYYRKGEILINELYRSTPIKVSYVIKDSTILGQSFFVEFIDDYK
FRLTQNDKVIGDFNVNETINHPKVELKISLLDKDLYVTPQGGDLFFKINDYDKLTFAYIGKLAVFPLNNAAKTINISFQD
NNGEKAKEIITAVANEYIDYDIEERSKSSKKALQFIDQQLDKYYNRVKGAENRIQEFQEGTNFSTLDRSSIYFDRSSKLE
NDLFNIDLQKKILEEIKTSISSNDKDIDVYELLPILAGTEYAGGIMSLITTLKELLFRQENLQYEVTKNNEVVKSLKHQI
NVQKKVLFESINSSISKLSIRRVEILKSIDDVEKKFLNVPAEELEYARLQRVLSLDEKFYNLLMEKRTEYSISDAGFVTQ
HKILDRAIVSINPVFPKKNIILLFASIIGFVLSLVLLLVKYILKNTISSVDEIIRHSYTDITILGIIPKYKHDIPVSQLV
VNKNPKSIIAESFRAIRSNMQFISGTEGKKLLAVTSTVSGEGKTFCAINIAGIIAYSGKKVVILDLDMRKPKIHLGFGVE
NAVGMSTLLIKSKKISECIHHSELENLDFITSGPIPPNPSELIINGELLNIVKELQIEYDFVIVDNPPIGLVSDAMEILR
EADYPIYVFKNEYSKKYFVNNVDRLILDNGIKNLSIILNAVEHGKGAYGGGYGYGYGGGYGYGGGYGYGYGGYYEDEPKE
SKGFLNGIFGRKK
>gnl|bykdb|A0A2A5FYT6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=823 residues).
METSSFSNNNEHNAFAKQQSDFDFGLLLYITQRNIFWIIAILIVAGTAAYFYIRYTPPIYESIGIIQVRTDNTASQILEA
TPAYLRQDISGDIEFLRSKEFFKNILNTLDLEVSYFSEGQVMATENYANHPYSVGFQVKDSSIFGRKIYIQFDDEFKAIA
SYTINDSVYSREAPINEIIILPHVNLRIKDVDFIQITTSKKQLKQNDYFFIINDVNQITEQYHHRLRVELLNAAAKTIKI
SFTDHSGKKAKDISEAIAEGFINIDVERKSQSAEKVLNFIDTQIESVYGRLRTSETSMQSFQKDNRITGNDGFTGIYLER
LNLLENEVINLELEESVLKEIEKKITANEKEIDPYTIIPVLTGTHFEKNISRQINSLHQLLIKKEEMLYSETEKSEKIKS
IDYQISIQKNLLLESLKAMKDKISARKKNIQKKIKEYEKTYLEMPTKELEYSRLQRVFAINEKFYSLLLEKSTEYSIAKA
GFVPENIILEKAKIPNFHISPNRKLVVISFFLIGLIISSGLIAIKYLLHNTITNINEIARLSKANANILGMIPRYKEDIP
VSLLIVNKRPKSMMAESFRTIRTNLQFISNEPGPKTIAITSTISGEGKTFVAINLGGIIALTGKKVIILDLDMRKPKIHA
GFGVENTSGMSTLLIGKDSVENCIRHSEQKNLDFITAGPIPPNPSELIISEKFEKLLIELKVMYDVVVMDNPPVGLVTDG
IAAIQKADYPVYIFRSGFSKKNFVPNVDRLIRDNKISRLAVILNSVETHKGKYGYGYGYGYGYGQGYGYGYGYGYGYGYG
YGYYDDAKESEKKSMIGKLIGKN
>gnl|bykdb|A0A2A5H8X6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=805 residues).
MQEDQFAHKKEVVSNFNTELDIILLLKVFKKTFIYFVGIIAICVTLSLIYLRYTVPIYQSKLVLQVGSENTANKVLQVDN
FSKTEDVAKDVELLRSKLLLKRALSKLPLEVSYFNQGKILEYELYKNSPFKVFFEVKDSSVLGKKFYIEKTNNEKFNLFQ
SEKLIGEFSSNVPIELKEVTLRIVFDNYNEFGADKNNSMFFAINDLEALTNKYIQQLGVFPLNPSAKTISISFNDNNALK
TSDIITSLANEYILYDIEERSKSSKKIIQFLDNQLDKYYNKVKLSENRIQDFQTSKKIGNPNEVSSIYLDKINRFENQLI
DIDFQTSVLKEISKSVTGKINTIDVYNLLPTLTGTEYEASITALITNLQSLMVQKQNLLSEVTVNSGSIKSLENQIDVQK
QILFTTINSLITKLELRRKEVVKKVNEIQAKYLTVPANELEYARLQRVLSIDEKFFTLLMEKRTEYSISEAGFVPQHTIL
DKANVPTLPMSPNRNLILITGVLLGVVISLVLLIIRYIFKNTISTIDEINRHIKSSVGFLGNIPLYHNKIPVSQLVINRE
PKSVISESFRSVRSNLQFITSNNQKKTIAVTSTISGEGKTFCAINLAGIIAMSGKKVVIIDLDMRRPKIHIGFGVKNTSG
MSTILINKSEIEECIHKSELENLDFITSGPIPPNPSELIIGGGIENLINTLKNKYGYDYVVVDNPPIGLVSDAMETLKFA
DYPIYVFKSEYSRKNFINNIDKLVIENEISKLSIILNGVDFRDKFYSYGYNYSYSYGSKNSYYYDGSEESASFFDRLLKK
VGLKK
>gnl|bykdb|A0A2A8CVB6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Longibacter salinarum] (length=803 residues).
MSPSSNMSSNGHRPAGGPVNGIAGASLFYDDNPQRGSQLHELLGTLWRGKWIILGVLIVVLAAGTAYTLSIPTTYRTSSL
LLVDKQSQSGGVVAQLSSRGLSPYSAESRTLQNELFVLQQSMTIPNRVADSLLALGRHPETGRPIQMLSDVEGNRLSQNQ
IAHRVRGSIRAGTYGEQFDAIRIVATGRDAADVALVANIYADEYIRRTKEKARESLQASRDFLERQAEKLKAEVQAAEGE
IENYMQREGAIALDQESGRIVSDIAQMEAEQRQLQIELQLARTSLDEKRSELEKIEPQISDRLSSTTGDVLESVQEEKAR
LQARIDQIERENPNLGAGGTLQRDLRRMKERVSRLQERADSLASKYVNESLAAGGVGSQSGENSRSLTYVVEQRRAIAQH
RIEVSGLEARLDAIQNQLEQRRAALKNIPEQSMVLAQLQRERRSTERIYGMVQEKLQETRLAEESEMGYAEVIRPAGYGT
PVSPSTRTNLLYSFMIGLVLGGGIVLVREQLDTRIQQPDDLRRHGHQIVGVVPSMDQLIEGEFEGQSTILIDGQEIQTSL
AMLVSPMSAVAESYRRIRTNLQFSRPDKELRTLAISSAEKGEGKSTTSSNLALALASAGKDTLLVDADLRRPRAHELMGL
SRSPGLSHLLYDDEVEVDDFETEIDRLWVLPAGESVPNPAELLGSERMQDVIENLRERFDYILFDTPPVLLFSDALALAS
HCDGTILVASANRTDGRAFDHAVDLLHDVEADTIGCVLNRYDASSFLQGYGYNYGYAHSYKRLEEHYAEDPNTGGRFSWL
HKL
>gnl|bykdb|A0A2A8CVM9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Longibacter salinarum] (length=807 residues).
MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSSEANAGIDVAEILDMLRRGKWIIAATTIVVVALVGAYT
YTVDPVYEAKSIVKIDLGAQSGPGGMGAFGQQRDLASEVGVLQYSAELASRVVAELRATESALEEKGKFPLLYGEDGQAR
STNEVMSHMMQRVSFVPMQSQSMIQFTVESGVPEEASTVANLYSSQYEIFSREKARASVTAARDFLETQAEKRREEIREL
EQQWETFAQNNQVVTQGIGGERLVAEYTELTARRDALRFELEQEEEALRLLRDQLAQFEPGLRETVQQEQEASGLRSEIS
VLERKIGEMRAEAAQYYVANDGLEGDTDRIETEFPQLADLLERINGLEKRKRSLTNQLVAEATQSSGLPGATAGNDSQMG
TSALNRIMQLKTRITEQEIRIGQIEAQIAGLESAIQSYEPRLNRIPQQTIQREQIDRKLQQAERFYQSITSELQKTIIAE
ESELGYVETVRKAFVPSIPVKPNVQQNLLLGLLLGVGFGIGLAFLRLASNSRIYRPDDLLRNGYRVTGVVPKMDNEIKKE
FRGRDTVEIEGHELSTRLLPILSPWSPVTENYRLIRTNMQYAGSGQSYGEPPQTILVTSPEPGDGKTTTAINLALTFVLS
GKKVLLIDADMRRPTAHKLLGMERSPGLAEMLRGDDKVQVVRRTYVDGLYFVPAGKAEDPPTEALDSVRMDKLIELGKSR
CDIVIIDTPPVLAASDPLVLAPRADATLVVTSANSTDVDSLDLTRDMLEGVGVSISGVIFNRFDDAKASGSNYKYGYYHS
DNYRMVS
>gnl|bykdb|A0A2D2N2N1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis] (length=822 residues).
MNLNEDSKNTFTRQSRSYISDTEDTAFFSLEEFFLSLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMIGNSEVENEILMLKSKRLTAIVVDKLDLDVSIYKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IQINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLNTTLFFADSWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKRNNITD
ISTDVGTYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYDRLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSSEPISPRKPVIFFAAFLLGLVLPSSFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSQDLKAVMFTSANTGSGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKNRYDYVFLDSV
PAMSVADAMITNRVADLTIYVIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYDKQG
KKLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|A0A2D4ZVH1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=777 residues).
MHFNGNSSNGYNSGYSPLENETDSYIEKEIDLIKVFNILLLHKWALIGITVLFTVVAIIFAQLQTPIFQSTGTLIVSESK
NRYSYAGAGIENLLTSTYGIGVGSTIANELQIMKSRKLSYDLAERINEVEFDQYGNKFPILWRAYPVDSTSTSIDTVAMR
YRELIRFSEPDPEADIVSISFESPLPTEASSIINMTMDTYSALSTEQNRTMAVSALEFLRTERTKLESELVSTEDSLQNF
MNRTLLIAVDPQTEEIISTIANLEVEKQKLEVGLVAVMSGIAQYENQLNEIKPGLADLYSDAIGPVIERYQYALAELETN
KLLYLTKNPGISENNPEIARIENEILKVKRQIKDRTNNLLSSGSDLYLSFIGSGDGTLTQRIAEISQKLIELKVEQAQLK
TQENIISKRYAEVNNRLEDLPDEIIQLARLKRNVRVNEEMYLQVSSQFAEMSLWEKTQFGLGRPLDYAVPAKEPVKPKKK
IIVVVGFFMGCVLAVGFVLVREMLNDTITSTDALKEFQKPVLGAIPDFSVIGELDPNERQYIGKKSVSNQLITLFDHISP
ISEAYRRLRINVVYANPDKDYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDA
LFDSTIDARLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLIDGLIVVSR
FNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR
>gnl|bykdb|A0A2D5KD44 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=818 residues).
MQEQLSPHELEKLKQSQSSLSSFNTDFDLGLFLYIIKKNLLWVMLTIGMSILGSFLYIRYTAPVYRASADIQIEKSNQAN
RLLDVEDYYESNDISSEIELLKSPLLMEATLEKLPLQVSYFSEGQFLRNEIYKNAPFNVEVLYKEPSLSSTKIDISFANS
SSGKLSWGEGKESSVDFYAGKSCHLPFAEVIVTVTDYSRIKKEVEAVKGIEYHFVLNNPQSLVKGILSRLEIVILNPNAK
TLQVGISDNNRLKAFDIVNGLIDEFKLYNVEKKKQSSKQILDFLNAQIESVYEKQKVYERQIQRFKRENGITEIDQFSKV
YIERMNQIDQAQVELEIEIATLEEIKKQIKEGGEQIDIYEFLPILVGSQFESSISSLIEQLNDLLLKKQELLFTMRENSN
RIQEIDYQIDIQKKLISESINSLIDKLNDRLSDLNERVERSQKEYFNQPEAEIELLRLKRVYDINERFYTMLIEKKTEYS
ISQEGYVSDINILDKATLPTTAVSPNKNLIFIGFTFAGLFLSFLLIIVRYLFHNKITSIDEITKYASAQISVLGMIPKYK
KDIPVSQLIVNKNPKSLIAESFRSIRTNLQFISAQEGAKVMAVTSTVSGEGKTFIAINLGGIIAFSGKKVIILDLDMRKP
KIHRGFDVSNEKGMSTLLIGKDEIKNCIHHSKQENLDFITAGPIPPNPSELIINSRLSEIITNLKEEYDLIIVDNPPVGL
VTDGIEMIRKADYPIYIFRSEYSRKNFVRSIDKLVNDNKINKLSVILNGVDIKKRSYGYGYGYGYGYGYGYGYGYGYGHG
YYNENEENKGGIFNKRKN
>gnl|bykdb|A0A2D5V560 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=832 residues).
MESENFKXVEXNFQRYKENVADLTQEFELGLFLYLLNKIKWYAITLIILCITSAFIYIRYTPKTYQTSSIIQVAVKEQPN
GFSDLYSYNINTNLNSEIALMNSEKAIEKVIRDIELKVFYYFEGEXITRFLYNQSPXSFENFSIKDMSIISKPIYLLFDG
NYFSLTDEKAEIIYAKYILPNKFFSSEFISGKLKFSSNNWKDNLNSMSTNERLFFRIPSXNELKNSILNGLTINIKNQSA
HSXQISHQHTNPHFSKDICNSIVKNYMDYEIDKKQKSTDNIVSFITRQKDSVRKRLIRNEKDLRIFKKNNKXNXXLLNIS
GIKENXEKIEIEIAKXQIDIDLXNQFSDMFENXLSTEINSTSMKNISLLTAIFYNESLTSKMIEQLQEDVNKRDQLLKDI
TPNNKNIIILNGEIEESVVYIKKAVKLLKKNYKEKAKKLERKIYNYGSEFSIIPEKELELLRLEQIKEINNKYYTELLNR
EIEYELSKAGITTYNEILQSAPLNENPISPNKLMIYSIFIGIGIFIAIVIILLNYITHDKITALHEINKYSSIEISTLGM
IPFIKNPMKVSQLIVDKSPKSMLTESFRAIRTNLQFIDNNKKSKIIAISSTISGEGKTFLAINLAGIIAFTGKKVVVIDQ
DMRKPKIHLGFDCKNNLGMSEILSKKNTIKECINHSTLNGLDFITAGALPPNPSELIISDQFNHTIKELQKIYDFIIIDN
PPVGLVTDGISILQKADYPIYVFKANYSRKKFVQNVQKXIKENDIKKLSVVLNGVDAKRNEYANKYGYXYGYGXGYGYGY
GYGYGYGXSYYSEGNSSKEKSIFEKIRDKIKK
>gnl|bykdb|A0A2D7K5A8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=850 residues).
MVNHYSNQSIMGAEEFKGAEENIQRYKENVSDLTQEFELGLFLYLLNKIKWYSIIIIIISISLAFLYLRYTPKTYQTGAL
IQVAVKEQPNGFSDLYTYNINTNLNSEIALMKSQKAIDRVIEDLNLKVFYYFKGEILTRFLYNQSPFIFENFSVKDESIL
SKAIYLLYDGTYFSLTDENEEIEYANYILPNKFFSSKFISGKLSFSNGNWKDLLSSLSSNERLFFKIPTKKEVINILKNS
LTITIQDQSAHSIKISHLHTNPHFSKDVCNSFVKIYMNYEINKKQKSTDKIVAFIKIQKDSVKNRLIKSEKDLRIFKKNN
KFKNELIGITGLKDKAEKIEKEIVKIQLDIDLMDQFSNMFENNLSTEINSSSVKNISLLTTIFYGESLTSKMIDQLEKDV
IQRDELLKDITPNNKNIILLNGQIEESVLYIKKAVKLLKQSYKEKAQKLKRKITYVGNEFSIIPEKELELLRLQQIKEVN
NKYYMELLNREIEYELSKAGITTYNEILQSAPLNENPISPNKLLIYSIFVGIGIFISISIIFLNYITHDKITALHEINKY
SNIEISTLGMIPYVNKEMKVSQLIVDKSPKSMITESFRAIRTNLQFISNNQSSKIVAVSSTISGEGKTFLAINLAGILAF
TGKKVVVIDLDMRKPKIHLGFGEKNNLGMSEILSKKIKYKEAIKKSSLNRLDFITAGTLPPNPSELIISENFDQTLLELK
KNYDFIIIDNPPVGLVTDGIPVLQKADYPIYVFKANYSRKKFVQNVEKLIKENHINKLSVVLNGVDSKRNEYANKYGYGY
GYGYGYGYGYGYGYGYGHGYGSSNSYYSDDYSKKEKTIFERIKNRFKSWK
>gnl|bykdb|A0A2D8JJW3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=782 residues).
MATQSNKQFSIYDFLYFLKRNYIYILIITLFCFLVGCFLTLRIKPIYSSYAEIEIVKDDNSGIAKMPGFEAFSDDKKLED
KIRNIGLRPIAQATIDKLSEPVNSLFLTPDYKLIFKYKEDKKDTVSFLFNNEIIDVPIHIKEGCGTLIENISETIQIKNE
KNALNNLSLHSDNTVFDLSGVVIPDGDFKDGCDLPKYRQLHVLNTRDYKPVGWRETFNSAISLFGLWPVSNQKKHDLVNY
TFKDGDIRAAVERLQESLNINHVKETSHLVITVESLDSKEAANIVSCLIDSYVEEEKKHANQKTSDQIIFLKNQILSNSD
SLLKMKDEIQKFQQAEDILSSDGNANEHVEQFLKLKSERVAQQLKLDDLINAKEIYEQEIGKNDIPKSYELAIKDTLRFL
DIRVKVSNNRIENINREIEDYQTFLDELPRKTREFTTLKEKKIEFSATNEFLKEKLKNAELIFNSAQPGITVRVNAEQDF
EKKKPNRSRNLLLSIFIGLFGSTLILFLVEYFNNSIKTIEDLEKYGLNILAIIPSIGSQKNKKIKNNGSIERTLITREDP
KSPISEAYRTLRTSIMYSSVDTNDSKTVMVSSPGPGEGKTTTVSNLAITYANLGKKTLLIDADLRKPVINKVFDLDKENG
LSKYIVADANIDDIIQKSQIENLSIISSGINPPNPSELLNSDKMKVLIEQLKLRFDIILIDTPPIIAVTDALILSKIIDN
FILVCRSTVTQKGALDRAIKSLNQVGGKFDGAILNALSEGDNYGSGYYYNYYQYYYNEDSKK
>gnl|bykdb|A0A2D9D7T6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=822 residues).
MSSLNQRKLIVNKDYNPLILGEILRKHWFAPILFIVFFSTVAFFYLRYTKPIFQSKAVIQIVEEDRVKEVLGKDAFTDRE
SADGGLSKYIELLKSEFIFEKAVERLSLYTSVYSEGKLLTKDLYRSNLVSVEPVKLLDSTLCGVHFDIKEKKGKLEISYT
HNGQSKKISGELNKPIKTKSFEIIVKAKNKFGITEINKNNRLYFVFNKKYDVMRSLKKNLTVSAIDPSAKTIQITFDHYN
PELTRDMTQAIMDVFFLYEEEISKKNTDKILAFVDTQLDSLSTLLQKSKDSITSFQKKSKLSNPDNTTVELSSRINSFKT
RQLENEEELVTLYLIKSKITPNPDRIQIYKLIPEMLGKKNLEANVIKQVEELNALLEKKENLLTGLTPQNKEIEILDQKI
DARIVSIRKSLIIIEERVKESMALLQGKILELESEYYKLPEAIMRYDRLKYIEELNNKYFTLFTEKKIEYTLSNAGYSST
NRVLSNPVKPKTPMTPKREIVYGFALXLGLIFGLSYLLLKYVTYNDIVGSEDLLNLLPEGTNYLGGVPXYKKKMKYSQVV
VTESSKSRLAEAIRSIRANMSFVDKNAKVMAISSSVSGEGKTFVALNLAGMLAVSGKKTIVIDLDLRKPKVHHGFDQENI
SGMSNIISGNDSLDNVIRKSHLENLDFITAGPIPPNPSELILSTEYKNILSELKERYDIVMIDNPPVGIVSDGISVLASA
DIPIYVFKSNYSKRLFINRVDELFNVQKIRSLNIILNGIKTRRSFYGYGYGYGYGYGYGYGYGYGYGYGYGSGYYTEEEE
ESPIFVKLIKGIKSRWKSKKQK
>gnl|bykdb|A0A2E0FJ09 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=819 residues).
MIEEEISKRNDSFERYRERLTNFSSEFEIGLFLYLTRQIWVWMLLIVIVCFGLGFLYIRYTPPQYKAKALIQRTSQDNAR
RILNVKNPLQEDETLTGDVELLRSPLLMEKTVASLPLQIRYFLEGKILKHEKYNGSLFLVEDFQLLNSSLVNVPIYVLLK
PDKTIHLKYTVDEETFEFNESLNESFSTEHFICSIQISDLNRFYAQQNDGEFYFLYSDLEKLASEFSAMLEVSIANSNAN
TIGLSFTHPNQVLTKDVLGALIENFDQFDSIKRSESSNRIVEFIAMQKDSVSKKLKESERMLKDFKDTNKIRQVEGMTDS
YLSRIEEMESELVKLDVDEEILNEIATVITDNPLELDIYNVLPILIGSEFESNLYTLISVLHKKLMLYEDLISERTGDHE
EIKKIRSQIDVQTKLISEGIKSLLNKTMTRKETLTGKLNKIESKFYNLPEKELEYGRLDRIFNINDKYYTLLLEKQTEYA
LTRVGITSNTNMLSPPKIPEYQDSPSKKIVLAISVIASILLCVLISIFRYLAHNEITSLNEISSISNASVSILGMIPVYK
NKIPVSQMIINQNPKSMIAESFRSIRTNMEFVSSSSEKTKVIGVTSTVSGEGKTFVAINLAGIIAFSDKKVIVLDLDMRK
PKIHLGFGVENVRGMSTLLIGKEKINNCINTSELPGLDFITAGPIPPNPSELIINGELEKIISELKKTYHTIVVDNPPVG
LVTDGISVIKKADIPIYIFRANYSKKNYVQNLDRLMNEHKIYKLSAILNGVDTSRKRYGYNYGYGYGYGYGYGYGYGNSY
YEEENSKKSTFIKRIFRKK
>gnl|bykdb|A0A2E1XQ82 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=848 residues).
MVNHYSNKSIMGVEDFKGTEDSIQRYKENVADLTQEFELGLFLYLLNKIKWYAIIILIISISLAFLYLRYTPKTYETGAL
IQVAVKEQPNGFSDLYTYNINTNLKSEIALMKSQKAIDRLVEDLNLKVFYYFEGEILTRFLYNQSPFIFENFSVKDESIF
SKPIYLSFDGTYFSLKDKNQEIEYANYILPNKFFSSKFLSGKLSFSNEDWKDFLSSLSSNERLLFKIPNKKEVINIIKNS
LTITIQDQSAHSIKISHQHTNPHFSKDICNSIVEIYMNYEINKKQKSTDKIVAFIETQKDSVKNRLIKSEKDLRIFKKNN
KFKNELININGFQDKAEEIEKEIVKIQLDIDLMDQFSNMFENNLSTEINSSSVKNISLLTTIFYGESLTSKMIAQLEEDV
NQRDELLKDITPNNKNIILLNGQIEESILYIKKAVKLLKKSYKEKALKLERKITYVGNEFSVIPEKELELLRLEQVKEIN
NKYYMELLSREIEYELSKAGITTYNEVLQNAPLNDIPISPNKLLIYSIFTAIGMFISILIILLNYLTHDKITALHEINKY
SNIEISTLGMIPFVNKEMKVSQLIVDKSPKSMLTESFRAIRTNLQFISNIQSSKIVAVSSTISGEGKTFLAINLAGILAF
TGKKVIVIDLDMRKPKIHLGFGEKNNLGMSEILSKKITAKEAIKKSSLNGLDFITAGTLPPNPSELIISQEFDHSILNLK
KEYDFIIIDNPPVGLVTDGIPVLQKADYPIYVFKANYSRKKFVQNVEKLIKENQIKKLSVVLNGVDAKRNEYANKYGYGY
RYGYGYGYGYGYGYGYGYGSSNSYYSDDYSKKEKTIFERIKNRFKSWK
>gnl|bykdb|A0A2E2TFD1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=822 residues).
MIQDAREEQNESLDLYKERLTKFSQDFEIGLFIHLIQKSFIWILLFVSLAFGGAYLYLRYYQPMYQSTSILQLKESNQAS
QLLEIDFGKNQNEDMMSDLEVIRSKEFLKTIFKKLPLDISYFNEGELLNYELYMSSPYIVDYDIISAEAFAHKYYIYFPN
TTQIHLSIDEPIGDANYQVFKIDGDIELPFVTLSIKILDFDIIKNDQETGTRNDVFFTLNNNASIVNRYSKSLDLKVLSQ
SAKSISISFTDPNPRKAADLANAISTGFIDYDLTRKIYSSTQVIEFIDSQISEVYGRLKESEVSIQEFKLSNKVTGSSEL
TGIYLDRLGNLEEELIKQELEQEILIQVKQAATSSSDSVEVHQLIPLLTGTQFEDNLLQQIAYLQELQIEKDQSLYEVTQ
SSGRVQNLDYQVRIQKKLLFESIISMEVNLKNRITSLKQKIGEIEGTFSGLPLQELKYSRLKRIFTINEKFYTLLLEKKA
EYAIAKAGIVPESVILERATPNNLPVEPNKKMTYIVFAIFAVFLSILLVLVRYLSHNTIGSLNEIVKMTNASVGTLGIVP
EVKEKIPVSQLIVDQRPKSVLAESFRSLRTNLQFLSTEAEGSKVIAITSTISGEGKTFVAINLGGIIAFSGRKVIILDLD
MRKPKIHKGFNVQNKNGMSTLLIGKDKISDTIQSSQQTNLDFITAGPVPPNPSELIINGKLPEILKELKETYDIIIIDNP
PVGLVTDGIYCLKLADYPLYIFRAGYSKRNFVQMVDRVVNENNLKNLAVVLNGVEIRSGRYSYNYSYGYGYGYGYGYGYG
GYYEEPEQQETEKKNRFFNKKN
>gnl|bykdb|A0A2E3R1D0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rhodothermaceae bacterium] (length=789 residues).
MIDQPYPTAADRGAPGAPVRGEDPFYYGDRDGIDLRALLDILLRGKWIILGAVLALTIPVMVYSMLSPSKYRSYAILLVD
KTDTDLADVLPEAMPSGFWRQERNLSNELLVLDQSMPLAEAVAARLIEAETVPGTNRPLPILRDDDPSTPLTVQEVAFRL
QRGSIKSTMETGGADAIRVNAVSTDPQEAALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQETDAAVEQY
MLREGAVALQEETSRLVDQIATLDARRDQAQVNLVTKRAELAALQSELSRLESQLGTRLSSNLDSELAAARERIQQLNAE
LEVFYRQNPALRNDTNPPANIARLRTELARVEADQERIARQLSAQSLASGSSPDDQRSGFVRAADLRAQISAARVAVRGL
EAEVSQVSSRLGQYESELSNVPAQSIELAQLERERQAAETLYGALEQNLQQARVAEQSQLGYARVIRPAFPTPAPFSPLR
ARNTILALLCGLVFGSLLAIGKVRLDHRIHTPDDLAKLGHAIIGTVPSTTALVKEEYGGADVAEVNGRMVDTHVVSLLNP
MATASESYRALRTNIQFSRPDVVIQTILVTSSNPSEGKSVTSSNLAVVFAQAGRRVLLVDADLRRPTVHKKLGISREPGL
VQQLFSSESIQATTLDQLADDLYVLPAGSLAPNPSELIGSRRMRDLIADMRTKFDIIIFDAPPVLAATDAVLLSTQCDAT
LVIARAGQTKDFELNSALAALKDVGTKPSGLVLNAFDVRQAYGYRYKYAYRYGNAYGYGSPKAADQPDA
>gnl|bykdb|A0A2E3XZI5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=843 residues).
MKQENFVQTEENINRYKENITSLTQDFELGLFLYLINKIKWVLITILIIFLLGSRIYLRYKPEIYKTETRLQLAVKDEPL
EFMQMNPLSSNSTNLKSELAIIKSQKSILRLIKKLKLNILYYNEGEIISRLLYKKNTYKLENFYIKDSSIISKKIYLKFE
KNYFSLVDEENEKIYAEYIEANKFFSSKYISGILKIDWELEEFKKNLEKSNFYFIIPTIKQIKKELLGGLEVNIIDRSAH
TINIIHKHSNTFFSKDICNSLAEIYIDYDLERKQLSSEKIVKFINNRKDSVQKKLILNEKKIRDFKKLNDFENKTTLIEN
QTKRIEEIEKELTVINSNINLLNQFDLMFDENLSSKITTSSIKNISLLTNIFYEDELIKIMITQLQEDVLKRDLLLKEVT
KNNKNFIQLNRQIEEEILYIKKAVKLLKERYEKSKLKIINRKNLIFSRNKIIPESELELMKLEQISEINSKYYSQLLQKE
TEHELSNAGITTYNEILQSAQLSEIPISPNKTIIYLISIISGIIVCLVFVLINYIRHDKITALHEIHKYSMTEISTLGFI
PFVKDKMEVSQLIVDKKPKSMLTESFRAIRTNLQFINNDVNSKIIAVSSTISGEGKTFIAINLGGIIAFTGKKVVVIDLD
MRKPKIHLALGSKNENGMSEILSKKNNIEDCIKISSLENLDFITAGTLPPNPSELIVSETFDKTLYQLKKNYDFIIIDNP
PVGLVTDGIPVLQKADYPIYIFKANYSRKNFVQNVEKLIKENKLNKLSVVLNAVDSKRNEYTNKYGYGYGYGYGYGYGYG
YGYGYGYGYGYGYGYNSDNSYYTEGDSKKEKTIFDKIKSYFKS
>gnl|bykdb|A0A2E4ELE6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=826 residues).
MIHEDTSRNNENLDKYKERLTNFSQEFEIGLFVHLAQKSLLFVLAFFVIAFISSSLYLRYTQPIYSSSSILQLKEQNRAT
QVLDLERMNEKADISADIEIIRSKEFLKTIFAKLPLTISYYTEGEFLTFEHYKSCPFEVKFEIKSPEAFGKDYYVYFESE
KELILTIENGKETVEKRLSTNKWEDLGFVELKFIIIDFDIIKSEQTDLSNNDFYFRLNSDAEIISKYSKSLKVKLLNQAA
NSVEISFSDYNPRKAADLSNAISGGFIDYDLQRQITSSNQILEFIDHQSSEVFTRLKSSEVSIQEFKIDNKVSKTENFTE
MYIDRLALLEEELIKLELEKDILDELKAASDGEKDSVDVYDLLPLLAGTQFEIGIKKQIQFLHELLLEREQSLYEVTADN
GRVKNLEYQISIQKKLLVESINSSSNKIESRMQNVEQKIKDIEDTFTGLPLQELKYNRLKRVFSINEKFYTLLLEKKAEY
SISNAGITPESVILEKAIPPSMPISPNRNMVYIVFFVIAAVFSTILVIIRYLLYNSIGSLNEIVKLTHASVGTLGVVPKV
KDNIPVSQLVVDKKPKSILAESFRGIRTNLQFLSTKKTGPKVLAVTSTISGEGKTFVAINLGGIIAFGGKKVIILDLDMR
KPKIHKGFNVGNKNGMSTLLIGKDKIADTVQKSQLDNLHFITAGPVPPNPSELIINGNLEKIVEELKEMYDLIIIDNPPV
GLVTDGIEALKMADYPLYIFRAEYSKRSFVQMVDRIVNENKITKLAVVLNGVDIQGRKYGYNYSYGYGYGYGYGYGYGYG
YGGYYEESEDRDVQSRAFMRKFRSKG
>gnl|bykdb|A0A2E5CV79 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=759 residues).
MELMGILRFHYKLILTITLFGIMIFTYRTYTIHPVYRSTSSIIIKEKPGTSMIMQYGSRDRSDMSNEIEVLRSRRLAKDV
VKLFWDSNRRNSLALFNTRKYYPRGEKYRRILKEIMSLGIYSPEIEKEEHYTEPYSDAIGEKFSQNVMNGISIKRRNATG
VLEITFQSVFADEARRISDGIAQVYKNLEKTIGNEDATLRVEFMDDLVNQQEGKLLLAEDSLKQFKIENSFFSSDGEASS
VARQISALENDIYNTRSELNMRRERISFLNSKLSAEEKNFATKISTDINAQMIVLRKEINQLESQSIQNAMIYGENHSAV
IEIQKRVSIMKEKLDEKVQQLIAQGITSQDPLAERQKIISDILSLDAEIFGFLQKEQQIENLLSLYQNKLLTLPDKQLKM
ASLMRDVNVLSQNYMMLRQKLEEAKIELASQSGRVQLLDSARRPSRPISPNHRSDILQGLIISLAISFGIIFLIEFLDNS
IRSINDIENLKMSVLGVIPAISGSTNAVINYRAKLFGKQKQISNKNITRRLITREDPRSPISEAYRSLRTNMIYNDVDLK
IKSILVSSAGPGEGKTTTVANMAITYANLGKKTLLVDTDLRRPVVHKIFDLKKEPGITNFLAGTQEDFSSLIKSTSIENL
FVVTSGVIPPNPSELLGSSKMENLINELENEWDIILFDSPPLVAVTDATMVSKAIDKIIIVVKMGQTEKKAFEHTIKSLE
NVHAPVAGVVLNAVTKSNSYGSYYYYYQYYNYYGSDSDK
>gnl|bykdb|A0A2E5RLE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=803 residues).
MEKEKLSILNDEFDLGLAILIIRKNLISILFSISIGFCVAFFINRYTTPQYSASSIVKISEKNDVNQMMNFENIYETNLV
AELSRLKSKKMLSEALNTLNIDVNYYTKGKFLNTENYHSNPFSISYQLKKREAVKSPIMVNFSNGSAIISKVDVDSGTVL
IPVNKWVSIDGLELKINISNRKLNELNNSGKKFLVKIVDKNQLISKYSKGLQVNIENTRANTIKISYTGNHPKKCADIVN
SLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKEIQENNSEYGTDYGKLALDLAAKDQIEKTKTES
TLNDFRNFYSAISNKINHEELYSILLLNSKNQYISTTSSRLRNLLSEKRSLSFRITEESYQVKEIDFQINLEIQDLLEVT
KNIILDLQENLQLIDERLQSYRLAKKSQELNFDHNTDYLHLQRMYDINSEYYSRLLTKKAEYEMVKAGFVSDNEIIEPAK
ANISPISPQKKSNYLIFLGIGLTIGLLIIVIKYLLHNTVSSTSDVAKHTNNIPVLGMIPSYKDVIPVSQLIVDKNPKSLM
SEAFRSIRSNMQFISQSEGSKILTVTSTISGEGKTFVAINLGGIIAFSEKKVIILDLDMRKPKTHIGFNVQNTIGMSTLL
IGKSSLEECIQKSHLENLHFITAGPIPPNPAELIISNKMTDVINELKKLYDVIVIDTPPVGIVTDAFPIISKVDYPVYIV
RAHFSKKVFLKNIQMLRDKKKIKNLSVILNGAGGDKKYGGYKKYGYGYGYGYGYGYGYGGSHGYYEEKPQKEKKVLRKIF
SKK
>gnl|bykdb|A0A2E6GVY9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=807 residues).
MEKEKLSILNDEFDLSLAILIIRKNLLFIVLSIFLGFCIAFFINRYTTPQYYSSSIVKISEKNDVNQMMNFENIYETNLV
AELSRLKSKKMLSEALKTLNIDVNYYTKGKFLNTENYQSNPFSISYQLKKRKAVNYPLMINFKNGSAVISKMDVDSGSFI
IPVNKWISINGLELKINISNRNLNDLNDSGKRFLVKIVDKSQLINNYSKGLSVNIENSRANTIKISYTGNHPKKCADIVN
SLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKDLQKDNQEIKTDYGKLALDLASKDQIEKTKLET
TLIDFKNFYSSISNKISHEELYSVLLLNSKNQYISTTASRLRKLLSDKRSLSFRITEESYQVKEIDFQINLEIEDLLEVT
KNIILDLQDNLQLINDRLESYRIAQKSQEVNFDHNTDYLHLERMYDINSEYYSRLLTKKAEYEMVKAGFVSDNEIIEPAK
ANLVPISPQKKSNYLIFIGSGLVIGLLIIVLKYLLHNTVSSTSDVSKHTNNIPILGMIPSYKDVIPVSQLIVDKNPKSLM
SEAFRSIRSNMQFISNKEGSKIITVTSTISGEGKTFVAINLGGIIAFSEKKVIILDLDMRKPKTHIGFNVQNTIGMSTLL
IGKSSLEECIQKSHLENLHFITAGPIPPNPAELIISNRMTDVIDELKKSYDIIVIDTPPVGIVTDAFPIISKVDYPVYIV
RAHFSKKVFLKNIQMLRDKKKIKNLSVILNGAGGDIKYGGLKKYGYGYGYGYGYGYGYGYGYGGNHGYYEENPKKEKKTL
KKIFVKK
>gnl|bykdb|A0A2E6SYP1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=797 residues).
MEKEKLSILNDEFDLGLALLIIRRNLFLTILLILMGAGFAFFVNRYTTPTYYASSVVKISEKNDVNQMMNFENIYETNLV
AEMSRLKSKKMLSEALADLKLDVNYYSKGKFLNTENYRSSKYKISYQIKDKSVLNKLIQIEFVKGCALLSFNDDPSSNTI
VPVNTWTDFEGLALKINISNINQNKLSDQNLKFLFMINNEKQIVNHFSKGLDVSIFNVRAKTIKIGYSGDHPEKCADIVN
SLASAFLISNISKKKESANQMIKFTDDQVVKINKRLEYYRKLLKPYKELGSSETKDDFDYNQLTRDLKGKDENEKIELQA
SLSDFTQFQLKLSENPSNEELYSILLLNSTNKYLSSVGTSLKQLLAKRRELSFRVTEESYEVKEIDFQIKLQLNDLKEVV
SNLIVELRENIQLIDERLTSYVVAKASKVKDFDHNSDYLHLERMYEINSDYYSKLLTKKAEYEMVKAGFVSDNEIIEPAK
ANIVPIAPDKMTNFIIGCSIGLIIGLIIIVIKYLLHNTVSSTGDVMRHTNNIPILGMVPSFRDAVPVSQLIVDKNPKSLM
SEAFRSIRSNLQFISNSEDSKILTVTSTISGEGKTFIAINLGGIIAFSEKKVIILDLDMRKPKTHIGFNVQNTVGMSTLL
IGKTTLDECIQKSNLENLHFITAGPIPPNPSELIISKKMTNIFNQLREVYDVIVIDTPPVGIVTDALPIISKVDYPIYIV
RAHFSKKMFLKNIQILKDKKGIRNLSIILNGADGGKRYSGYSKYGYGYGYGYGGSNGYYEEKQEKEKPSWKKLFVKS
>gnl|bykdb|A0A2E7CT70 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=835 residues).
MIPEEIKNTEDNLLRYRERIANFSKDFEIGLFLYLLKKSRFTIILILLSAFSLGFLYLRYTPKTYQTSATLQINIKDKAD
ELLEIYSFQQKTNINSEVELLKSQIIIDKAIKKLNENVRYYSEGEILTSDLYKTSPFEIKDLKIRDSIIIGLPIYIQKKG
DYFILTDFDNQKSYAKFIKPGDFFSSNYISGKLIIDDIPTFSESLDKFNYFFKIPFFQEKRNEIINDLEISIIDPAANTI
GITYSHTNPKFAQDVCNTISKVYIDYDLKKKALSSINIVQYINAQKDSVDKRLKLSEQEIQIFKKANNVNSSLMANKTQL
SKISEVENKLVQNQVDITLLNQFQEMFQSTLSKKISSNSIKSLSLSKIFYDNLVIQNMIESLEKNVIKRDELLRDVTESN
ENVILLNYQIEEEIIYISKAIELINKQKRKENKALQQKILLLEKKLLTLPEKELELTRLERIHEINNKYYTLLLEKETEY
ELSKAGITTYNEILSTAPLSETPISPIKLLVYSLVFVLGLIFSIGVSLLKYLLHDKITSLYEISKYSNGTISILGMIPLL
KTKVPVSQLMVDKSPKSLMTESFRAIRTNLQFISNDKKSKVIGISSTISGEGKTFLAINLAGIIAFSGKKVVVIDLDMRK
PKIHLGFGMKNGKGMSDILIGKSTIENCVNNSSLKDLDFITAGTLPPNPSELIISDFFNKTIEKLKEKYDTIVIDNPPVG
LVTDGIPVLQMADYPIYVFKANFSRKNFVQNVDRLINENNLPKLSVVLNGVDTSGSGGYGKRYSYGYHYGYGYGYGYGYG
SKGYNSYYTEDENLRKNSIFKRIINAFKKDNNDYT
>gnl|bykdb|A0A2E7TQF6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=803 residues).
MEKEKLSILNDEFDLGLAILIIRKNLISILFSISIGFCVAFFINRYTTPQYSASSIVKISEKNDVNQMMNFENIYETNLV
AELSRLKSKKMLSEALNTLNIDVNYYTKGKFLNTENYHSNPFSISYQLKKREAVKSPIMVNFSNGSAIISKVDVDSGTVL
IPVNKWVSIDGLELKINISNRKLNELNNSGKKFLVKIVDKNQLISKYSKGLQVNIENTRANTIKISYTGNHPKKCADIVN
SLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQPYKEIQENNSEYGTDYGKLALDLAAKDQIEKTKTES
TLNDFRNFYSAISNKINHEELYSILLLNSKNQYISTTSSRLRNLLSEKRSLSFRITEESYQVKEIDFQINLEIQDLLEVT
KNIILDLQENLQLIDERLQSYRLAKKSQELNFDHNTDYLHLQRMYDINSEYYSRLLTKKAEYEMVKAGFVSDNEIIEPAK
ANISPISPQKKSNYLIFLGIGLTIGLLIIVIKYLLHNTVSSTSDVAKHTNNIPVLGMIPSYKDVIPVSQLIVDKNPKSLM
SEAFRSIRSNMQFISQSEGSKILTVTSTISGEGKTFVAINLGGIIAFSEKKVIILDLDMRKPKTHIGFNVQNTIGMSTLL
IGKSSLDECIQKSHLENLHFITAGPIPPNPAELIISNKMTDVINELKKLYDVIVIDTPPVGIVTDAFPIISKVDYPVYIV
RAHFSKKVFLKNIQMLRDKKKIKNLSVILNGAGGDKKYGGYKKYGYGYGYGYGYGYGYGGSHGYYEEKPQKEKKVLRKIF
SKK
>gnl|bykdb|A0A2G2EB96 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fluviicola sp] (length=795 residues).
MSSKGIIINTSYDPLILRTVLKRYWWWAALLVMAFASFAYIYLRYTKPTFESSMVLQLGDQDSAKDVLDIENINSRDNEI
SSVVELLRSELLFERALNKLNLNVSLFSRGQILTEEKYLSSAFNIQPYQLSDSSLINQEIAVTSSGNSKVKLTYVKNGKQ
VILSGKLNERIKNEDFDVVVKATDPHSFYQVSKENELFFIFNGREQLSNRLIQDLSVSSIDPYAKTISISFRGYNAVLCR
DVVNAVSKSFIEYDEEQKRKSSDNIISFIDDQLDSLSSEVRIAKDSLIRYQRKSQLSDPENAGISISDNVNKMQDQLFEL
EEEYNGLLNVKQKLSKTPNRLEVYKLLPELLGRSYERALEGHLNQLHDFLERKEDLLFEVTEANSEIAIINQKIASKLRI
IQRSIGAIENRLSRNINAIRRKIGSLEGEAFDLPEKKMEFNRLKNIQNLNEKYFTLLTEKKVLYEISDAGYASTNRVLSK
AKINLVPVAPSRNFVFAAFILFGLFIGIGLILFRYLTFNEINRIEDLEQILPPQASILGGVPLFKEVLEYSQLVVADAPK
SVMAEAMRKIRTNLNYIHPYYQTIAISSSISGEGKTFVALNLGGIIAMSGKKTVLLDLDLRKPKVHLGLDADNGVGMSSL
IVNQATIDECIHHSKVENLDFITAGPIPPNPSELLLSKRFEEIVNELKDRYDVVIIDNPPIGLVSDGIKILTDADIPIYV
FKSHYSKRVFADRVKELFTMQQLKSLNVILNGVKTTRLGGYGYGYGYGYGYYDSGYTEEVETKSKKWYQRLFRRK
>gnl|bykdb|A0A2G2F510 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fluviicola sp] (length=802 residues).
MSNKSFIINKNYDPLILRTILKRYWWWPLTFILLFSALAFTYLRYTKPVYESAMILQLSEKDTAKEVLDFQNLGSRDNQL
SGVVELLRSELLFKRAVKSLSLNVSLYSRGNVLTEEKYLSSSYYIQPYELYDSTLINKEVRVDYDGENISLSYLKNGETK
VVKGYVNEHLKNEDFDVVVKVISDDALRDASTINELYFTFNSIESVTERLRKGLKVVPVEVGAKTISISYRGYTPQLCKD
ITLAISNSYISFDEDMQRKGSENILGFIDSQLDSLSNELKSSKDSLMIFQRKSNLPNPEEAASNITDNISKLQDQLFLIE
DELNSLITVHKMIGSSPNRLEVYKMLPEMLGKSYETSLVKHIEELHLLLERKEDLLYRVTPENSEVKLLDRKVKAKTNLI
QRSVSAIENRLMQNARVLKGNLAKYKDDIFELPEKKMEFNRLKNIQNLNEKYFTLLTEKKVLYAISDAGYASSNRILSMP
KVATTPVEPSKNFIYSSFIMFGIILGLGVMFLKYVMFNEINLIEDLESVLPEKASILGGVPMFKYNMEYSQLIVAEAPKS
SMAESMRKIRTNLSYINPNYQTIAISSSISGEGKTFVALNLAGIIAMSGKKTVLLDLDLRKPKIHLGMDVDNTNGMSSLI
VGQSKLEDCIHSTKLKDFDFITAGPTPPNPSELLLSDGFKDVISQLKELYDVIVIDNPPVGLVSDGVRNLTDADIPIYVF
KSHYSKRSFTNRVKELFEVQQLKSLNVILNGIQATKSSSYGYGYGYGYGSYNNGYMEDDTKVFKQAAKDNKWYRKLFSKW
RK
>gnl|bykdb|A0A2G2FJ17 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fluviicola sp] (length=780 residues).
MEKRNNSIYVNTNFDTDILRIVIRKNWIWLMLIATILLSSAFLYLRYTKPVYESKMLIQISNEDQGADVLDFKNIKEDAS
ISREIELLRSEYLFEKALDRLDLQVSLFAEGDVLTEKRYKQSTFYIKQSHIKDSSVFHIPIYIKPKAQGLVELSMQRHGE
RLKWDIESNKLLATPYFDLEIEIPNWESFVTDAETNVLYFHFNSEDNLASKYLSGLAVSPVDIQAKTIEISYRNTNANLA
QDITKAIGDAFFEYDERYTKESAENILSFISLQLDSLRKELSASKDSIMYFQRKENLPDPENLGESIATKLEKYRFDKFE
LQDELNTLEMISLKLKQSPESLDVYKLIPELIGKSFEGSLNLQVKELHELLETKEDLLYKVTPENDMIKKIETRVDNRIQ
NINKIIIVLKDRLKEKIKVVNTEIAKLENSYYELPEKEMELSRLKNIQNLNEKYYTLLTEKQVLYSISNAGYASSNKILN
NASISNTPISPQKSLIYGAAIFMSLAIGIVLLFFRYVTFNEINQLPELQKLLPPRVSLLGAIPLVKQKMEHSKLIVNGAP
KSMLSEAFRTVRTNLSFVKNNPRTIAITSSISGEGKTFVALNLAGILAMTGKKVVVLDLDMRKPKIHLGLDAENDCGMSS
ILSGQKKVDDCLKKSCIEELDFITAGPIPPNPSELILSNKFKEVLTELKEEYDIVLIDNPPIGIVSDGVNVLAMVDLPIY
VFKANYSKRYFVNKLKEITELDEIKKLSVILNSVKMSKSKYGYGYYEEDAKRSIFKRNNT
>gnl|bykdb|A0A2G5L7B8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Reichenbachiella sp. 5M10] (length=787 residues).
MRPIHGGQNHNQSEGDPLSNIDFDKLNQVFIKNLPWIILILILFNAGTFLYLRYTKPIYSSESILKLDIKSDAGILGIQN
PMEQDIKGLSGEIEILKSRLFASQVVDAVGMNVSYFHPGRSHLYDERYGNSPFIVDVQVSDPSILNRRIDVEILSDDHFV
MDFELHGTSHRTRYPFGKKINTAFGELIVSKTIFFKEQQNLIDFYFVINSREALIDYFQQNIIVEPINFNANTIKIALAD
PNKYKARSLVQAIDTIYLNYTKAAKNQAVEQKISFLETQMYKSQIELEQFEDYFEKFTIKNRTTDLSQDLNYTIRLLNQL
DSQRFNIRTQIAAVELANKQLGEGTPITTLGLPKPFLEMLAEYNELKNERLLKLDTYNENTQIIKQLNSRIDLSQKAVHD
RLVSYQENLVTSQEELSKKRKILESNFAELPSMGTSYNKNRRLYSLQEEFYFSLIQSKIELEIARAGTVTNFVVLSPASM
PDAPIKPQKILIYGAGFMAGLIISFFFVAISYLLDDKISNSKELERLLMAPLLGVIPKYKAEKLQTTRLVVSTNPKSSMS
EALRSVRTNMEFMASGNGRKLISITSTVSGEGKTFIAVNLGAIFAYSGLKVVVIDLDMRKPKVHLAFGTEQTNKGVSTIL
IDKNTIDECVNNSEVKNLSYISAGPTPPNPSELIMGEKFNHFLEELKEKFDIVLLDTPPVGLVTDGILVMKKTDLPIYVV
RAEYSKKSYLKSVHNLITNNRFDNLSVIFNSVNQQGRYGYGGYGSGYYEDEVPAKRSWLDKLLGKKA
>gnl|bykdb|A0A2G6PRA9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=797 residues).
MNNKGLIINKSYDPLILRTVLRRYWWWAALLVLTFAACAWVYLRYTKPTYESSMVLQLGDKDNAKDVLNIENINSRENDM
SGVVELLRSELLFEKALNKLNLSVSLFSRGEILTEEKYLSSSFNIQPYELSDSSIINQEVAVVSKGRNKVELSYVKGGEK
QRVEGMLNEHIQNSDFDIVVKAADPDNFHKVSKENDLFFIFNGREQLSNRLIKDLSVAAIDPNAKTISISFRGHNATLCR
DVVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIAKDSLIEYQRRSQLSDPENVGVSINENANKLQDQLFEL
EEEYNGLLNVKRKLSKSPNRLEVYKLLPELLGRSYEASLAGHLRELHEFLERKEDLLFEVTENNSEIEIINQRITSKLNI
IQRSIAAIEERFSRNISALRAKIGVLEGEAFELPEKKMEFNRLKNIQELNEKYFTLLTEKKVLYEISDAGYASTNRVLSK
AKINLVPVAPSRNFVYSAFTFFGLFVGFGLILFRYLTFNEINTVEDLEQILPSQASILGGVPLFKQALEYSQLVVADAPK
SIMAESMRKIRTNLNYIHPNYQTIAISSSISGEGKTFVALNLGGIIAMSGKRTVLLDLDLRKPKVHLGLDVDNRVGMSSL
IVNQATLEECIHKSKVDNLDFITAGPIPPNPSELLLSKRFQEIVAELKERYDVVIIDNPPVGLVSDGIKNLTDSDIPIYV
FKSHYSKRVFANRVKELFTMQQLKSLNVILNGVKSNRSSGYGYGYGYGYGYGYYDNGYTEEPEVKRNKWYQRIFKRK
>gnl|bykdb|A0A2H0B957 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium CG23_combo_of_CG06-09_8_20_14_all_32_9] (length=804 residues).
MEQKNIPILNEKFDFNISLQVFKKSIILSVLVFILAAVGAFVYLRYTQLIYKSVSIIQLKNENTNANKILNLTNAVEEIN
SIQTIELIRSKEFLKKTFNKLPLGVSYYSQGTFLVSELYKATPFTVDFHITKGNLYNIPIYVSFSLNGDAAIKYTYNNQI
VQKSLKSNAWTDIGGFEIILNITDLAAIREQSNKIKTDSYYFTLNDSETVYQKYSSRLEVSLLNQEANTISISITDNNAR
KTSEIVNAIAEQFIKYDVEKKKESSQKILDFIEVQNNLIYQQLDSIEQLLIKFSITHQIQGDKESSTSNVNRYANLLTKI
EEDIDITDIEISSLKQILDEISKTPNINAYNLISLLPLKDNNILLSLLNQIQNLITQRDAYLNNQTKNSYQIKVIEKQIE
TQKQTLIDLIKSNYNRALERKSTLTKRLVEYELKVYGNSSAMDLDYLKIKRLYTINEEFYNKLLEKKAEYLISQAGSVSR
NVILENSSVPSFPIAPSRNSIIILFFIVALVLNTIIIIIRYLLYNEITMPDDIRTYSEVPVIGVVPLYKTKLPISQLLVD
IKPNSVFSEAFRSIRSNLDFLKNIPQSKTIAISSTIGGEGKTFVALNLAGIFAIQGKKVILVDLDLRKPRFHLCFNTDNS
KGVSTILVGKNKIEDCIKKSKIVNLNYITAGPVPPNPSELIAGKEISDFIYSLKEIYDVVIIDTPPLGLVTDALNVYKTC
DFPVYLVKANFSKRAFLYNINNLHEEKHIQNLSVVLNGVDLKKSRYGKYNYGYGYGYTDYHADYYDDSEKKKKKGFFGRI
ISHL
>gnl|bykdb|A0A2H0GAU8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium CG18_big_fil_WC_8_21_14_2_50_32_9] (length=803 residues).
MEEEQFSNKREPISNFNTELDIILLLKIFKRNLFLFIAIITICVVVSFVYLRYTIPIYQSQLVLQVGSENTANKVLQVDN
FSQKEDIAKDVELLKSKLLFKRALSKLQLKVSYYNQGNFLNNELYVGSPMKVNYAIKDSSIVGIPFFIEITKNNKFNLFE
NETLLGEFEVDTPIKLKQVDLKIQIDEYESLKDVKNNKMLFVINNIDDLTSRYISQLNIFPLNPSAKTINISFQDNNSTK
AKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQSNNKIGNPQEFSSIYLDRLNRFENQLI
DIDFQRNVLTEISKSVSGKLNTIDVYNLMPTLTGTEYEASISALITNLQGLLVQKQNLLGEVTVSSEASKSLDRKIEIQK
EVLFATISSLVVKLDARRKEVSRRVEEIQSKYLNVPANELEYARLQRVLSIDEKFFTLLMEKRTEYSISEAGFVPQHTIL
DKAVVSSIPIFPNKKIILATGILLGIVISLLLLILKYVFKNTISSIDEINRYAHSSAAFLGNIPIYSNEIPVSQLVIDKE
PKSVIAEAFRSVRSNLQFISNDENKKIIAITSTISGEGKTFCAINLAGIIALSGKKVVIIDLDMRRPKIHIGFGVKNTCG
MSTLLINRNTIEECIHHSELENLDFITSGPIPPNPAELIISGELEKVIEKLKKSYDYIMIDNPPIGLVSDAMETLKKADY
PIYVFKNEYSRKNFINNIDKLILENGIKKLSIILNAVDFKDKYYSYGYNYSYSYGQKNGYYYDSKEKETSLLDKILKKLK
LKK
>gnl|bykdb|A0A2H3NSN0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Longimonas halophila] (length=775 residues).
MNTNDQNALDIRRKKVEQIGLSRSDNSDTESNAVDLNTIWHTIKRGKWIILGTCLAMIAAFAGYTFMVAPEYEAAATVQV
EKPNQAQTVRFDIQPELSSEIGILTNSGSLAMRVITELRTAADTTDTPFQLFAAVDDEQPTDSEAMIRLFDMVDFAAEAD
QGLIRIVARSQYPEEAAAVANTYADAYRAYSRESARAGVAAAREFLETQLDRREEDIEEVENEWQQFARRHDVAIDGQDG
NRVATDYVEMMGQRDQLEFQLQEEQRTLDMLVNQLNEAESSFRSDVEGEQSVQSMQNRIAALDQQIADLEAQAEPYYINN
PDLRGNEDQVRELSQIKRQIEGLEDRKERLTAEMVELAADPEVRVGQGAALGRLTELRARIDEQEATVRQLQGQVSRLNN
RIGGYEDRIEEIPEQTVEREQLARRLDQAERFYRDIAMELQRTIVTEESELGYVQVIRSASIPALPVSPNIQQNLILGLL
LGLAFGIGGAFVRQAMNWQIYDPEDIQSQGFSLVGVIPDMKREIKSSFNGKESVDVEGRQLSTSLMPLLNPWSPVTENYR
LIRTNLQFAQANVEDMPEVLMITSPEPGDGKSTTAVNLAITIALSGRSALLIDGDLRRPTTHKMLGVDRSPGLAEMLTDS
TQREIVQRTFIENLYYVPAGTVKVPPTELLDSSRMRQLVALGRSRCDVVIIDTPPVLGATDALVVSSLCDAVLVVASANK
TDLRALKSVKETFAGVNVPLAGVIFNRFDPAQSQGSYAYGYGYDAAYSYAPTAEA
>gnl|bykdb|A0A2H3NWA9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Longimonas halophila] (length=808 residues).
MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVYHPEGNGVSQLREMAGLLWAHKWIILGVFVVVMAAAGVYTYTLPNQYQ
TSSLLLIKPDSPSTLVSTRGRMVPGLAGNRSLSNQLFVLRQSRELAQRVADRMDEMYPEGEGPPIMYTAETQERLSAQQL
AGRLMGRVQASPGGEEIDAIRLSATSTDPQEAALLVNLFSEEYVEFSRDRSRQSVQATYDFLKEQSESLRVDMEEAEQNL
VDFMQREEAVALDEETSSTVSRITSLESERAQLRIELEMTRARFNAQQDNIESIEPQLAERLASNIDSELARVQEERAEL
KQQLDQALERNSNLSPNPNGNALERELARTQERIDRLDTQAQDIAARYVDQALAAGGAGPGEDSERGVGYVAEQREQLVQ
QRIQISGMEARLSNIDEQLAENRTRLQELPAQSLELAQLQRERRSAEQVYSFVRQQMQETRMTLESEIGNAEVVRFAGVP
SVPFAPTPRQNMTLAALLGLVLGGGFVIIRDLLDTRVRQPDDVRATGEHLIGVVPSMDAIIQRDFDGERHIEIDGQKVPT
TLPMLVSPMSAVAESYRRLRTNLRFARPDDEVRTLAVTSASKGEGKTTTVANLALALASAGQRTLLIDADLRRPRLHTLF
DGNTSLPLVDILYDGLPDPEALRTSVDHLYVMSGGEKVPNPAELLGSQRMQTLLDDMEGEFDYVLVDTAPVLLFSDALAL
SPFCKGVVMVASSGTTDHRALEHAIHQMHEVDAPLLGCVLNNYKADDNSRYAYSYDNYGYAQSMKRLDDYYSDDNAPSKS
RLQQWLGR
>gnl|bykdb|A0A2I0QZ80 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Brumimicrobium salinarum] (length=771 residues).
MEVNKKKLFVNTTFDTNILKIVIKRNWYWCVLIFSLFIVLGFLYLRYTKPVYESRMLIQINSENQGADLLDLSDVRTEGS
IAKEIELLRSQLLFKKAIKQLPLQISLYAKGEFLTEQRYRQGNLEISPLLLKDSSLLNTPINITTEGNKIFLNFTHQNKA
HHIAIQPNEILKNNLFDIKMKVNDFQELKTDAETNQLYFVFNDLNTVSSRFHDDLSIRPIDQKAKTVEISYRSHSPTFAK
DIITALTKSFFKYDEGLKKESAENVLGFIASQLDSLTRELSISKDSVMRFQRNENITNPEHLSGSISSKIEFLRTEERNI
IEEIRVLKVVKEKLNSDPNSNDVYRLIPNIIGQSYEGSLTKQIQELYELIERKEDLSYKVTQNNDIIQKLEKRITIRKES
ITRIIDALIERTEEKLKITSKDIKELENRYFDLPEKQMELDRLINIQELNEKYYSLLNEKKVIYSISNAGYASNNKILNS
ASSASSPVFPVKSMVYSATLFLAFSFSIGLLLLRYLTFNQINQITDLNTVLPKNIGVLGSVSINKAKAVNSSLIVNERPK
SAISESFRTLRTNLSFVKQNVNTIAITSTISGEGKTFIALNLAGIIAMSGKSVLVIDLDMRKPKVHLGFGSDNIKGMSNL
LAKHCTVNDVIQHSQLKGLDFISAGPIPPNPSELLLSQHFEDVFKQVKTQYDTIIFDNPPVGLVSDGIQLLSKVDVPIYV
FRANFSKRYFVEKLKEISEIDEINNINIVLNAVDAKSNTYGGNYGGYYSES
>gnl|bykdb|A0A2J6HHN3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Marinilabiliales bacterium] (length=784 residues).
MKQKIAKFNDEFDFKLFLYIAKRNLKRIILFFIVLFLFLFLYLRYTQPIYESSTIVQLNSDDKGQMLFETKNLYDEDIYR
KIEVMRSPVFIRRVVSRLPLDVSIFAKGNILNSELYKSAPFKVYYELIDSTFYAESLDITIHDDHLNVSYMNLDGSMEDK
SFQPYESVVLPKVIFSVEPVDTVNFMQKFKNREFIVVFNNIDNLVYKYSRKINISVVSDAAKTIRISLRDINASKATDIV
NAITTEFELFEIEEQKQSSESILEFIDGQLGIVEENLTESEDSLYKVSVASPDSLEDKTGLKSRMRELDRLISKTKYEKE
VLSAFILSVENEENDVLFLISMLTGTESYTYLSPYLTSLQDLEFKRQEYLITMTENSTVIESIDKQISYQKRMIHQSAAS
LLDKMESDLRQQVNERNKIAAILGQREIDIPDDQSRLQRFYSVNEKFYNQLIEKKIEYSIAIAGYVSQLIVLEPARPNFK
PVFPNKKMIWFGGVAFAILISLGFIILKYILYNEVVSLKDVTRYTNVPVLGVIPKYKSHIPVSQLIVDSRPRSLLAESLR
AIRANLQFIKNGTTPKSITITSTVSGEGKTFVAINLAGVLAFSEESVIVLDFDMRKPKIHLGFNTDNEVGVSSILSGGED
IDKCIRKSALANLDFITAGPEPINPSELILGDRMDKLLEYLRTKYAYVIIDTPPIGLVSDAMKCMQHSDYPIYVIRANFS
ERNFVYNVERLYNENNFRYMSVILNNVDPDITGAGSSRGYAYGYGYGYGHDRYGYYEEEQVRRR
>gnl|bykdb|A0A2K8Z965 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Spirosoma pollinicola] (length=777 residues).
MTNESNYSYTTHQVVESEGLNLRNLISRYIKRWPWFVVSIGLMLAGAYIYLLDKQPVYKIQASLLVQDQQKGSEQNNTLK
ELGVFTPKQVVENEIEVLRSFTLMNRVVEKLHLNVRYYEATTFSKRELYEDSPIELIIEQPISALYKSPLDITLPGDNTV
TINEHVYPLNKSIETPYGRLKIVSRKATARIKKMIVQVSKQTSAAKSYLSNLHVIPTGKGSTVILISLEDGVPSKGEAVI
NQLITEYDQAAIMDKNKVAANTLKFIEDRLNIVSGELSSVEKNVQSYKSHQGITDLSVQAQSFLETVQQNDASLIQVNVQ
LAALNDLQKYVETKSENRGNTPPAVVGLNDPVLLGLITNLTTLEQQRDQMARTTSEQHPMLETINSQIRTAENNMAGNIL
TMKNMLLSTRQQYLAKNGEVEGAIRTIPLKERMLMDITRQQAIKNSLYTYLLQKREETAVAFASAIGDTRTIDFALSDDK
PIRPAKTIIYALFGLLGLVLPIAAIAGSDALNNRVMRRGDVEDVTHVPILGELVKKRHPGPLVISPNNQSVIAEQIRTLR
ASLPFLHSEGTESQVILFTSSISGEGKSFVSTNLGMSLAYVDKPTVILDMDLRMPKLHKIFNLDNTNGVSEYLLGEATVD
EVLTPIPGATNYYVIPSGSLPKNPSELLSSPKLKQLIEELRERFDYIIIDTPPVGLVSDARLIAPLTDATFFMVRHDMTP
KNHIKMIDKLYREQRFPQLNIILNAVDGTDSYHYSGYNKDYAYGGQPSRKIWQFSRR
>gnl|bykdb|A0A2K8ZAJ2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Spirosoma pollinicola] (length=769 residues).
MNMNPNVYTPYQTADVESKYNLGTLLIRYVRNWPWFMLSILLAQAAAYIYLLYQPLVYNVQASVLIKDERKGISEQSAMK
ETNIFTQTKLVENEIEILRSYSLMDRVVTNLGLDVQYYRPTRTLKKHIYQESPIRLIVEKPTSQLYMEELKFLFVDSKMV
KLNGHMYPVNQSIKTPYGQLRIFVRKPLSSKLKPIFATVSLHNDAVEGYLGNLKIGSTTMLSTVLVMNLQEAVPSRGEAI
LNQLISEYNKEAVVDKNNQASSTLNFIEDRLALISGELSNVEKEVESYKSTHGITDLSVQAEKFLTTVKDNDLQLNDVNM
RLGALADVERYVQSHSGRKGVAPATLGLSEPILTSLLTKAAELELKREDLLKTTSSGSPLIESLDSQLKNTNAAISENIE
TIRQQLISNRNQLVANNQRMEGMIRTVPGKERALLNITRQQGIKNNLYTYLLQKREETALSAASRVSDSRIVDPAHTTSQ
PVKPVRMMIFALFSLVGLVIPIGIITAKDMVNDHVLRRADVEEVTQIPIIGEVIKERQVGTESFVFKSRMHSVIGEQIRA
LRTNLLFLNGDAQKNQVILFTSSISGEGKSFISLNLGASLALVNRKTVIVDMDMRKPKLHKSLHLENKLGLSNYLTGEAD
IDNLLHPVIGHENYYIITAGSLPLNPSELLSSTHLAELFTKLKERFEYILVDSPPVGLVTDSQLIAPFADATMFLVRHDH
TSKKYIKMIDALYKEQRLPNLRIILNGVKEGESHYYSHNYGDYRELKKK
>gnl|bykdb|A0A2L2WX98 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. MGM2] (length=800 residues).
MENTNNATIEKEEAQLIPLLRLCLGQLKAHWVWFLFSVIACAALGFLYLQCQPRIYQRQAVILLEDTDGRSAMGRKASSS
MNTLLELNGISVGDNLKNEVFILSSQRIMERVVDSLHLDVDYTIKESLHEVSLYRNRPFRIEFSSECQRPEKFEVVKTGD
RKFALSNFERGKDKYKGKVSIAVGETKKTPLGNLHLIADTYIDKMPTGETVTVTRLPKKMAAASYCKQFSAGEYDKKESS
LIILGCEDINETRAEDIINVVFDAYKRDIVANKNRVANNTAIFIDERIRIIDGERIASRDQMAKFLSDNKLTDFEQSAQM
YLTESSAARKQRLELETQVAVARYLTQYLQNSSKRNETVPVLSLPEASFTPLIGEYNNQMLERNRIAGNTSETSPTIREI
DNRLASMRSSLLASIQSYVKSVEMELKEAGQNEAAINSQVGSLPEKQKVGLDIKQQLELKNTLYTYLLNKREEVALQMAI
SEANVRLVEGPLGSPLPISPRSNIILVISVIIGFFIPSLVLWIRYMLDVTISTRKEIEDATTIPIAGDIPRWDEGNERAL
IADVSSDMPIVESFRVLRYGLNFMRHSAKVYIVTSSTPGQGKSFISTNLAYILSRAQKRVLLIDADIRKRTTTKALGSSA
GLTALLIDEENELQLEDCILKNVQNTGVDFLPAGKMPPNPAELLMGDKLDDIIDEAKRLYDYVIIDTTPTLSVADAGIVN
RVADLTIFVLRVGVQDRGFLPELEKMYQAKKFRNLCIVINDSDVKRGYGYGYGYGYGYGYGYGYEKKKKKKKGFGIFRRK
>gnl|bykdb|A0A2M6GH67 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium CG18_big_fil_WC_8_21_14_2_50_42_9] (length=777 residues).
FITLLVVTRKSLIWIVFLIMLGLGASYLFLRYTKPVYRSSSTLKIDERSQAGALGLGGPLGNAAAEQNMVSLSGEVELIN
SDIIYRDLKENLNLKVNYYAMGNVLNEELYNNAPFKIDYEIRDGSFYDKEFKVNFIDNNTFKLVYLIGEEEITGEYKVGE
PINKKEIYLVLNRTPNFNPFVLEQNYHFVINSDGALNNYFRSNLAVEIINPSANTISISFTDFNPRKAQDIINRVDSAYL
VQKLLVKNQATQQQLKFLDEQIQATKDDVTRYEKAMQDFAIQNKTYDVRGEIAKSMARLEELYKERSDLGLQINLLRDIH
NLVAHDSDLEQIIPSLKQIEDAELSTKIAELSSLQRSYKILLLSYKKTTQTVKIREEEMRLTKEAVTELLQQNIDLLQNQ
TATLTRDINAIEAELKQMPARVTEWARLQRPFENVEGAYRQLINRRLDFNIAKAGTTADFQILQPASLPAAPIKPDKLMV
YAIGLASGLFLGIGLIAARYFMHNTITNLGEVERNTKAPVLGVVPRYTKEKLLVSKLIVHKNPKSAISESIRSIRTNLDF
ISSAKKKRLISITSTVSGEGKTFVAVNLGGIIALSDQKVVILDLDLRRPKVNLAFDAENNIGISTILIERHSVPECIQKT
AIPNLDFIPAGPTPPNPSELILNPKFDEMLEELRQLYDVIIVDTPPIGIVTDGTLVMRKADIPIYIVRADYSKKEFLKNI
NKVIKTNKFNKLTVILNDAKAQGGYGYGYAYGYGYSNSYYDLEEKEGVLTRLKRNFT
>gnl|bykdb|A0A2M7E2T8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium CG02_land_8_20_14_3_00_31_25] (length=806 residues).
MEQKRIPILNEKFDVNIFLQVFKRSIILSIIIFFAAIVGVYVYLRYTLPIYKSSSIIQLKNEGTTANKVLNLTTAVEEIN
SMQIIELIRSKEFLKRTFNKLPLKISYFSQGTFLENELYKANPFSIDYKNTKRNLYNVPIYVSFDKNGDSNIKYKTNNTN
YEKTIIKNQWTDINGLEIKIEVTDIDAIRTQINKIKNDSYYFIINDTESVYKKYSSQLEVSLLNQEANTIQISFKDNNAQ
KTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGITHQIRNDKDSKETGPERYSILLSKI
EEELDNVEIDISNLKQILDEISKTPNIKVYDLISLLPSKNDGILISLLNQMQNLINQRDLYLNNQTQNSFQIKVIEKQIE
TQKQTIIDLIKSNYNRALDKKSTLTKKLVEYKLMVYGNSSAMDLDYLKIKRLYTINEEFYNKLLEKKAEYLISQAGSISQ
NTILENSVIPTTPISPIKTTVILLFLIVALVINIILLIVRYLLFNEITSPDDIRVYSQVPVAGIVPLYKTKLPVSQLLVD
IKPNSVFSEAFRSVRSSLEFIKNIKESKTIAISSTISGEGKTFIALNLGGIYSFQGKKTILIDLDLRKPRFHLCFNTDNS
KGLSTILIGKNKVHDCIKKSKIANLDYITAGPIPPNPSELTAGNEILNVINELKQIYDVIIIDTPPLGLVTDALNIFKSC
DYPIYVVKAHYSKRSFLYNLNHLLLEKHIENLSVVVNGIDIEKSRYGGYNYGYGYGYGNSKYHTDYYDESITKKKKNIFT
KIISHL
>gnl|bykdb|A0A2M7NC69 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium CG_4_10_14_3_um_filter_31_20] (length=806 residues).
MEQKRIPILNEKFDVNIFLQVFKRSIILSIIIFFAAIVGVYVYLRYTLPIYKSSSIIQLKNEGTTANKVLNLTTAVEEIN
SMQIIELIRSKEFLKRTFNKLPLKISYFSQGTFLENELYKANPFSIDYKNTKRNLYNVPIYVSFDKNGDSNIKYKTNNTN
YEKTIIKNQWTDINGLEIKIEVTDIDAIRTQINKIKNDSYYFIINDTESVYKKYSSQLEVSLLNQEANTIQISFKDNNAQ
KTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQFGITHQIRNDKDSKETGPERYSILLSKI
EEELDNVEIDISNLKQILDEISKTPNIKVYDLISLLPSKNDGILISLLNQMQNLINQRDLYLNNQTQNSFQIKVIEKQIE
TQKQTIIDLIKSNYNRALDKKSTLTKKLVEYKLMVYGNSSAMDLDYLKIKRLYTINEEFYNKLLEKKAEYLISQAGSISQ
NTILENSVIPTTPISPIKTTVILLFLIVALVINIILLIVRYLLFNEITSPDDIRVYSQVPVAGIVPLYKTKLPVSQLLVD
IKPNSVFSEAFRSVRSSLEFIKNIKESKTIAISSTISGEGKTFIALNLGGIYSFQGKKTILIDLDLRKPRFHLCFNTDNS
KGLSTILIGKNKVHDCIKKSKIANLDYITAGPIPPNPSELTAGNEILNVINELKQIYDVIIIDTPPLGLVTDALNIFKSC
DYPIYVVKAHYSKRSFLYNLNHLLLEKHIENLSVVVNGIDIEKSRYGGYNYGYGYGYGNSKYHTDYYDESITKKKKNIFT
KIISHL
>gnl|bykdb|A0A2M7NLQ9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flexibacter sp. CG_4_10_14_3_um_filter_32_15] (length=829 residues).
MSDFDENPFINPAQAADASNEENFLADFDVSKLIRVVKKKLIYVIFLLIICVVASWIVLRYTKRVYSSSSTLKLEMKGTS
ELLGRGIFSSDENVTNFLVGEIELILSRSVYEEAVKRLDLNISYFVKGRWWFNYFERFQDSPFEVTEYEVYDASFYNRHL
DIQIIDEEEFVLTYQTATGEDFSKIYKFNTRIKNQYFKLIISLSDTFDKLKSTSDSYFFTLNSPEYQIAYIASSLRANVL
NPKAYTIQVSFTDNNPYKAAIVTNTVVDIYFEKTLENKNKVYRQTINYLEDQVRIVQDSLERIEKRIDNYKQENGITSQK
PEEYQALVQNILNDIRELQEKRVEMDNELKLYREISTLLEDDSTLLVALTYSSMLKDTNLKNRIEKVYDEEKEKKFMLDR
LTKQTAAYQQKEKKIELLKKEVDKFITLNQRMIYERLSEIAINIYKLQSSIPSSASQIDLELKKMMRYQDSYQQNYSILL
GKLIETSITMAGTVTNYQRLATAIPGTTPIYPEPQLFYIYGLGAWLALSVLLIGLTYIRQNKVDSLPELEKLSSVPILGM
VPKYNKPMDYSQLIIHKKPKSAISESFRSLRTNLDFMGNISNDTIISVTSTTSGEGKTFIAVNLGGIIALSQTKVVLLDL
DLRKPKVHLAFGVENTRGMSTLLIGKTSIDEAINHSEIPNFDFITAGAQPPNPSELIMSDEFKDLLKELKLRYDVIVFDM
PPVGLVTDGIIAMRLADLPIYVVRTEYSQRSYVRGINRLHQVQNFKKLSIILNAATKSTGAGYGYGYGYGYGYGYDYGYG
YYDDDDEKISLFKKTKKWWIKLRRKLSKK
>gnl|bykdb|A0A2M8ADX2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium CG_4_9_14_3_um_filter_32_8] (length=804 residues).
MNDEFNNKENKETVSNFNTELDIILLLQIFKRNLFLFAAIILACAVISFIYLRYTIPLYQSQLVLQVGSKNTADQVLKVD
NFQEQEDVAKDVELLKSKFLLKRSLLKLPLEVSYFNKGKFLTFELYKNSPLDVNYDIKDSSIIGLPFYIELTQNDKFKLF
ENETFLGEFINNQDIKLSKVDFKISIDGYEELKKSQSDIKGTSIFFTINDIENLTNNYISKLNVFPLNPMAKTISISFQD
NNATKTADIITALANEYIVYDIEERSKSSKKVIEFLDDQLDKYYNKVKLSENSIEEFQKTNKLSDIDKFSSLYIERVNKL
ENQLVDIDLQKSVLEEINNSVKGKIKEINVYNLLPILAGTEYEIRITSLITDLQSLLIQRQKMLTEATKESDLIKIQDQQ
IELQKEVLFKTIISLVEKLEARRKDAINKIDEIQNKYLNVPAKELQYARLQRVLSIDEKFFTLIMERRTEYSISEAGFVP
QHTILDKAAVPGIPFSPNRKMIMATGVLLGIVISLIILILKYVLKNTISTMDEITKFSNGAVGILGTVPTYNREIPISQL
VINRDPKSVISEAFRTIRTNLQFISKSEESKLMAITSTISGEGKTFCAINLSGIIAMSGKKVIILDLDMRKPKIHLGFGV
KNDKGMSTILIDKDQIKECIHHSELTNLDFITSGPIPPNPSELIISGKLDEVIAELKKEYDLVVLDNPPIGLVSDAMEML
KKADYPIYVFKSEYSRKNFINNLNKLIVENGIKKLSIVLNGVDYSNKYYSYGYNYNYSYGNKDGYYYDDTQKEKLTKRIF
KKKK
>gnl|bykdb|A0A2M8FTK1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium CG_4_9_14_0_2_um_filter_32_27] (length=803 residues).
MEEEQFSNKREPISNFNTELDIILLLKIFKRNLFLFIAIITICVVVSFVYLRYTIPIYQSQLVLQVGSENTANKVLQVDN
FSQKEDIAKDVELLKSKLLFKRALSKLQLKVSYYNQGNFLNNELYVGSPMKVNYAIKDSSIVGIPFFIEITKNNKFNLFE
NETLLGEFEVDTPIKLKQVDLKIQIDEYESLKDVKNNKMLFVINNIDDLTSRYISQLNIFPLNPSAKTINISFQDNNSTK
AKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQDFQSNNKIGNPQEFSSIYLDRLNRFENQLI
DIDFQRNVLTEISKSVSGKLNTIDVYNLMPTLTGTEYEASISALITNLQGLLVQKQNLLGEVTVSSEASKSLDRKIEIQK
EVLFATISSLVVKLDARRKEVSRRVEEIQSKYLNVPANELEYARLQRVLSIDEKFFTLLMEKRTEYSISEAGFVPQHTIL
DKAVVSSIPIFPNKKIILATGILLGIVISLLLLILKYVFKNTISSIDEINRYAHSSAAFLGNIPIYSNEIPVSQLVIDKE
PKSVIAEAFRSVRSNLQFISNDENKKIIAITSTISGEGKTFCAINLAGIIALSGKKVVIIDLDMRRPKIHIGFGVKNTCG
MSTLLINRNTIEECIHHSELENLDFITSGPIPPNPAELIISGELEKVIEKLKKSYDYIMIDNPPIGLVSDAMETLKKADY
PIYVFKNEYSRKNFINNIDKLILENGIKKLSIILNAVDFKDKYYSYGYNYSYSYGQKNGYYYDSKEKETSLLDKILKKLK
LKK
>gnl|bykdb|A0A2M9B9H9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter chitinivorans DSM 11115] (length=823 residues).
MAVNENAELEELIRSAGGAEPNAVEDEGGGLDLTTLLLVARRSILWIILLIALGLSASWLLLRYTKPVYKSSSLLKIDEK
TEAGILGLDGPVGQAVGSSNVNKLSGEVELIKSNIIYQRLKDSLELNVNYYVEGTVLENELYGISPFKVSYDIKDPNFYN
SKFNLNFTGGKQFRLSYLYLGQERSATYTLGQPVVVPGMTLVVTATPLLDEEALEKNYHFVINDDGAVNNYLNTNLSVDI
VNPDANTIQIAFTDFNPAKARDIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQKLQSAEENLQAFVRQNKTYDV
KTEVAGITEKLAEQEEVRLKLVEKARLLGEISRLVEQDRLTQNEDATLEQSIPGIAAVEDAQLTQQLSELNALQWNLRRL
LRSYNETTEAVKQQQAQLAYVKNNIRRLIQQNRRLVQTQIDRMNQQRDQFNAELQTLPQKETELARLKRPFELYEKSYLM
LMDKKVEFSIAKAGTTPDFQILSPASMPSAPISPVRTMIYAIGLAGGIALGLALIAVRYFMHNTVTNVRELERSTSASVL
GVIPTYDKEKMTVSKLVVDKNPKSAISESIRSIRTNLDFISGSSTKKRRLISVTSTISGEGKTFVTVNLGGIIALSEQRV
VILDLDMRKPKVNLAFGAENIKGISTILIDKHTILECVQHTSIPTLDFISAGPTPPNPSELILSARFDEMLEELYQHYDV
ILIDTPPVGLVTDGILIMRKADIPIYIVRANYSKKSFLKNVNKLIRANNFTRLCAILNDSTASGLYGYGYGYGYGYGYGY
GQGYYEETRPVVGLFSRLRKRFT
>gnl|bykdb|A0A2N0U0M7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salegentibacter salarius] (length=770 residues).
MKYNSKTGKEDNLFRYIIKTFFPFWPLFLVLIVVCILAAWGYLKYATPIYEASASIMIKDEEKGVDDSKIMESINPFDSK
KIVENEIEVLKSRDLMKSVVRDLNLYAPIYEDTGIKTISAYTSSPIRVIVQDPNRISISADEPEKHFFKYNANDEKVVFS
GKEYSLNEWFEFSAGQTIMFVKNDNVNKNASDPLFFYLLNPKMISSELIDELDISTSNKLSSVVNLTIRDAVPERAENIL
NRLILEYNRKIIKDQNELAASTMTFIDERIENVEADLDELEYKIEEYKSNQGVVDLSEQGRLYLQDIGENDKQISELELQ
LAVLNNVENYVISKGSAGGMVPSTLGISDPILSQLIEKLYNLEVEYERLKKTTAENNPVLTSISNQISKIRPSILENVKS
QRQNLQSRLANLNSNNRRFNSTLRNIPGKERTLLEINRRKTIKNNLFSYLLQKREEAALANVPTNENSAMIDKAEASIDP
VSPKPLFTYLIAILLAVGIGTGYVKGKEVLSGKVLYRSDIEEYTSIPVIAEIFYSKNSKGKRFTKPQDFVLIEQFRQLGA
RLGLYRRDIENKRILVTSGISGEGKSFVSSNLAFSLAQTGKKVVLVDMDFRKHKTSDLFNLSGSKGIIGLLKGEVTYDEI
IHPSEVNSNLFVIATGAKGDDYTEILLNGKLEFLMDSLSDDFEYVVIDAAPVNILAEVNLIAEFSEKTLLIIRHGHTSKE
SLKRLDESAGLQSLKNVSIVFNGLKNRGMIKTDYGYGYDLKHRMASYAKQ
>gnl|bykdb|A0A2N2WFW8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium HGW-Bacteroidetes-6] (length=802 residues).
MAEYKKSKLNDDFDFKLFLFIARRNLKFILVFFALLFALIFMYLRYTLPVYEASSVVQINSDDKAQKLFESKNFYDEDIY
RKIEIMRSPVFMERVIEKLPLDVSIFVKGNILNFELYDGAPFHIQYQIVDSLSYGTPYSLTVGDSTFVISTKTAGGTESE
TEFRFHETVSLPQVNFLLTPVAGDAKSFFAANNGKQFLIVFNSVKDLANSYSQKINIAVLNDVAKTIRISIRDMNPRKAA
DLVNKVAEEFAAFEVEYQKESSNSILDFIDTQLGLVEDNLDQTEDSMRQGKNMSFDSTLDRSSLQARLFELDNLLAANIS
ELESLDRFYNTFESGNSDFVVLLSLLSGLESQVYLAPYLQSLKELEMKKQDLLVHITENSTAVESVNSQIDFQKRIIRES
ASGIIAKLRREQQRYIAEKNKISRLLGRPLVNAPDEQNRIERYYTVNEKFYNQLIEKKIEYSIAQAGYVSQLIVLQPAQP
DYKPVFPNKKVIWIGVIAFAFILSLAFIILRYVLYNEVVSLRDVKRLTSVPVLGVIPKYKNYIPVSQLIVDSRPKSLLAE
SLRAIRTNLQFVKNGGLPKVISVTSTVSGEGKTFVAINLAGVLAFNEKSVIVLDFDLRKPKIHLGFNTDNETGISSILLG
LQNADECIKQSNIPNLHYITAGPTPLNPSELILSEKMDELISYLKEKYSYIILDTPPIGLVSDAMKPLQFADYPIYIVRA
SFSKRSYIYNIEKLYHENNLRYLSLILNSVDPEVTGAGSSEGFAYGYGFGYGYGNNKHGYYDEDEIKRSGWFQRLRDKFR
KK
>gnl|bykdb|A0A2N2WYB5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium HGW-Bacteroidetes-4] (length=804 residues).
MYQGKIPLINDKFDFAIFMQILKKSLWVSIVLILLSFFAAFLYLRYTQPLYSTQTIIQINENDRTTRLLNIEDVYQNDDI
SKVIELLRSKEFLKRAFSNLPLQVSYFSEGTFLSTELYKRSPFKVEWKTLNPSIFNTPIYIDFTDDKNGIITTYVKKEGY
DQKIELNQWTAIQGGEIKVSILNIDDIESQQEYYKSNRYYFIINNPQTLVDLHLQTLQVALQNRSAQTIQITYSGYNPEK
AADIVNTIAEEYLKYDVESKKESAESILAFIEERLKLVYQNLDETEKQLHEFKKENKLNLDKYPINGSPFPIFTAKISEF
EDELINIEFELVTLQRISTQVNVDNELNIYELIALLSGTKSEAILVSVLNNLQQLISEKEQLLNDVTPNNLKIKQLDKQI
SNQKNLLIDFINSTVQRLESRKNDYKTKIAEYEERLFSDRNFDELEYSKLDRLYTINEGFYHKLIEKKAEYLISQAGYVS
QNTILEKANVPAHPISPLSKKTYPVFLLMGLFLGGGFILVRYLLYDEITSINTIQNYTNAPILGTVPVYKKDIPVSQLLV
NRHPNSLFSEAFRTIRSNLQFISHGAETKIITVSSTISGEGKTFVAINLAGILAISGKKVVILDLDLRKPRIHLGFNTSN
NKGISTLLIGKHKLDECIEKSDLPNFDYITAGPVPPNPAELAAGKQMEILLVELEERYDIIIIDTPPVGIVTDALANLQR
ANYPIYVMKANVSKRHFIDNINNLIHVKNMDNLSVILNGVDVNQRRYGNYGYGYGYGYGYGYYAEDEETTIGRRLTEKLQ
KLKK
>gnl|bykdb|A0A2N2Y3E5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium HGW-Bacteroidetes-21] (length=808 residues).
MEERRIPILNETFDIPLFLLVFRKSLLYFTIIAVLCGAGAYAYLRYTQPLFQASAIIQLKDEADKTNKILNIQNIYDEFN
PNQTIELIRSKEFIKRVIKSLPLDVSYYSKGTFLETEQYRNSPFTVVFRNEGFKHFDVPIALDFENITDGWLYFQNNSSA
EKVKIKTGEWLNFYGSWLRIEIRDTAALLEYENMLKKDGLFFIVNNPETQLNKIIQNLVVGVLNFEAQTIQITYTDFNPQ
KTSEIVNTISEQFLKYDVEKKKESADKILDFIENQSDLIYDELDKIEEQLILFRKQNNIKTDDEKDLATYRSVIERITRV
ESDLEGIKVEVDTYNNLLDYLKKKDLSAVELIAIIPQNLNSSVLTSILSEIQSLIKEKEKAMNNLTTQSFQIKSIDKQID
NQREILKEFLQTSINRSTEKKNILLEQLKIFDSQLYANGTIDDIEYGKIQRLYNVNIEFFNNILGKKAEYLISQAGFVSQ
NIILENAITPTGPISPLKKNVMIITIVLIFVMSFFILFFRYLFHNEVYSVQDIRNYTDVPIIGTIPSYHDSIPISKVLVD
IKPNSVFSEAFRNIRSNLEFIDRDNGSKIIALSSTISGEGKTFVALNLGGVYAFQGKKVIIMDFDLRKPRIHKSFERDNK
CGVSTLLIGKTPLESCIFESNIKNLYYVTAGPIPPNPSELIKNASLHEIMEKLRTMFDIIIIDTPPIGLVTDALELFRES
DFQIYVLKSNYSKRVFIYNINHLFNEKKFDKLSIVLNKIDMSSSSMLGSYSHHYGYGYYSYETKSNYQEDAAKYYRKGFF
NFLKKKKK
>gnl|bykdb|A0A2N3IIZ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Raineya orbicola] (length=808 residues).
MAQYLTEEERFRRLLQTDDIDSGESPLEAIDFAKILYILRKNWYWLIVFPLLSVSLAYLYLRYTKPIFQSTANLKMEFKD
ESAGLDLRIGLNQENPIDNIAGELEVIRSPLIYEEVLKNIDLSVEYYAEGRILDNEMHGFSPIEVQAVVLNENLYNQKFY
IESEDGHSYNIEVKNDKKTLAEYKGKFGEWLKNKDVELLITQKMPLSTYSENIYFVLNSKGKSMNYLANNLEAFILNPQA
KIIAISFKDHNATKARDVLKSISEVYRVKSVEIKNRANRQKKEYLDAQIEKTEKELNAYEAEMERFIIQNKTNNIEGKIS
ELVNKIQQLTEERYKINAKLQTIIELEIFVNQRFVDSKNIPLMPDVDGAILQQISELNRLRQIRQNQELSETSATYSYQV
LDIKINNLQKNITESIDRYKKKILKELTEITQKLAEIEANFLGLPSKITEFNKLKKKYETVQSYYNNLIQQKIQIGLAEA
GTVPNFEIISPASTPSIPISPKKTLIYGIAGGIGILLSLLLVVGKYLLKDTIGSQQELEKSVSMPVVGAIPKYRKYKMEH
SKLIVHQNPKSAISESFRNIRTNLDFMFPRSEKETGQKVVSITSTISGEGKTFVTINLGGIIAMSGLRVVIIDLDMRKPK
VHLGLNGSNEKGISTILIGRHSLEECLRTTEIENLSYISAGPVPPNPSELILRNEFKELIKTLKELYDVVLIDTPPVGLV
TDAMLIMSQVDVRFFVLRANYSRRGFAKNIQKITSLHQIRSVGLILNAVEEQGKYGYGYGYGYYEEKNTPKTTSWFNKLK
MQLLSWKK
>gnl|bykdb|A0A2N3U785 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter ramchanderi] (length=777 residues).
MNKKDIFLAEPENFDLRGVLTKYLRYWYLFAATLLLSLAGAYTYLRYATPQYLISSTLLIQDNNKGASVYENSFFSELGI
FQTNQSINDEIELLKSISLMQRVVKDLSLYVNYYVEGHIKTEEIYGSSLPIKVVVSDLKQPAFGKTLRVQIKDKNNFVLN
DEEKETLHEFGQKIVLPYATFTVTAAPGFSTTNYSEVLVEFKDYRRVANYYRNALSIYPINKETKVIAIELTEPVPEKGI
DLVYHLISLYNKDKANDKKASAVNSLSFLDERIKFLSSELTDVEENVERYKRSNEVTNLDSDARMYVEKAADYNRQISEW
QVQIDVLQTIEDYLTKSKNKSILVPSTLNIKDPTLQDLISRFNELQLERQGLLRTMQPNNPLVVNLNDQLSNLEVNILEN
LRNIKQGLIVTRNNLQKSYAQFQTKKQLVPSIERDLLEINRQQGTKEGLYLYLLQKREESALSLAADVSNIKIIDEAMVS
LDPIKPVRKLIYLAAIIFGIALPVAFVFLKDQLNHDIQHKKDIERATETPILGELAHNEEKESLVVTNKNRTSVAESFRL
IRANLQFATVGGENRVILITSSMSGEGKTFFSLNLAASLVLTGKRVIVLDFDLRKPKLMHYLGITHEKGITNYLISETPS
IDDIVVQSPQIPELYLIGAGPVPPNPSELMLHPRVDKLIEDLKAIFDYVIIDTSPIGQVADALALSPYIDSSIYIVRYNY
TSKEQINIIDEIYRNRKLKFPMIVLNDAKRKNGYGYGYGYGYGEQKKNHNFNKNVKV
>gnl|bykdb|A0A2N5YXE2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Marinilabiliales bacterium] (length=819 residues).
MENKIPIFNQKFDPRTFFTIFKKNFWLILIIFVVSLAAGYAYFRYTRPVYKTTTVLQIKNENKTNQILGINAGVMETDLA
PVIELVRSNEFLKTVVASLPLDVSYYRQGTFLYTELYGNTPFEVNYRINNTVILDQKVNIEFVDYKCHLYYKIGNQDYEY
LISPEEWQSVFGMEVFIHFPSKKDMEFELNPDNKSQYFFTINNTKTVLTNIASNLEIQVLNENAGTILITYNDYNARKSA
EITNTIAEKFIEFDENKKKESANNIITYIDQQMENVFLQLTNTEQNLHDFKQQNNIRSNTETLLFNKTNLYTTKMSELES
KLLNVDFEIMTLEKVSEKIEKDPELKTYEILAMLSGQQSETFIAGMINSLQELLNKKEILLFDVTANNHKIVTIDEQIAT
KKATIVDFIGSTIERLKSEKSEYSRKISEMENQVFVDSSYDEIEYARLMRLYSINEDFYSQLIKTKAETMISQAGYVSNN
LILEKANIPVAPDYPILSTVMLMAFIIAFVISVLFILLKYLLYNKILSTIDISDYTKIPVIGGVPVAKISMDVSQVVVHQ
RPKSMMAESFRNIRSNIEFYPAKNKCRIITVSSTIAGEGKTFVGLNIAAIYAMMGKKVIVLDFDLRKPRLDKCFSVDNIK
GVSTILINKHSYQECVRHSEIENLDYITSGPLPPNPAEIILGEKLNTLVQEIQKDYDLLIIDTPPVGIVTDAMITYKLAD
NPIYVMRAGISPKSFIENVNLFVSDSKVENMSIILNGIERSSGRYGYGYKSGYGYQYGYATYGYGYGYLTKIHNTYYGEE
VEDKRNIFQKIADKLKRKK
>gnl|bykdb|A0A2N5ZWN6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salinivirgaceae bacterium] (length=802 residues).
MQKNKIPIINDTFDITTFKRIFIRSFWMGIIIMMLVIGGAFLKIRYTSPVFEAKSVLQIQEDNKNTQVFQLDNLYEDNKK
LSKTIALIRSKEFLKRTFSKLPLETRYYIEGAFLSTETYNNSSYSVNYEIQNPSIYGEPIHIQFIDENNAKIEFEIGDNI
ITKDIEINEWNELGYFKIFVTINNFAAIQSMYEKESQNSYYFIISNMDQIYSEHSAKLTIRLLNSSSNSIEITYESNNSQ
QAADVVNKIAQEFQLFDVEKKKESVKNILDFIERQLKNVYQTLDNTENKLQQFKKDNNIPSDAFERSPFPIFTSKIEEFS
EQITQLDFEIFTLENVNDQLKKQGQINIYEMIATLAGTSSEKVLVNILSNLQQLINEKNQLLNDVTENNMRIKLIDNQIE
NQRRLIIDFVNNNLSRLKEKRAEYQKKTEEYENKIFEEESFDKLEYARLLRLHAINEGFYNQLIQKKAEYMISQAGYVTQ
NVILEKANSNLQSISPNKKQILIGSVAIGFVLYLIFIFVKYLLFNEITSISMIKSYTKSPVIGVVPAYKKKVPVSQLLVN
EKPNSMFTEAFRNIRSNLQFLSPGSGSSVITVTSTISGEGKTFLAINLAGIQAISGKKAIILDMDLRKPRLHLGFNVSND
KGMSTILINKHNYKDCINHSEQENLDFITAGPVPPNPAELVFTKKMDELIEELEETYDVIIIDTPPIGIVTDALVNLQRA
NYPIYVLKSGLSKRNFLENINSLIEDKKLDNLSVVLNSVDIAKRRYGYGYGYGYGYGYGYGYYSDENEKTRKNFVKKLFK
LK
>gnl|bykdb|A0A2P6C1S6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salinibacter sp. 10B] (length=796 residues).
MASTNGHPGSSQSVSVEDLLYEDTTSRRSSQLHDLIQTLWEGKWIILGVVTAVVLAAAAYMYTIPTTYRTSSLLLVDRNQ
QSSVLSGLGRGRTSPFLQQDQTLQNELLILRQSRTIANRVARQLQRMGTHPDTGQPLQILRGPEGEQRSISAVAGQVQNM
ISAQPSGEETDALYISASSHHPNEASLVANLYAEEYIQRTQERSREDLRASRQFLEEQADTLRQDVQAAEQKIEEYMQRE
NAVSLDQETGRVVQQISELEAQRAELRIELDMQQAALETQKEELGTIEPKLAERLSSSLGQRLSSLQTEQAELESKIDRV
ERNNPDLEPTSQLGRELQRMKTRAQTLARRTDSLANRYVEESLSAGGVASSSGEDGGPSGVSYVAQQRREIAQKRIEING
LQARIGAISDRLQENRQSLQEIPRRSMALAQLQRERRSAEQIYSFVQEKLQEARLAEQSEMGYAEVIRPAGPGYPVGPDT
RNNLMLAFMLGLVLGGGLVILKEQLDTRIHQPADLRDHGHQVLGVVPSMTRQIEDEFGGEDTIEVEGQELRTTLAMIVSP
MSAAAEAYRRIRTNLQFARPDDEVHTLAVSSADKGAGKTTTCANLALALASAGERTVVIDADLRRPWLHELLGLHREPGL
SSILYEDAPSFEQFETGIDHLSVLPAGAEVPNPAELLGSGRMKQLIDTLDEQFDYVLIDTPPALLFSDMLGLAPHCDGSI
LVARAGETDGHAFDHTVDRITDVDADLIGCVLNHFDASSILYSDGSNYGYAYAYQQLQDYYEDTERGTVQKSLRHW
>gnl|bykdb|A0A2P6C324 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salinibacter sp. 10B] (length=788 residues).
MNDTSQNLTPYRKQAEKIGLQSSNSGSDDNTLDLGALWEAVKRSKWVILGTCVFVTALTAAVTMMMPQVYEAGAVVSVER
EAAPARMMVGLNEQRDLSSEIGLLKNSGELARRVVSTIEDVADTTQGVQFTLLAPVSEEEPYTQYAAILRLQEMVSFVPD
QQQGLINIRVESQDPAEAALIANSFAQQYRLFSREMARAGVVAAREFLETQLEKRKDDIRAIENEWEAFARSNAIVTEGL
DGQNVAAEYAELQSQRDALTFQLEQEKRTLSILEDQMERAQPSLRSAVLKEQEVQSLRTQIQALEDQIAELKARAEQYYI
NDPTLRGDESRVRELAEIKRRIDGFEDRKMDLTEDLVEASREASGTAGGVATAEGGGIASIGQLGTLQGRIEEQTIKIEQ
TEAQIQALEDRISGYQGRLESIPRQTIQREQLDRRLTQAEQFYKDIAMELQRTIVTEESELGYVKIMRSAVIPMLPVRPN
MKQNLVLGLLLGLGLGMGLGFLRQSMSWQIYEPDDIQAKGYSLVGVIPRMDREIKKTFNGSDVVEVEGRKLSTCLFPLLN
PWSPITENYRLVRANLQFAAAKNHRDHGQSSQIMMVTSPEPGDGKTTTATNLATTIALSGREVLLIDADMRRSNAHKMIG
VERSPGLAQILEGETGLDTIIDDTIIEGLHVLPAGEPSVPPTELLDSERMRGLLASVATLYDIVIIDTPPVLAATDPVVL
APNCDVVLVVASADKTDFRALSQVESTLEAVGASIGGIIFNRYDATRAGGANKYGYGYSYKYDYAPVE
>gnl|bykdb|A0A2P8EAX2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cecembia rubra] (length=779 residues).
MNQNKARNKGAGEPIDLFKSVRLLLPYWPYIIASILLFVGLSFLYLKSATPFYEITSSVLIREGERAGNLTESPILSDLE
NIKTTVKLDNEIEKLRSKSLLNEAVISKSAFVTFYDKIGIFKREISPYNVSINIVVHEFNEEFLLEGEVFTIKVLNEKKF
EIEFAKNKKTEFNFGDKIKTEFGVFSLEKKSEEDAISFPFSTFVVRLENPIVKTERYAKALNFEQSSVKSSTLFIRLLDS
SPTRGKQILNSLIEGYNTSNQNQKNEVALKTIKFLDEKLFLAKKELDSLEMYVERFKQRNRVTDIGLDSRIYLESTASTS
KEISELSNKIEILESIESLIAVQGSGNETIPSSFVTLDPTLSELLSKYNDLLRERQRISRIVQPNNQQLISLNEQLSSLK
SNILQNIRSNRSNFEITRKNLEENLNVNRSQVQRIPVIERELMEIDRQKGIKQEHYQYLLRKRDESALALEVSGVSSLQV
IDAPTASVKPVSPKKLTTIGIGFLAGLALPIIVLFLKYNFSERITSKKIVEGITQVPILGEVGKNEEKGYIVVKPGSISP
PAEQFRLIRSNLGFLSKNENQVIAISSSMSKEGKSFTSINLAISLSLVGKKVVLVDFDLRRPSILKALNLNSEISLNNYF
NESINDFKKIIIPSGIDENLSVLGLNTYIENPSELINSNKVLGLLKSLRSSFDYVIVDTSPMGLVADPLSLSEAVDVLIY
VIRLNYTKVSQLEEYEEVVQNNIFKRNFLVLNDAEKLSSSKFGYGYYSSDKSIRVKHKA
>gnl|bykdb|A0A2T2S682 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium QH_10_64_37] (length=829 residues).
MPRSSSFEYAGDGHPGNGRSAPDDEPSLYDSAPDGPTGVDRLRALLSTLWGGKWILLTVFVLVVGTVAVYTYTRTPQYKT
STLLLVDLGQSRSAVPSLTGGRSSGASALGGQRRSLSNQILVINQSEALAQEVAVRLDTMGTHPRTGKPLDVLTTPSGEG
RSRAVLAGLLRRRVRAQSAGREVDAIRITAQGPVPAEAALIADQYAAAYLQRTREKSRESLRAKRDFLDQQSDKFATQVQ
QADRALAKYMQKEEAVSLDQEASRLVQQLSELEARRDELRIELDMAESALNTKKKELKRIRPRLAERLSSGIQTELKQVQ
QEKANVAAEINRVKTRNPNLDADASTARAKNLRQLQRRADRLERQADSLADAYVEKTLAAGGIGAGEGGEEGGGERGISY
VVQLQRQIAQKEIQVNGLRAQISTVERQIEENRTRLQNLPPKSLQLADLKRRKQSLEQTHSFIRRKLQETRMSIEEEVGF
AERIRSAGIPGRPISPNSQRNLILGALLGLLLGGGLVVLREKLDTYVRTPADVEALGEHVIGVIPSMQPTIESEFGGKET
VEIDGREIQSSLVMLTAPMSAAAEAYRRLRTNLRFARPDTNLRSMVVTSPGKKQEGKTTTATNLALAQARAGQKTLLIDA
DLRDPKVHRYLDLSKSPGLTDALYDAPDPSDLPAPAENLRVLPSGDEVPNPAEQLEARRMRRLIAAMEQAFDLVVVDATP
VLFFSDALVLGTHTDGVLLVASANGTDGPALTQVTSQFDEVEVARLGVVLNRFRPDQQRAGYGYGYGYGYGYGYGYGQYD
DDALAAYRNGENGRSRSVSERVRDWWNGG
>gnl|bykdb|A0A2T2USC0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium SW_11_64_17] (length=835 residues).
MNGQVGGMPAPQEDEITLQEIIGMLWGGKWVILATFVVVVALGAAYTFTQTPIYESSNLVLVEKQQRQVSSILGEQGSSF
SPFGSQNNLANEVLVANQSEAITRNVATRLDSMETNPYTGEQLSVLTGPKDPSDTSEQSASETVAGLLMSPEEERRTVSE
IAGDLVSQGGKATMSASAAGGNLAGQYESADAINISVKGVSASEAALIANLYAQEYINYNERKSKESARSTRKFLEQQSK
KFRNRVNRAEQRLEKFMREENAVALDQETQQIVQQISEMQARRDELQIELDMESSALQSLKEELANIRPNLAERIASGLG
EELSQVQKEKAEVASEINAVRRNNPNLEPGDSSPKAREFARLEEKSRQLSREADSLAQQYVQQTIAAGGVGSIPAKGEET
TRRGQGRGLSYVVDLQRKVAQRRIEVNGLQAQLETVQERLDQYQQELNTLPNQSLRLAQLQRERRSAEEIYKFVQEQLQE
TRMAEESEVGYAEIVRSAGVPSGPVSPNTKLNLVLAAFLGLLGGMGLVFLREALDTKIRTPEDLEDLGPKVLGTVPNMDG
LLGAEFGGDDTVDIDGHPVRTDLVMLTSPMSAAAEAYRRLRANLQFARPDAPIRSMVVTGPNKGDGKTTTSTNLALAMAS
AGQRTLLIDADLRRPRLHKYFDIDRSPGLAEALYDESILADEGTTDPGIDNLSVLAGGREEIPNPSELLGSQRMCRLIER
AEEAFDLVIVDTSPLLLFSDPVSIVSHTDGALIVVEANRADRPAVEQALSLLEDVDSEPLGAVLNRFDPERAESYGYGYG
YGYGYGYGYGYGSDYAYQYGDQSIQDYYEEEEEGD
>gnl|bykdb|A0A2T2UTM4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium SW_9_63_38] (length=803 residues).
MASTNGYPSGEEGPGSRSLAVEDLLYDNSDRRSSQLHDLIQMLWDRKWIILGIVAVAVLSAAVYTYTIPATYRTSSLLLV
DREGQTSVLSGLGRGRRSPFGQRDQTLQNELLILRQSRTIARRVAKRLQDLGTHPETGEPLQILRGPEGKRRSTAEVANQ
VKGMISAQPSGEKTDALYISAKSHHPYEVSLIVNLYAEEYIQRTKEKSREDLKASREFLEEQADTLRQEVQAAEQKIENY
MQEEKAISLDQETGRVVQQISELESKRARLRIELDMKQATLETRKEELRQIEPKLAERLSSDLGEKLSTFQTEKAELEVK
IDRVERRNPDLDPTSRLGQELQRMKARAATLDRKTDSLASRYVRESLSAGGVAAGGGGEGGGSGVSYVAQQRREIAQQRI
EVNGLKARIAAITNRLAETRKKLQTIPRRSMQLAQLQRERRSAEQIYSFVQEKLQEARLSEQSEMGYAEVIRPAGRGYPV
GPDTRKNLMLALMLGLVLGGGLVVLREQLDTRVCQPADLRDHGHSVLGVVPSMTPMIEEELDGQDTVTVDGRTLQTTLAM
IVSPMSAAAEAYRRIRTNLQFARPDDEMQVLVVSSAEKGAGKTTTCANLGLALASAGERAVVVDADLRRPWLHQQFGLER
EPGLSSALYSEVPALEAFETGIDNLSIIPAGTEVPNPAETLGSGRMKKLIETLDEQFDYVLVDTPPALLFSDMLGLAPHC
DGSILVARAGETDGHAFDHTVDRLHDVDADLLGCVLNEFDADSILYSDGSNYGYGYAYRQLQDYYEGEEVRVASRSGWAS
WWR
>gnl|bykdb|A0A2T2V0F3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium SW_7_64_58] (length=839 residues).
MHDGSAPSGNGHSNRWNSMNPVNGQSQPSGEHGARDDEITLQELVGMLWGGKWVILATFAVVLALGAAYTFSQTPIYETS
SLVLVEKQGEGVSSILSESGSMNPFGSRRNLANEVLVANQSEAITRNVAVRLDTMETHPRTGEPLAVLTGPEGERRTVGE
IAGDLVAQGGKATMSAAAAGENLGNQYESADAIRISVRGVSASEAALIANLYSQAYIDYNQRKSQESARSTRKFLEQQAS
KFKNRVDRAEQELESFMQEEKAVALDQETSRIVDQIANLQTRQDELRIELDMKQSALTSKQEELANIRPNLAERISSGLE
EELSQVQREKAQVTAEINAVKRNNPDLDPGGTSPKAREFARLKERARQLDREADSLAQKYVSEAIAAGGIGSIPAEDRQG
GGRQQGRGVGYVVELQREVAQKRIEVSGLQAQLETVKQRLAEYQQELNTLPEQSLRLAQLQRERRSAEEIYKFVQEQLQE
TRMAEESEVGYAEIVRSAGVPIDPVSPNTRLNLVLAAFLGLLGGMGLVFLREALDTKLRTPEDLEALGPKVLGTVPSMDG
LMEEEFGGSDTVELDGRTVPASLVMLTSPMSAAAEAYRRLRANLQFARPDDRVRSMMVTGPNQGDGKTTTSTNLALAMAR
AGQRTVLVDADLRRPQMHKYFAVDRSPGLAEALIDESILTEEKTMETSIDDLSVLTAGGEIPNPSEMLGSERMGHLLGRL
EDAFDLVIVDPPPLLFFSDPVSVVPHTDGALVVVEANEADRSAVSQALSLLDDVDSPALGTVLNQFDPGRAGSYGYGYGS
YGYGYGYGSGYGYQAGDKSLQAYYEEDEDDQSTGLFSFL
>gnl|bykdb|A0A2T2YJE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Adhaeribacter sp. HMF7605] (length=812 residues).
MTNKESIVLEELENNYAAAVEVEEDSGGSDIDFIMLLSIIRKSLIWVSLLIVLGLIGAFLFLRYTKPLFKSSSTLKIDEQ
SEAGRLGLGGTIENQQTLSNLSGEIEIIKSNFTFERLQQKLPLDINYYSIGNVLNEELYKNSPFKITYQLTNEAYYDRRY
NVTLLDATRFNLSYLEGDQEITEEHTIGKPVEKPGFSFTLTLRVPLSADVIAQKYYFIVNSNAAIRQYLTSNVAVNIVNL
DASTVEISFTDHNPFKAHEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGNSEIQMENFVKENKTYDVRAD
VSKSITKLEELNKERINLHLQISLLNEVDQLLNKSSNLDQMIPSLKELDDAQLLKQIAQLSDLQLDRNLMVQSYKTTTKA
YQLLEEEIKFVEQSVRKLLAQNIVLLQKEVALVNSNIRHIQQELLQMPGKETKRARLQRLFDLHEKFYLMLMDKKVEFGI
ARAGTVPDFQILAPASRPGAPIYPNKLLVYGIGLAGGLFLGLGLIAARYLLHNTITSLPELERSSQAAILGVIPRYRKEK
LPISKLIIDKNPRSAISESIRSIRTNLEFISSSKSKRLISITSTVSGEGKTFVAVNLGGIISQSNQRVIILDMDLRKPKV
HLAFDAENTKGISTILIDRHSVAECIRHTAMPNLDFISAGPTPPNPSELILNTSFDEMIEELYHSYDVIVVDTPPVGLVT
DGILVMRKADIPIYIIRAGFSKKTFLKNMNKIMRLNNFTKMCTILNDADGLGAYGYGYGYSYGYGYGYGYTNSYYEEEKP
DSFFTRFKKKFT
>gnl|bykdb|A0A2T5YE44 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter mucosus] (length=774 residues).
MDKNKTNSEDNLAVALLYKFLPFWPLFLVLLVLGMAGAWAYIKYYTIPSYAVSASLLIKDEEKGMNASKIMESIDAFNTN
KTVENELNVLRSSALMSQVVHKLKLYAPIYEEDRFKSIPAYTTSPITISLKSPETAAEYPAVYFTFDQATQKVKIDGKEY
PLSTWVVTPYGEMLFEKNLLQNGSAQNPLFFSINNPKAVAKQLISRIYVESPGKASSVVNLYIEDNVPERGEDILNALID
AYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVKYRSSNGAVNLNEQGKLYLQSVDFNDRRMNEINLQLAVLD
NVEKYVLSKEQNIGIVPSTLGVSDPVLSQLLQKLYNAEIQYQQLKKTTAENNPLLASLREEIDNMRPGVLENIRNQRSNL
LASRDKVASTSSQYSHVLQGIPQKERELLEISRQQAIKNNAYSFLLQKREETVLSYAPSAEDVKVVDRAEASRGPVSPRP
LYIYLTSVILALGAGIALVTGKELLNSKVLFRSEIENCTNAPIVAELSAAKYKGRKTLLGPDDVAQVEQFRQMRVTMGLY
GRTFTRKKIMVTSSIPGEGKSFVSSNLAISLASSSKKVVLVDFDLRNPNTSVLFEKANEPGIIEYLMDKAQPGEIIKPSP
YQNLSILPAGINIGDHTELLLNGKIEELFKILEESFDYVIIDTPPLDLVSDAYLLSEFCDITLLIIRHAYTPKSLVQRFT
QDNKLKQLNNVAIVFNGVKPRGFVKGQYGYGYGYGYESKYGNKSYKPRGLAVNS
>gnl|bykdb|A0A2T8HKA9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Sphingobacterium sp. 2c-3] (length=777 residues).
MLKDTNIAGAEDKSINVLDLLKYLFVHWKWFLLSVLFFGGYYYYQYSKTPFVYSKAAILMIKTPQNTNVTARFTRSSMMN
TVSVASEILQLKSKELMRHTIATIQGDISYSKTEGLRNIELYKDSPIRVTFTKLDPEAHASMTIIPKDSNHVDFLLMEND
NIIHSQRIKLREETTTPIGKLTISSNKLYKPSIFGEEITVTKIPRETMVSYFLSRMKIVQIEDDAGLLQLTLEDHSPKRA
TDLIKTLIEVYNEQTVEEKNRVAVSTADFIRERIAIIERDLGTVETDLERIKMDNKGMDVNEAAGMYITESREYLNASRE
LETQLSLAEMMRDYIYDAGRSEKLIPSNMGLADLNVDRYISDYNSALLRRNRLLEGNNSNNPYVQELDQYLSSNRQNIER
AVDNAVSGLQIRVRNAQRDMASAQKDAISMPAKQRQVLGIERNQKVKEELYILLLNKREENALNQAMADDNIRVIDPASG
SDFPVSPNKVRKLAIGIGIGIAIPTAILLLILFLNTSVRDRKDLEKSLTVPFLGEIPFSKNSKKNVHVIVREQATDPVTE
TFRILRTNIDFMSNGKSKQVITLTSLTEGVGKTFCAINLATSLAFLKKKVLLLDLDLRKGTLSAKVNVPKTKGVSHYLAD
RSVSLQDVLYKNEISGIVDIIPIGVVAPNPVELLLSDRLDSLIAELKELYDYIVVDNVPVGVVADSSIINRISELTIFVI
RAGKMDKRQLPEIENIYQQGLLNNMGVVLNGIRKGRAGYGYGYGYGYGYGYGYGAKK
>gnl|bykdb|A0A2U1FKU2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas loveana] (length=825 residues).
MPTEEKRITPYGGASRSESGEDISFFSVEEFLFSLLSSWKWIVGSVVACALIAYIYVQNQSPVYHAQATVLIKSAEKNGV
SGGLSQFQDLGLLMGNSEVENELLVFKAKRLTAIVVDKLNLDLTLSKDGFWRKESLYANSPLSIKITNRDSTEGYSFRIQ
IKDEKTFRLTHFKRHAGRGLSGMEVDGTFGQPVATPVGELQIDQTPFFVAAWKGQVVYVVKEDMRKVVERYNQELQVALA
DKKSTIVRLSLNNTDLDRAKDFINTLISSYNDDVMNDKKSVAVSTATFIDERLAMIGGELGSVDTEIETFKKQNNITDIT
TDVGTYLKNSSDLQKDQLIVERNLSLAKYIQAFLRQTNSDNELMPANLGLTEQGIDNSIAQYNELKLRYDRLKQSSSENS
PAVQEAAMQLVSMRKSINVAVDNYIKTLSLQLRDVNKEMSRTREQISAVPTREKIMSTILRQQKIKEELYLYLLNKREEN
ALRLAITESNAKVVDAADGSSVPVAPRKMVIFMAALLLGVAIPTLYIYLRMQFNKTVRGRKDLEDMAIPFLGEIPAYEGQ
RNEEDVDVVVNAGSRDSASEAFRILRSNMEFMRVKSPDMKVVMFTSANPGSGKSFVTMNLAISIALTGKKVVVVDLDIRK
GSLSGRLAENNVGVTDYLYKDTLTVDNLITHSPYSENLDVILAGPIPPNPAELLLSDRLTQLIGELRNRYDYVFMDSVPA
MSVADAMITNRVADLTVYVIRQGLLDRRYLPEVERLHTENKFVNMCMILNGVTYTSSSSRYTYGYNYGYGYHAHDKHDRK
NSGSRYASQAKKKFRMKHLKRTNHG
>gnl|bykdb|A0A2U2XBJ3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Brumimicrobium sp. C305] (length=771 residues).
MINQRGKIFVNTTFDLKVLKIVIKRNWYWCALISILLVVSAFIYVRYTKPVYESSMLIQLNSENQGADVLDFKDIRKEGT
IAKEIELLRSQLLFEKAVADLPLTVSLYAKGEFLTETLYKQGVVRIMPLIIKDSSLFGTPIFLSSMEDKIIMNFKFNGGN
YNYKFAPNSLLKTPFFDMRVIVDNWSQFVLNSTSNKLYFELNDKSTMSRRLRPGLTVTPVDANARTVQISFRSHSPLLAK
EMIQSLTANFFKYDENIKKESADNVLEFIAVQLDSLTRELKMAKDSIMVYQRMENITNPEQIAANTSQKIEKLRTEIRQG
MEELRVLNSVQDKLEGNPNSLDVYRLIPVIIGKSYESSLNSQIQELYNLIEEKEDLLYQVTPQNENIKKLEMRIQIRKEN
IDEVIDLLSQRIEEKLAIIREDLEEFEDSYFQLPEKQMELSRLNNIKELNEKYFSLLTDKKAVYSISNAGYASDNKVLND
ASASGSPVFPKVELIYGVSLFLALSLSLAFLFLRYLLFNEINQLSDLKAIIPRKVGVLGSVPQNKNKETYSLLVVDNNPR
SMISESFRALRTNLSFVKNDIRTITVTSTVSGEGKTFIVLNLAGIIALTGKKVLVVDLDMRRPTVHHGLEATNEKGMSNL
LARLCHKEEVIQQTRIQNLNFISAGPIPPNPSELLLGSRLDELIVEFKKEYDVVIFDNPPIGLVSDGVRLLTKVDVPIYV
FRSNYSKRNYADKLHEISAIEEMKNINVVLNAVDAKKSLYGYGYGNYYNED
>gnl|bykdb|A0A2V1IJY1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Duncaniella muris] (length=798 residues).
MAETIKSEARKSVNAGSAVPLTDILYRTLHHWPWVLLSLVVCVGAAVVYLLCTPKVYTTTASIMIKDEAAGKSAGAEDFG
DFGLFQNKTNIQNEITTLKSADLMEEVVRRLNLDMNYYIPGRFHDVVAYGSNLPVRVEMPGFAENGSALFRVEVDGAGKV
SVSDVKSGDLKSEERVQGAMNDTLMTVVGPMVVVAAEGYKPGEAVELNVVKAPVSATAGGYESRMVIAMSGDKSSVINLT
VTDQSTQRAQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKSQHLIPDVSAASSMYMSQN
QQISQQIMDLRNQLKQTLYIKSYLGAASDNEKMLPMNSGVANVDIQSQITDYNNLVLQRNSLLAKSSDKNPLVVQLNEQM
DQMRHAILASVDNSINALNMQISSLQGSQASTTSKIASNPSQAKYLLSVERQQKVKESLYLFLLQKREENELSQAFTAYN
TRVVNKPASFGPTAPNTRNILMMSFLLGLAIPFGVVYLMESNNTKVRGRKDVEHLAVPFLGELPQDGHEKKKEAGEANTI
VVKGGKRDIINEAFRVLRTNVEFMCNSSEGNKVIAMTSFNPGSGKSFVSMNLGMAIALKGKKVLIVDGDMRHGSTSAYMG
SPAKGLADYLGGAVSEVDTLIVKTPECQNMQVLPIGSIPPNPTELLESPRFGELIGELKSRFDYIIIDCPPIEVVADAQI
IDKFADRTFFVIRAGLFDRSMLPELDRLYEEKKYRNMSFILNGSRNDQGRYGYSHTYRYGYGYGYGYGYNYGSGEKKK
>gnl|bykdb|A0A2V1ILM4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Duncaniella muris] (length=823 residues).
MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFFILCLNKWKWFVISIIIFLGLGVLYIMSTPETYTRTAS
VMINEDTESGSQGVASALSDIGLFQSSANVNNEMLAFQSPAIIADVIQRLGLQTDYIYRHNLKNITLYGDSCPVSVNFLS
IPSKQSASMELDIRDDGKIDISKMMLNGVECDPSEMTVNIGDTVATSFGPITINPGPAYAKRFGNTIKIFRYSISDAIEA
YKARLSENLADDNSTVIDFTFKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADF
KGEHLVPDVAAASAMYMEDANENTKQQMQVSTQIAISKFILDYIKNPDTNGQLVPANAGLENPGIEAQINEFNQLQLERD
KLSNSTGDTNPLLQDYDKNLRSMRSALVSSLTNQERALQTQLNSLIRSDRVTSRKIASSPGQAKYLLSVERQQKVKEALY
LYLLQKREENELTLAFTPYNTRIITPPMGSNRPTAPISRNILLICFALGILIPGFILFIDESMNSRLRNRGDLEGIRTPL
IGEIPESSDSNTLRVRRWRRRWRDILGKNSQIEEAPSLLVRDHGRSIMDESFRMVRANLEFMTRNSQNRVIMVTSFNPGS
GKSFISLNLAAALALKEKNRKVLIIDLDLRRASVSRILPDHSRGITDYISGATDNCDKYIQQTECPGLYLLPVGTIPPNP
SELLYSDRLKQLIEKYRQEYDYIFLDCPPAELVADASIIAPLADITIFILRAGLLDRRMIPEIDRIYDSHRYHNFMVILN
GTLTSGAPYNRYASYYSAYDKKS
>gnl|bykdb|A0A2W1NDY9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomix sp. SM1701] (length=792 residues).
MNNFHINNENAISSLNKDIDIDILKTVFKKNWIWLLLCVIIGVSIAFVYLRYTKPIYESRAIIQRSLKDEGQRILEFKDF
NTENNLSADVELLRSPFLMEKVLMNLNLKISYFSEGEVLIEEKFKQSPYHLIFYELKDSSLINVPIYLKDGQDGLYLVFN
ANQKKNEIPVAHDQLVDNEYFKFVFKINNEKVFKADLEKDDLFFKINNYKTLTNVLIHSLIVNIENADANTIKVSFRSNN
NVLAQDMVREVVETFFTYDLEKKSKSSESILSFIDEQLDTVYNSLKFSENSIQSFTNISKNNNPALYKENLLDQIDQLRT
EVLQADLEYDLILGLVEGINSKNRVSIYNLIPTLAGTRFQPLLEGQIEKLYRLLEDQEDASYRMTMENDGLKNLESNIIN
QTETINRTLKAIKNQVKTRKDAVNKRVANLELKLYGVPQKEMQLAGLKRKFDLNEKYYSLLIEKRTQYQISKAGYTIDNN
ILQEASAPVLISPNPKMIYMAAFVLSLLIGIVYLGIKYITFNVINNEKELRKLIPSRVGFLGLVPKTKTTSNNSMLLVNH
QPKSVLTENYRHIRSNLQFILDSEKSNVIAISSSISGEGKTFVSLNLAGIFTLANKKVMVLDLDMRKPKIHLGFNAKNEG
GMSGILAGTLEWQNCIKNSELENLDFITAGNIPPNPSELILNGRLDTLLSELKQIYDIIIIDNPPIGIVSDGVNVMNNSD
CPIYIVRANYTKRVLMQQLSKLIGDDTVRDLYVILNDVEMTKSQYGYGYGYGGYYSDEDSSKKNKKWFQIWK
>gnl|bykdb|A0A2W2AFF7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Taibaiella soli] (length=810 residues).
MQDKNYTNHIVAAEQQEEGSLNVHKLIGIVMSHWVWFAVSLFLTLILSFVLLRYSTPAYKINATVLINDDQKAGNMDGKQ
LLEDLGFLSGKGNVDNEVEIFKSRSLMESVVRDMQLNVNYFSSGRVKKTPLYEDVPFHFVFIPLYEDSVSKDMYTFSVKI
NGDNIALKCSGKKCNNVDWKGKFGQTVSLPIGKLQVIKNPLVKADEEEYRVDVQSTDEAVEDYRKALTANVVNKQVTLIN
LSLQSNIPHQGEDALNKLINVYLQANVDDKNKIADSTMRFIDDRVALVGEELTGIEKKIEAFKKENELTDIGEESKILLG
STSDYMKQLTQSEVQLSIVESLQKYLHENVNNRRVVPSSLVLQDPTFVALIDKYNGVQLERERMLMSTTEENPMVRNMDQ
QSDNLRGDINNSLASLKRELQTGIRELQARTGGLDEKIKQVPTKERVFLEYSRQQNIKQELYLFLLQKREETAVQKSSTL
ANVRIIDPAKSENDPYKPKKAVVFLTAILLGLLIPGSAIYIKNLVNTRIETKDDITDKTKVAIVGEIGHNTEEAAIVVER
ASRDKLSEQFRVLRTNVQFLLKAGNHKTIALTSTMSGEGKSFVAINLASALALTGKKVVLVDLDLRKPKIAKKLRLERSR
GFTNYIVGQAKLEDILQVADSNENLTVVTSGPVPPNPAELLMMPAVNTFFEELREHFDYIVVDTAPIGLVTDAQLLDQQV
DATLYVVRQGYTYKQQLNFVNELYTGRKMPQLSLVVNDVKAGNGYYDYNYGYSYAGYYGYDSYYEGDDDVEDKQGLIARL
KLMAQKGGLN
>gnl|bykdb|A0A2W4R1L8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=773 residues).
METGTFKSGNSIEGIDFSKLRTIIRNNRLWILAIFVVINLLTYLLFIRYSPDLYESHSEIKLDIRNEATELGINRLVEDQ
NLNIMSGEIEIIQSKLFLARVLDSLKIDVSYYNKGEILNYEFFGNLPFTVDYTITRPAFYGVPIFVDLGSTEAVRLRINQ
DGDQVSGKYGEPIDLNGLTVTIHRNPAFTSESGLNCFFVINSPEVLMNYLMRNLTVEPINFNANTIRISFKDHNPLKAQT
VVNKIDSLYLIFSNEQKTLANRQKITWLTNELKQIEEKMSQYENYFEDFILANKTSNLDEELANTIRLIHEIDSQRYQLT
TRITGINELLDDMSNGVYLVNPVHRLYFPQAINDNLDKLSELQMSFDRLKLSYSEVTFAFREREQQIQNLQEQVTKQLTE
LRDSLLDRLRRLNEQKQRAEQEFAQMPDRNTEFTKNQRFYKLYEEFYLMLMQSKSEFEIAQAGSIPDFKILSSASLSYQP
IAPNKPMIMGIGFVFSLVFNLFFIGILYLANNKITSVHELEQLRHVPLLGIIPSSHHSNGDVLHVVNHPKSMATEAFRTL
RTNLDFFNPSAATKTVAISSTVSGEGKSFVAMNLGGVTALSGKKVVLLDLDMRKPKHNLPASLSNGSMGISTILIGRNTW
QECLVKTDVENLDYIPSGPHPPNPSELLLNNEFSKLLSELKEQYDVIILDTPPVGLVTDGIMAMKKADLSVYIFRANYSK
KEFLDNLKRIVNINKLTNIATLLNAMPVSDKKSYGYGYYEEDSGSKLKSILKL
>gnl|bykdb|A0A2Z3GKA1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter nivis] (length=834 residues).
MAVNENAELEALIRNAIDGGTEPPTAATVGAAADEEADDGLDLSTLALVARRSLLWLLLLLALGGSAAWLYLRYTKPVYK
STSLLKIDQRSEAGVVGLGGQLAAADPRASSKLAGEVQLIKSEIIYKELRDSLDLYVNYYVQGTVLESELYGISPFRIAY
TIKDKELYNQKISLEFTSPTRYSISYSGPGAALDGEYNLGQQVSLPGLDLKVTPTRYFGPATLTAKYHFTVQDEGTVNAY
LEKNLAVDISSADANTIQISFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGF
VEKTKTYDVRSEVAALAAKGESLEEQRLKLNQNLVLLSEISRMVQQQTHITRNENETIEQSIPGLGDINDPVLSQLLSQL
NGMQWDQERIRRSYTGATEAVQQKNAQMDYTLSSILRQITQARKDLLSKIALLDRQQNKLDAKQEGLPSRATEQARLQRP
LALAEGTYTMLMGKKVDYNIQKAGTTADFQILFPASEPRVPISPVRLIVYAIGLAGGLFLGLGLTAVRYLMHNTITNTRE
LERSTQAAVLGVIPTYGKEKMEVSRLVVNDNPKSAISEAIRSIRTNLDFISSAKKKRLISVTSTISGEGKTFVTVNLAGI
IAMSGQRVVVLDLDMRKPKVNLAFGAENVKGVSTILIDRHSVAECIQRTSIDALQFISAGPTPPNPSELILSPRFEQMLA
ELYESYDVIIIDTPPVGLVTDGILVMRRADIPIYIVRADYSRKAFIKNMNRLMRTNNLTRMCTILNDAQSKGAYGYGYGY
GYGYGSGTYGQGYYEDPGPTTRPTLAQKLGRLFK
>gnl|bykdb|A0A316JZ08 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fluviicola sp. XM-24bin1] (length=807 residues).
MAKQKLFINTSYDPLILRTIVRRYWLWVLGFVGIFVVLAYFYLRYTKPVYESSLMLQISNQDKAADVIDFENINTLDDDI
SAVVELLRSELLFERAVDKLNMSVSMFSRGKLLTEELYLASSFNIQPYELVDSTLIGQEIGITTRNDQVILSYSKGGKNV
KLKGPLNKHVTNDDMNVVVKSANPKVFRKMASENELYFTFNSRQGLVERLHGGLDVIPMDPNARTIQVSFKGHNARMCRD
LSLAIAEAYQEYDEEINRKSSENVLSFINNQLDSLYFELQSSQDSLADFHSKSSVVDPELSGGELNEKLNDLELQLSDID
KEVASLIAIDNQLERAPNRLEVFRMIPEMLGKSYEASLVTHITDLHDMLEQKEDLLVSLTPNNEKVALVQKRIDTKINTI
LRSIATIKLRLNSEAVRLRQEISRRKFKLSGLPEQRMEYSRLKNIQELNEKYFTLLTEKKVLYSISDAGYASENRILSMP
TVSTVPVAPNGGFVYFAFILVGTFIGLGIMTFRYLTFNEINLIEDLENTLPERASILGGVPLLKFSMEYSQLVVAEAPKS
IMAEAMRKIRTNLSYIHPNYQTIAISSSISGEGKTFVALNLGGIIAMSGKRTILLDLDLRKPKVHLGFDEDNTHGMSSLI
VGQSSLEECIKKSTIPELDFITAGPIPPNPSELLLSDRFKEIVEELKGSYDVIIIDNPPVGLVSDGVKNLTEADIPIYIF
KSHYSKRNFTYRIKELFEMQQLKSLNVILNGVQSNRSSGYGYGYGYGYGFGYGYTSGYMDDDMDKFSKPSLWMRIKRKIR
SILRRSK
>gnl|bykdb|A0A316SZX7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Coprobacter sp] (length=803 residues).
MSEQNINQPQQNAPAEEEINLRDILDLLISQWKWFALSICICLGIAFLYLKQATPIYTRTASVMIKDDRRGGAITESAAF
QELGAFNIKSNVDNEILLFESKRLMEEVVRLLKLDVNYTEDMGLQTIDLYRNTPIEVSFVDDDDKSYSGFTAKKKGKEIY
LSDLRTSAQVSDIDRDLTIKASLYDTISTPIGKLVIKPTPYFDSWKNEIKISKNPVKAVAASYKGRMNVSLIGKTTSSVS
ITLQDPNPKRAEDVINTLIDVYNLDGTNDKKKVAESTANFIDERLLIIGKELGEVDSEIANFKSTNKLTDISSEAQSQLQ
QSSAFKKEGLSLENQINLALFIKEYLSDEKHVSELLPANTGVADLGINEQIKEYNTLLLNRDRLIANSGNNSPVVQDLNS
SLVSMRKSLLRSVDNLLASLKISMEQIREQENRTMNRIASVPSQEKAVISITRQQKIKEELYLYLLNKREENALSMAITE
NNARIIDEAAGSNTPIAPKKAVVLLAALIIGCIIPAAIIYLRIILNNTVRSRKDIEDKLSVPFLGEVPMANGSSDDNIVV
KENGIDSTSEAFRIIRTNMEFMKMSHDMKVIQFTSANPGSGKTFVASNLAMTLALSSKKVVIIDLDLRKRTLSKSLKSSK
NGITSYLSGQASINDILHKGEHENLYVINAGPLPPNPAELLLSKKLEDLIAELKTQFEYIILDNVPSTMVADAAIVNRVS
DLTIYVIRQGLMDRRQLPEIERLYTEHKFTNMCIILNGIKFGRTGYGYGYGYGYGYGYGYGYGYGNEHQHKKKGLFSFLK
RKK
>gnl|bykdb|A0A328BL48 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. NL] (length=830 residues).
MAVNENAELEELIRNATSGGAAPTAPAAESEDDSVGGGLDLPLLLSVARRSLPWMILLVLIGLAASWSYLRYTKPLYRSS
STIKIDEKQQAGDLGLLAAGAQAGQQGMSKLSGEVELIQSDLIYTRLRDSLELDVNYYTEGTVLETELYRTAPFRVEYAV
REPLQFGQKFSVEVLDQNRFRLSYAQGQAEQGGEYSFGETLTTPGFTLTLVRTRFFNEQTPETKFFFVINTPEAINGYLA
QNLTVSVINPDANTIGISFTDYNPAKARDIVNKIDSVYQQVKLARNYQSTQQSMAFLDSQLNGNRDSLQKAENALQAAVK
RNRTYDAKGDLATITTQMQELAKQREQILRRQGVLQELSRVVETERLIGSDELTVEESIPGLAVLQDPQISQQLTVLNEQ
QRELRQVLQSYQPTTTAVQIRQSQLAFTKRSIRRLLQQTLKLTNDELNALTRQQQQLGGELQSLPGKETELARLRRPVEL
YVSSYMLLMQKKVDFGIQKAGTTADFQILSPASLPSEPISPQKMMVYAIGLAVGALLGLGLVAGRYLLHNTVTSIRELER
NTVAPVLGVVPSYDKEKLAVSKLIVDKNPKSAISEAIRSIRTNLEFVANSRQKRLISVTSTISGEGKTFVAVNLGGIIAL
SEQRVIIIDLDMRKPKVNLAFDAENTKGVSTILIDRHTVQECIQRTSIPSLDFISAGPTPPNPSELILHPQFDQMLEELK
RTYDVIIIDTPPVGLVTDGVLIMRKVDVPIYIVRAGYSKKAFLKNINKLVRGSGFSKLTTILNDAQAGGMYGYGYGYGYG
YGYGYGTGYGYYEETQAPTGLLARLRRRFS
>gnl|bykdb|A0A349DQI4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Microscillaceae bacterium] (length=813 residues).
MEERNHILPTNNDSENDDFLSNIDLEKIWEILKKSILWMLILPLLTLSVAHIWLRYTKPVYESSSSLKLAIKDEGVQMLG
IKQLITSNSINGNLIGEVEFIRSQIIFNSVIDAMDLWVSYYEQGNILEAEYYTNAPFKVVDYKIKTPGYYDKKFNIKLKS
QKEFELSFQTGKVLNKQVYKFNQTVKYPGFSFKVIKTPFYKKRFHNIPFYFKLNSRESLIRYLNTNLQVGILNRSARIIG
VNFRDFNPLKAKHIVHVIDTTYLQKTLENKKRANIQQKKYLNRRLNEIEDSMRNYEAKIQGFKLKLKTNNINEKLDKSVQ
EIEQLIKKKLKFTDELAGIKEIENLIAEDKELVLYLPENTSGLQSLTEILKKISKLQEDKKLLDLRATSSSMIIQNINQQ
LNTQKAKANRLIAKARKGIYKKIVDIEARINALETAFGSLPEQEAEFKRVQRLYKIYEGYYLQLLNRKAEIGISEAGIVP
EFDVLKEANIPTIPISPRKFLIYAVAGGFGIFLSFALVVIRYLLHNKVTNLRELERVTKVPVLGTVPRYRHRKLKYTKLL
VHRNPKSSLNESLRSIRTNLAFLLPQSRESSNSSKTNIISVTSTISGEGKTFVATNLGGIIAMSDRKVVLLDCDMRKPKV
HIAFDEENDVGVSNILIKQNSLQECIKPTEIKQFDFIAAGPTPPNPSELLLREDFDQLIEDLKEIYDVIMIDTPPVGLVT
DGVLIMQKVDVPLYVVKAHYSRKIFGKSIDKLVQAHNFRNLSIVLNSVKHATGYGGYKYGYGYGNYYGGYYEDNAQKNGL
LARLFSIFKRRKK
>gnl|bykdb|A0A350IHV0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rikenellaceae bacterium] (length=801 residues).
MALENNNIDNRPALRNANGEEDGDILSLTEIWAMIWNNKWWYVLSLVVCIFMAGFVIYRTAPKYTRTAKVIVDDSNENSA
MKELASFTNAMSLRRNSGANVYNEMESFTSPDIMSVVVDRLGLEASYVEKQFLRSRELFTSSPIALVQTGDNHASAYSFE
LTKTGDSTFVIKNLRVAGEKMKYKGKIKGSFREELQTPVGKIKIVPTMHIDKWHDPIVVSWVNAKRLAKAYCKKLNVSLS
GKESTVLVLSLEDTFPRRAEDILNTLIDVYNEQWVANKNRSARNTTAFINDRLVVIENELGGVEESLKQYKETHKITDIA
SISEAYLKESTDYSAKSFEVNNQLAIAKFIKEYLKDPQHDGALIPSNLGLDSKTVDSQITEYNQMVLTRDRYMSDSSSDN
PLVGDLNNSISALKVAISRSMDNLISTLQMQVDKIEAQENDIMSRIANTSGQELQLLSIERQQKIKQELYVYLLQKREEN
EIASLVNVGNTRMVMSPNGDEKPGAPNKQMILLVALVLGMGIPFGVFFLINQLDNRVKNRSDVAGLQIPFLAEIPQIGQG
AGLLNKLRKNMLNNANTRIVVEAGNRNGINEAFRVLRTNLDFMTNQEPGKCHKIMVTSFNPNAGKTFTIMNMAATVALKG
SKVLLLDLDLRKGTLGKAMEHNKAGISAYLNGKLSDIMTEVQHIKDNLDMISVGSLPPNPAELLDSERFRKMLEELEKHY
DYIFMDCPPVDLVADTAIIAKEADFTVLIIRAGLFDKRALPVVETMYQSGVYKHMALILNGVDTTTKSYGHYGYGYGYGY
G
>gnl|bykdb|A0A350JJ90 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flavobacteriales bacterium] (length=831 residues).
MTEETNTNNLGVHSSQFDLGLLLMITSKSLIWIVSIILLLGGLAFTYVYYTQPKYESTSIIQIINENQANRILNVGDIYE
DADISKDIELLRSPEFFKRVIANLPVDVSYYAEGEVLNHERYLSSDFEVIYEIHDPIILDRRIYIEFETPTSGTINYLVG
TKSFSEKFAEEDTIQTPHFSFTIVRLDEAQAQSSGLTEDRKYFILNSAPTLVQKLSKNYSVRIQSAAAKTVQIVVTDNNP
AKASAICEQIAQTYLVFDHERKSESANQVLEFINQQIEEVYSKLKISEDLMSEFSQRTKLTKKKGIAATYITRVNVLEQK
KVELELKISLLSELRGGIQIEKTGVDIYNLLPVLAGTEFENSVKGQIEELQNLVLTRNRLLGGATMDNPNIRVYDQQISV
QKNLVIKSLEVLQKRLIALQKQTTGKIQSIEDNFLDLPTREIEYSRLERVFNSHEKYYTMLLEKKTEFSISKAGLVPENT
ILQKATMARQPVSPRKPIVYGIATAFAILFILGLIAARYLLHNDIDVRDLSGLLNPEISVLGIVPKYNHAIPQSQMIVDK
KPKSIMAEAFRSIRTNLEFFESKGEKKVIAITSTISGEGKTFVAINLGGILAYSGKKVVILDLDMRRPRIHEGFNAQNDA
GMSTYLSGRGDLMSVIRKSELNDLHFITAGPIPPNPSELIINGMLSKAITKLKETYDIILIDNPPVGLVTDGITCLRMAD
YPIYIFRSEYSKKSFAANVNRVFKENKIKNLSVILNSVDLDGAKYRNYGSGYGSKYGYGYGYGYGYGYGYGYGYTQSSGN
GYYEEDPDNATVKKSFLRSLMSKPKSENKKD
>gnl|bykdb|A0A351BXT2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=758 residues).
MNKPSLNGKSNHTAVNSPELRESKDNFKIYLNILRMNLIPMTIITLLCILLTIVYVMYAKDIYKSSATIKINRPQGSVLS
SSLIPEFQDFITDRYISNEIEVLKSYKIREMVAENLIDTFKIDEDKKKFYYILNHGENEDVTALISVSSLADILSQIVKI
DQKRGLDVVDIIVESPAKYEAMLIANLYSKVYQSFSLDLSREELTSLTGYLREEKENKFKDLAVAEGELEDYQKNGGLIL
LDAQVKNVVENISVLEAQQNAARIELNSKQEEYNSLKSEIERMDPTLVNFLQGKVDELYLTEIQSKIAELESQRDVEASI
PNDEKLREKTLAEYNRKIAPLRETLEEKIEVMRSSLFASTPEERRNVAQRLLEAGVGVQSLNTKVNTLSKMLGKYEVQFS
KLPTQSIEYAKLERNRKATEKLYLILEEKYQEAKINERIKLGTVLVIAPGVIASKPSKPNRMLIIFMGTLFGIGLSIAFA
FARNYFDHTIKSPDEIENRGISVLSWIPAIDELKNKSYQSEFIVANKPKSPPSEAFKALRTRIQYSKLEETPLKTILLTS
SVPSEGKTTISINLAGSLAQMEKKVLLLDCDLRKPRVHNVFEIDRFPGLSDYLFSNATLEEITRQTKLENLDVITSGTIP
PNPSELLASKQMKDFLEKMKLKYDFIVIDSPPYISVTDAEILFRIADGTILVLKAGSTPSDAFYRTSEKLTSLDPHNFLG
VVFNNFSFKSAYGYYYNYYYYYTRPEDKLKAEKPTSSV
>gnl|bykdb|A0A351HSA6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Marinilabiliales bacterium] (length=804 residues).
MYQGKIPIINDKFDLAIFLQIVRKNYWAPILFVAVSFVASFLYLRYTQPVYQTQSIIQINETNNTTKVLKIEDVYQDNDI
LKVIELLRSKEFLKRTFLKLPIQISYFSEGTFLSTELYRRSPFQIEWKMITGKLYDIPVYIEFDGSEKALIYYGDGGVNA
SYPIEIGKWSAIRADSIRCTVSDYLTIESQKENYKGNRFYFVISNPKNIVENHLQNLDIFLLNRSAQTIQISYSGYNAEK
ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKRENKINTDQFKAEGSPFPLFTTKISEL
EDELINIDFELVALQRINQQVANDHDLNIYELIATLSGTKSETIVVNVLNNLQELINKKEQLLNDITRDNLKIKLLEKQI
DNQKDLLLEFVNSTIVRMETKKGDYQKKIAEYESKIFNDQNFDELEYSKLERLYTINEGFYHKLIEKKAEYLISQAGYVS
QNTILEVGNVPIEPISPISKKIYPIFILIGLFAGVGYIILRYLLYDEVTSIATIQNFTDAPILGTVPIYKKEIPVSQLLV
NKHPNSIFSEAFRTIRSNLQFISHGAETKIITVSSTISGEGKTFVAINLAGILAISGKKVIVLDLDLRKPRIHLGFNTSN
NKGISTLLIGKNILDECIQKSDLSNFDYITAGPVPPNPSELSAGKQMETLLAELEERYDIIIIDTPPVGIVTDALSNLQR
ANYPIYVMKANVSKRHFIDNINNLVKSKNMDNLSIILNGVELHQRSYGSHGYGYGYGYGYGYYTEDDETTIGKKLTRKLQ
KLKQ
>gnl|bykdb|A0A352Z1R7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=810 residues).
MTSNVSIPPSQPLLRSGENAHIYDYLSVILRRRKLFTLAFCAVFFSVVLYTYLMKPIYEASSTLHIKKERGQGVLVDMTF
DQSNSIDAELEIIKSRTNIEQVAKRLHLDWQVTKKSKDLDFKLLDFSSTAKTPSYRIEMTGADTFTVKDDDDKLVGEGSS
GRLMQAKGFSLLLNDLKGEKGDNFRLKLLPLQNIAVSLKGGFKATEVGNRTNIVRISYSSTDPVQARDLVNTLVQVYLGQ
NIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKSSSGMFKLDSEAQEVVKNLSETEKLRAEVIFQKKQVEFALDA
LNSTLRKGNIYSPAIMRDDPLVAGLATKLSELEIQKRTLLTDYTENHPAVRTIQGQIDEIQKKIRSTYETNLVNLNKQQS
SVTHQLDIYESKLRKLPKAERDLARLTRVSNVNAGIYTFLLQKHEEARIAKATTVSNINIVDPAITPVLPIKPDKPKNLL
LGFLVACILGIGLAFFQEYMDDTIKDVEEAKRAIGLPLLAVIPFIPSRAENGEAKKRLPLITRLEPKSQVAEAFRSLRTS
LHFSAINRDKKIILITSTFLGEGKSIITANLSNTMAQTGVKVLVVDCDLRRSSLHEKFGVNKVPGLSEVLTGDTTFREVL
HDTGIPGIDVITAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTISDIVLLVMEAGRVPVKAA
QHMREMLANVQAPVAGFVMNDKTGRGETYGYYGSRYYRYGGYGRKYGHGYGYGYGYYSDAEPNHRKTPHRWEKVLNFIPE
KLRRRIKKLF
>gnl|bykdb|A0A353KZR1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=813 residues).
MEEKKIPLINEKFDLGLFLFVFRKSILLIGIFLFLIVAVMYAYLRYTPPLYRASSVIQINDQNQADKLLNLESVYENTNL
AHVVELIRSKEFLKRAFEKLPLSIAYYSEGTFLTNELYRMSPFTVEANILDSRIYEIPIYIDFISSKETKALYKIGEENH
EFAIYSNVWSNIGLAEIKLKIDDTSQIQAQLSDLKQNSFYFIIKNPNNVYLDHFSRLEVAVQNQLAQTIEIAFSDNNPLK
TAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHDFKKENNINISESELNTLSLNLYASKIEEI
ETEILNLDFELITLKRIQEQINSKANLNIFELIALLSGTKSGNVIEGILNTLQSLITQKEVLLNDVTNNNHQIKVVDKQI
ENQKMILTEFITSAISRLSNKKDDYKKKLNEFEGQAFNKASYNEMELAKLNRIYTINEGFYNQLIEKKAQYLISKAGYVS
QNVILEKAIVPQSPISPNKKFIFILAIVSFLLISFMLIAIKYLTYNEITGIHDLKSYTDCPVLGSIPMYKINIPVSQLLV
HHKPNSVFSESFRTIRSNLQFISKDEGSKIIAISSTVSGEGKTFVAVNLGGIMAISGKKIIIVDMDLRKPRIHLSFNTDN
SKGMSTILINKNTIDECIKKSELENLDFITAGPIPPNPSEISMKKYTEHVFQELKSRYDVVIIDTPPIGIVNDAMNSFQQ
ADYPIYVTKANFSKRSFIHNINHLAFEKGITELSVVLNNVDVSSRRYGYSYRYGYGYGYGYGYGKGYGGGYYDENTPQKK
TLLQKLLFWKNKK
>gnl|bykdb|A0A353Q7B4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=808 residues).
MALSQNNNVKQKQPEDFIRIQDLFYLCLAKWRWFVLSLFVTLGIAVLYLLTTPAVYTRSASLLIKEDSKGKSMAGDVSSL
FSDLGLSQANVNVNNELIAIQSPAVILETIKRLHIDVDYQINGPFHRKTLYGSELPVRVVFTDLTDKENAKLTLRVSEDS
TVVLSDFVWGDGSKSSKTIDTRLGTIVDTPLGKLSVMPTSHYTNETSPLIYVSRTNLYSATNACKEALTISLSDEKVTVI
DLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKSKNLLPDVEAASGMYM
EQSRETSNLLLSLKSQLSMANYIRNYLTGPAYTNQLLPANSGIENSGIESQISEYNTLQLQRNNLLANSSEQNPLIKDLD
QSLESMRKAIVSSIDNLVVTLNTQTANLQKSEQQTTAQIAANPDQAKYLLSIGREQKVKEALYLFLLQKREENELSQAFT
AYNTRLLTPPTGKITPTAPVKKNILLVAFVFGLLIPIVIIFIRENTNTTVRGRKDLENSTLPFLGEIPLYQPQKRNRLFW
KKQPEIEAIVVEEGSRDVINEAFRVVRTNLEFMDGSGEPDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKSVLVIDGDL
RRGSISDYVDTPKIGLSDYLGKRIDTPEEIIVVDKKHPTLHILPVGTIPPNPTELLVEERLKELINRMRSRYDYILIDCP
PIDVVADTAIIEKLADRTIFVVRAGLLERSMLVELEKIYNEQKYKNMCVILNGTTGNGGRYGYGYRYGYKYGYHYGSEKK
KTWWGNKG
>gnl|bykdb|A0A354M4S6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Coprobacter fastidiosus] (length=802 residues).
MAAVQNNPKSKQSEEFMRIQDLLYLCASNWYWFALSLMITLGAAFLYIKVTPPVYTRSASILIKEDSKGKSLSADAGSFA
DLGLIQANTNVNNEIISLQSPAIMTDVVKRLHLNMDYHVDGGFYREVLYGRTLPINVSIDTPNDNESSALTVKILADSTV
ELSDFIRNGEELPGKLLKGQLRDTIMTPVGKVTVCPTPYYTSQFSQPIYVSRSGLYSAVRRYAPNLSVVLNDEKSTVVDL
SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKSEHLLPDVQAASSMYMAQ
VSETDAQLLALNNQLYMARYIRNYLGGESNKYQLLPANSGIENSNLGDQITEYNNKLLQRNSLVANSSDQNPLVIDLDHA
LAAMREAIIASIDNQVVTLNAQIKNLERSGQQTTTRIAESPAQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAY
NTRIITPAGGSMLPTAPLKKNILLVAFVAGLLMPAIVIFIAENMNTKVRGRKDLENMTIPFVGEIPLAYHQDKQGSIFRK
KKLPETHTIVVKEKSRNLVNEAFRVVRTNLEFMLGKEGQSRVIMVTSANPGSGKTFITMNLAKSLAIKGKKILVIDLDMR
KASLSSYVDSPRIGISNYLSGQVENFSEIIVKGKVYPGLDVIPVGTIPPNPTELLFDLRLEQMLSTLKAEYDCIFIDCPP
VEIVADASIINKLSDMTLFIIRSGLLDRSMLYEIEGFYTDQRYKNMAVILNGTSEAYGHYGYQYGYRYGYNYGYGKGYSE
EN
>gnl|bykdb|A0A354SN68 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=814 residues).
MYTNMDNNENTSLSTEKVEDEFVLKDFLFACLAQWKLFALSVAVCVGATMLYLSSKSPVYMRRASVLMKEDNRRSASIGN
TSGIFNNLGIGKSYMNTNDEVAIINSQTIALEVVQSLHLEVSYSISDRLKEITLYGKNLPIKVSFLEATSMDNLSFEIQL
EKGGKAILSHFKGDFGDEVVNDEEAEMKTILSQEGDTLLTPIGKIFLQKSNSFDKAFITSTICVRKCNITSATERVQRMY
LATGREDGSSVVNITCNGEHIGMLNDILNAVIKAYNKKWVEDRNQVALNTSKFINERLKVIEKDLGLVDEDISSYKSMNY
VPNIGIATGMVMSQENSLDNTIVSTNNKIHMAYFIKEYLSNVKNRNQLLPVNSGIGNEGIEGLINDYNAQILQRNNIVSN
SSESNPLIKDIDTGLGTLREAILSSIDSEISTLKLELSLQKKHEQKTAKKVKTNPKQQQYLLSVERQQKVKEALYLFLLQ
KREENELNQAFTAYNTRIVATPNGPGAPIAPNKKKFLLGALIVGLLIPIAFVYVREEMNTTVRSKSDIDKYLSLPYLGEI
PQYHKKRKEQLKDSTLLVKEGNRDVFNEAFRVLRTNIEFVMQEKEKNVILLTSYNPGSGKSFISINLSMSLAIKSKKVLL
IDADLRHASVSNFYGKPKIGMANYLSKKTDNLESIIIKEENYPDYLHIIPVGKIPPNPTELLFSECFEEMIATLKKQYDY
VIIDCPPLDIVADTSIIEKIADRTFFVIRAGLLERGLLPQLEKEYKKGTFKEMAVILNGTSGDGGRYGYRYGYRYRYGYK
YGYKYGYNYGHSKS
>gnl|bykdb|A0A354WXN6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp] (length=832 residues).
MVVCSIRLGGCSLLNCHIIQQITQSTVMEQQENNKNIEQEEQELNILDLVKIAWANWYWFVISIVLCLSIAFVYLKWAPK
VYTRTASVLIKDDKKGGGFSEANAFGDLGITMGSRNVDNEVLVFKANRLMEMVVKRLHLDINYSIKEGLRTVDLYTQSPI
NLTFPEAEGEQVFSLKATPLDDKKVLLHDFKIANTEGKLVEAGKPMEVLLGDSVDTPVGPLKIEASLDYSERYWNKDISI
NKRAASAVTNAYQAALNASLASKTSTIINLTLQDRSIPRADDVLNTLIAVYKEDVINDKNQVAVNTSNFIAERLLIIEKE
LGSVDANIESFKRENQLTDITSETGMYLQNTSQYNQESLSLQSQLQLAKYIKEYLIDPSHNADLIPANTGVDVNVESDIS
EYNTMLLKRDKLISNSSSKNPVIQDLNNSLNAMRQTIIRSIDNLIVGLNVKINNVQNQAAQTSRRISAVPAQQKYVLSVE
RQQKIKEELYLYLLNKREENALTQAITESNARIIDPAGGSNLPVAPKSAVILLMALVLGGGIPAGIFWLMFTLDTKVRSR
KDLEKVITIPFLGEVPDKERKDKREVVVHASSRDSVSEAFRIIRTNMEFMRVKSKNMQVIMMTSMNPGAGKTFITINLSV
TLALAHKKVVMVDLDIRKGLLSERTGHGSQIPKGMTNYLSGNVEDINEIITKNAFCEGLDVIKSGPVPPNPAELLLSDRL
DKLVDELRKTYDYIILDNVPAMLVADATIVNRLADLTIYVVRAGVMDKRQLPELERLYRENKFNNLSLILNGTDYHHGYG
YGYGYGYGYGYGYGYGNDQKKRKNKNEGGGGN
>gnl|bykdb|A0A355FD59 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=808 residues).
MALSQNNNVKQKQPEDFIRIQDLFYLCLAKWRWFVLSLFVTLGIAVLYLLTTPAVYTRSASLLIKEDSKGKSMAGDVSSL
FSDLGLSQANVNVNNELIAIQSPAVILETIKRLHIDVDYQINGPFHRKTLYGSELPVRVVFTDLTDKENAKLTLRVSEDS
TVVLSDFVWGDGSKSSKAIDTRLGTIVDTPLGKLSVMPTSHYTNETSPLIYVSRTNLYSATNACKEALTISLSDEKVTVI
DLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKSKNLLPDVEAASGMYM
EQSRETSNLLLSLKSQLSMANYIRNYLTGPAYTNQLLPANSGIENSGIESQISEYNTLQLQRNNLLANSSEQNPLIKDLD
QSLESMRKAIVSSIDNLVVTLNTQTANLQKSEQQTTAQIAANPDQAKYLLSIGREQKVKEALYLFLLQKREENELSQAFT
AYNTRIITPPYGSLGPTEPRKSFILLIALITGLLIPFIAVITKERMDTTVRGRKDLENSTLPFLGEIPLYQPQKRNRRFW
KKQPEIEAIVVEEGSRDVINEAFRVVRTNLEFMDGSGEPDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKSVLVIDGDL
RRGSISDYVDTPKIGLSDYLGKRIDTPEEIIVVDKKHPTLHILPVGTIPPNPTELLVEERLKELINRMRSRYDYILIDCP
PIDVVADTAIIEKLADRTIFVVRAGLLERSMLVELEKIYNEQKYKNMCVILNGTTGNGGRYGYGYRYGYKYGYHYGSEKK
KTWWGNKG
>gnl|bykdb|A0A356H8Y3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Marinilabiliales bacterium] (length=804 residues).
MYQGKIPIINDKFDLAIFLQIVRKNYWAPILFVAVSFVASFLYLRYTQPVYQTQSIIQINETNNTTKVLKIEDVYQDNDI
LKVIELLRSKEFLKRTFLKLPIQISYFSEGTFLSTELYRRSPFQIEWKMITGKLYDIPVYIEFDGSEKALIYYGDGGVNA
SYPIEIGKWSAIRADSIRCTVSDYLTIESQKENYKGNRFYFVISNPKNIVENHLQNLDIFLLNRSAQTIQISYSGYNAEK
ASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVAFKRENKINTDQFKAEGSPFPLFTTKISEL
EDELINIDFELVALQRINQQVANDHDLNIYELIATLSGTKSETIVVNVLNNLQELINKKEQLLNDITRDNLKIKLLEKQI
DNQKDLLLEFVNSTIVRMETKKGDYQKKIAEYESKIFNDQNFDELEYSKLERLYTINEGFYHKLIEKKAEYLISQAGYVS
QNTILEVGNVPVEPISPISKKIYPVFILIGLFAGVGYIILRYLLYDEVTSIATIQNFTDAPILGTVPIYKKEIPVSQLLV
NKHPNSIFSEAFRTIRSNLQFISHGAETKIITVSSTISGEGKTFVAINLAGILAISGKKVIVLDLDLRKPRIHLGFNTSN
NKGISTLLIGKNILDECIQKSDLSNFDYITAGPVPPNPSELSAGKQMETLLAELEERYDIIIIDTPPVGIVTDALSNLQR
ANYPIYVMKANVSKRHFIDNINNLVKSKNMDNLSIILNGVELHQRSYGSHGYGYGYGYGYGYYTEDDETTIGKKLTRKLQ
KLKQ
>gnl|bykdb|A0A357QK06 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=809 residues).
MQKKIPLINETFDVRIFTYIIKKSMFLVAIIMGISIVGAFLYLRYTPPLYQSITVLQISNNNNADKVLEIENLREENTIA
QTIELLRSQEFLKRVFSKLPIDIQYFNEGTFLSNEMYKSSPFEVKVKINNGAIYDKKIYIDFENPTTYHLKINSDDLEFE
NLSVGKWENINGIDVKVTITNYKGIEELHKSLNHESFFFILKNPTTLLNEHISKLEIKLQNPEANTIEISYVDNNALKTS
EVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHSFKKENKISPNSDLNLSAFPIYTSKIHEFDEE
IMNIEFELVTLNRIKSEVAENKNIDVYELIALLSGTKSEGYISNILESIQQKNDQKDMLLNDVTNNNHKIKIVDKQIENL
RKTMIDFIKNTIKTLEKKSIDYEEKILQYQNEIFNTGQVNEVELARLTRIYEINEGFLTQLIEKKAQYSISQAGYVSQNL
ILQKSSPPTEPISPRKKMTLIIFLAAGILISLSIVILRYLLHSQITSITDITSYTDAPIIGTIPKYNKEIPVSQLIVNIN
TKSIISEAFRTLRTNLEFIAHGESNKIITVSSTVPGEGKTFVAINLAGILAISGKKVILIDLDLRKPRIHKGFDIVNDKG
VSTILIKKHLYKDCIKKSRFENLEFITAGPIPPNPSELIISKEMDEFLSELHNEYDFIIIDTPPIGIVSDGISIFKKAAF
PIYVTRANYSRRNYINNINHLIDDKNITKISVVLNGLDTRQTKYGYGYGYGYGGYGAYGEYGYGYFEEEFKPKLPWYKKI
IKRILFFIK
>gnl|bykdb|A0A357YNR3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=799 residues).
MSMYSEVEYEFNKLADKPVDVLSILMKYLIHWKWFLVSIFICIFLAVVYVYFTLPKYMIQTSILFNDDQKGGASEVTTFR
EMGIVSRRNNADNEVEILKKTMIVEKVVRDLGLYATYTEMRPLSLLARFGLKDNVPSFLIIKSNSLYGNESPVLVRMSDK
DLNNLIDKVSIDVVVYPTGNYNFSVEYNKNNFHYNLSPGDSTLKFPFGEIEVATTPIIHSRNMMVEIDIYRPADVANMYL
GNLTVELTSKTSSVADVSLICSNVALGRDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDVENQVQIYKQ
SQGITDIAAQANLYNNQMANVGQRRMDIESQLSIVSNLNDYVQNINNHEQLIPANSGINSQSLNNQINSYNNLVLERNRL
ARIASSSNQSMIDLNYQLTSMLNSVKSSLQNEKNNLEIQFRDIAAVYNQNRARVSAIPQQERVYSDIMRQQNIKEDLFLF
LLQKKEEKYMNMATVAPSSKIIDNIRVAGIVSPQKMKILAIFLVLGLIFPVIVIKIKDLLRYQIVSKEELEKITSVPVLG
EIPRITPNEKVSINERTLISENGNDSFNEMIRLLRANLLFVINGNEKKVINVLSSISGDGKTFTSINLSMSLALIDKKVL
LIDLDIRKPKLAKELGLDSKKGITLYLSGSMAKEELIKPSGLHPNLSVITAGAIPPNPNEILAKPLLDKLINELRGDFDF
IFLDTAPLGLVSDGFLLSRLADVNLYIARSEYTPKKYLEDAGKYYKEGRIKSLYFILNSVNLDAAEYRYGFGKKYGYGY
>gnl|bykdb|A0A358R538 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp] (length=812 residues).
MTERTINPQPAEETTGNVTLHDILRMVAANWYWFVISAAVCLGAAYYYLASTPRIYSRTATILVKDSRKGGDTDLAAFSD
LAGFQNRRSVDNEVFILQSRRLMAEVVRRLGLTTDYSVRDRLRARDLYGQSPLRVRFIDETEDLSAELTVTPLPDGRLRL
SDFDDGFLPKSERRTQIVVESGDTAATPVGKVVVERTPYLTPAYEGVPVRVRKRSLGSATSAYRNAVKCDVANKQASVVT
VTMSNTVPRRAEEVIDALVAVYNEDAVEDKRRISVVTSDFIRARLDVIGRELGDVDRGIEELKRSNRMIDLQSEAARNVT
ESSRYKAEGLSLENQIAVARFVSDYLRDPAHAGELIPMAASVASETVAAQIDRYNEAILTRSRLLANGSEQNPVIGEMDR
ELAAVRRSILASLDSHIATLTLQRDAMRGEEATADDRIAAMPSQEKAMLGIARQQKIKEELYLYLLNKLEETQLNYAVAE
SNARIIDTAYGSPLPVSPRATMILSIALVVGLAIPFGLLYLVGMLDTTIRGRKDIEEHVSAPFLGDIPYHEGGDERGVAV
REAGRDPLSEAFRMLRSNMTFMNVSAGNGIRSVLFTSTNPHAGKTFVAVNLAATLAMAGKRVLLVDLDFRRHALSSQLGH
GGSKHGLTAYLAGTIDNADALIRPSGIHDGLDVIYAGTQPPNPAEMLLSERLDRLVGELKERYDFLFLDSTPAMSVADAV
ISDRLADLCIYIVREGVLDRRQLPDIERLYREKRFRNMCIVLNSTRVRRHGYGYGYGYGYGYGYGYGDDRRDDEKRRWIR
GLLRRIFGKHKK
>gnl|bykdb|A0A358R8U0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp] (length=803 residues).
MEMTQNTSPAEPMDDSIQIKDLLYLCLAKWKWFILSLLVTLSLAFLYLLKTPSVYTRSATLLIKENTKGQSLASDVESFG
DLGLFQTTTNVNNELLVLQSPSIMLEVVKRLHLDMNYHIPGRFQDRVAYGASLPLTVSLPELTENESARFTLKVRPGGEV
ELSEFVRNGEEIPSEKVIKGNLTDTLTTPLGRVEITPTPYYDIDRGCQLKVSRTGLYGAVGSYSGNLTVTLSDKKASAID
LTFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYKSENLLPDVQAASSLYMA
QSSETNAQIMALSNQLYMTRYVRNYLSDENNRTQLLPANSGIESTNIESQISEYNTKLLQRNSLVANSSTQNPLVVDMDQ
ALSEMRRAIITSIDNQILTLNTQIASLQQNEQKTTARIAANPSQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTA
YNTRVITPPSGSMVPTTPVRRNILAIAFVIGLLIPVGVIFLREVMNTRIRGRKDVEKLPLPFLGEIPQWGGNGRSLFGKK
KKREPAADSIVVREGKRDVINEAFRVLRTNLEFVVGKSEKSNVIILTSFNPGSGKSFLAMNIAMSLAIKGRRVLVIDGDL
RHGSTSAYVGSPRHGLSDYLGFRTDKVEEILVRDKEYENLNILPVGTIPPNPTELLEESRFGELIARLRADYDYILIDCP
PIEVVADTHIIEKVADRTLFVVRAGLLERSMLSVLENIYREKKFKNMALILNGTDGQSGYYGYGNRYGYHYGYGYHYDSG
SKK
>gnl|bykdb|A0A358Y7S2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Crocinitomicaceae bacterium] (length=770 residues).
MSTGPIKKRVLNKEFNPLILEEILKRHWRAPIFYSTIFLIFAYLYIRYSVPIYQTKALVQVVEENKTRDILGKDALNVEK
ALNLNQEVELLRSELLINKVIEKLGIHTNLYSKGTILTQNLYRETGFSLMVYSLNDSSLCGTEMHVSVENDLILIDYEKS
GAKNKLKLKPNSRFKNPQFDIMFKVKNIDELKEHCAENEVYFEFIQREKLIEEIKEKLTVIAVNPEAKTIEITYENSNAK
LSYDITKTLIEQYLFFQEEMNIKNAKKTIDFIDYQLDSLSRVLEISKEDLANFQKRERLPNIEKIGDNLSENLTNYSKVI
LELEEELSTLYLVQGKLTSNPNRLDIYKVIPEMIGKKSFEGAVIRQIEELNDLLEKKEELLKDVTLENEAIKRIEIKIQN
KISNIRRSMKVIEDRIKSDKLIYSRKLGETEQEYFNLPTKSMELQRLQYIQDLNNKYFTLFTEKKVALELSNAGYSSSTR
VLTPPKVPTSPISPRTNLIYGLALVLCIFCGLSIMIWRYLTYNDIINSNDLQNILPPQVSFLGIVPLHKKKMKFSQIVVN
ESSKSRMAEAIRTIRSNMSFVKKDAKVIAISSSISGEGKTFVMLNLAGLIAANGKRTILIDLDLRKPKVHVGFNAENIIG
MSNVISGLNILDEVINKSEFPNLDFISAGPNPPNPSELIQSDKLKEIIEELKKRYDIVMIDNPPVGIVSDGVEILANADI
PIYVFKANYSQRIFIQRVEELVKVQKIENLNVILNGVKTGRSFYGYGYGY
>gnl|bykdb|A0A359CEZ9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=808 residues).
MALSQNNNVKQKQPEDFIRIQDLFYLCLAKWRWFVLSLFVTLGIAVLYLLTTPAVYTRSASLLIKEDSKGKSMAGDVSSL
FSDLGLSQANVNVNNELIAIQSPAVILETIKRLHIDVDYQINGPFHRKTLYGSELPVRVVFADLTDKENAKLTLRVSEDS
TVVLSDFVWGDGSKSSKAIDTRLGTIVDTPLGKLSVMPTSHYTNETSPLIYVSRTNLYSATNACKEALTISLSDEKVTVI
DLSYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISSFKSKNLLPDVEAASGMYM
EQSRETSNLLLSLKSQLSMANYIRNYLTGPAYTNQLLPANSGIENSGIESQISEYNTLQLQRNNLLANSSEQNPLIKDLD
QSLESMRKAIVSSIDNLVVTLNTQTANLQKSEQQTTAQIAANPDQAKYLLSIGREQKVKEALYLFLLQKREENELSQAFT
AYNTRIITPPYGSLGPTEPRKSFILLIALITGLLIPFIAVITKERMDTTVRGRKDLENSTLPFLGEIPLYQPQKRNRRFW
KKQPEIEAIVVEEGSRDVINEAFRVVRTNLEFMDGSGEPDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKSVLVIDGDL
RRGSISDYVDTPKIGLSDYLGKRIDTPEEIIVVDKKHLTLHILPVGTIPPNPTELLVEERLKELINRMRSRYDYILIDCP
PIDVVADTAIIEKLADRTIFVVRAGLLERSMLVELEKIYNEQKYKNMCVILNGTTGNGGRYGYGYRYGYKYGYHYGSEKK
KTWWGNKG
>gnl|bykdb|A0A359D1M1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=833 residues).
MKQQQRLIPVINDKFDLPIFLMIIRKSIWWIVIIFILALFSAFAFLRYTPPIYQSNSILQINEQNQTAEILGFKNNFIKP
SELPAVMELIRSNEFLKRVFVKLPFEISYFSQGTFLSTETYRTSSYIIEVRNVEPEMYNNQIYISFLNKNSFTLEYYING
VKSHYSLKPDRWNKINKTEIKININNIDDLLADKQNLKQNSFYFIINNPTYLLQAYKANLLVEVLSDEAKTISIKYSDYN
AQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHDFKKSNIDSALQNKLSPLPLFTAKINE
LQSEILKTDFELATLKRIEKQLSAGENLKYYDLYSLLSGTKSENVVSRLLEEINKLENDREQMLSDVTANNYKIKVIDKQ
IVTKKGILVEFVKTTIIRLNDSKNDYLLKIKEFEARLMSKSPSNGKDLEYAKLSRLYSIQEGFYNKLIERKAEYLISSAG
YVSNNTILQRSDTPKVPVYPRANIILLVFTLAAFIISLIITLGRYLFFNEITAVGDITAYTDANVIGVIPKYKKHVPVSQ
LLVDKSPKSRLSEAFRNIRSNLQFISNEEGPKVITISSTVSGEGKTFVAINLGGIIAISGKRVILMDLDLRKPKVHMGFN
TDNSRGVSTILINKHTIEECLKFAPIENFHYITAGPIPPNPSELILSQNMDNLVETLKRTYDVVIIDTPPIGIVTDAIVN
FMRADYPIYVMKSNFSKRTFINNINHLITEKNITKLSVVLNSLDTSTFKYGYGYGYGYGYGYGYGYGSGYGSGYGYGYGK
YGSGYYDDEPKKEKKSILKRFLNLFQREKIDNG
>gnl|bykdb|A0A359I8H7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=804 residues).
MSDNINVTQESEAAEEFSLKDFLARCLSKWRWFAVSIVLFCCLGVLYVLRQQPVYSRSMELLIKDQDGGGGVADISNAFS
SLGLVSSNTNVNNELISLSSPAVMYEVVKNLGLDVNYSTPGRFHEKTLYGSNLPVNVKFHDLEEQQCAGFRIELGKDGNV
VLRKFHLETPDGDEEIEKEVKAKIGAGPIETPVGKVSIIANGNYTAPKGKKNKPVTKIIVERDGMQSTVETYGGLVKADL
ADKDADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKRDHRVPNL
EEAAKTQMKQSVEMSNKMLEVTNQMSMSIYLRDYLNNPGNAKSVIPVNTGIGSPTLEAQISNYNNLLLTRNTLAASSSDT
NPLVVDYDGQIKGLREAIVNAINGQIVALNKSLRNMEGAKGAAESQLASGSTQAKYLLSVERQQKVKESLYLYLLQKREE
NELTQKFTADNTRIITPPTGSLQPVAPKVKFILAICMFLGLCVPGVAIYIISATDTKVRSRKDLDRMSAPFAGEIPFVGK
KSIKDRMARLLPAKKNSKELERVVVAVKEGSRDAVSESFRIVRGNIDFMIRGKEGGNVIMITSFNPGSGKSFISFNLSAS
FALKGKKVLVVDGDLRHGSASQFVDMPSKGLSNYLTGNTDNWQSLVVPVAGQNGMSVMPIGHRPPNPSELLDNGRIGQFL
DEARKEYDYIFVDCPPTDVVVDTQIVEKYVDRTIFVVRAGLLDRKALEEIDAIYRNKRFKQMSIVLNGTEAASRKSYGAY
GYYG
>gnl|bykdb|A0A364XUP5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Chryseolinea flava] (length=783 residues).
MMLESNKIGPPVALPNTEGIDINKLRVTIWDNILWILLIFVVTNTAAYLVIRYSKDIYQSVSELKLDIKNEATELGIATI
TSDEPQNADLISGEIEIIRSKLFLNIVLDSINLSVSYFNKGELLNHELFGNTPYHIEYKNVDDGLYNIPLHLTETDGNSF
SIKVGESQRKITGKFNEPINLDASVVTIKRNPNFKESDEEIEFFFIINSRDVLMNYLIANLTVEPLNFYAKTIRVAFKDN
NPSKARAILQVIDDVYLKYSHEQKNLANKQKIDWLNNELQQIEEKMEGYENYFKHFTLQNKTNNLDEDLKRTVTAISRLD
SQRYEFASRMQELNQLSDGLRSKKFFVSPGLRKILPEYISKNLDRVQELFLTQEKLKLSYNETTFAYRELEKEIETHSTR
AIEHINALRTDIMKRSQEVAQQKNLLESEFINMPDKSTQYSKNERFYKLYEEFYLILMQSKSGFEIAKAGATTDFKILSP
ATFSDHPIAPNRLMIAGIGLVSSFTLIIFFIGFLYIINNKITNLQELEKLSGVPVLGVIPSSKLEGNLYIVDQPKSIVSE
ALRTLRTNLEYFLSDTVQKVVAISSTVSGEGKSFVAINLGAAIAMSQKKVLLVDLDMRKVKHNIPFPVTDHTKGMSTILI
RRHSWEECLVKTQVDYLDFIPSGPTPPNPSELLLREDFNALLLELKKHYEYIILDTPPVGLLTDGIQAMRQADVSIYIFR
ANYSKREFMLNLQRIININKFTNICSILNAMSSAGEQAYGYGYGYYEDEKNTGVKKIKEIFKI
>gnl|bykdb|A0A368JPA3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Larkinella sp. ZZJ9] (length=778 residues).
MKSSNMYSYPMYPQGEINSSDGQGTLKDYLKHWKWFLISLITLIVAGFVYIWFTEPIYRVQASLLVKDEPPKSGVSSDGI
LKDLTTYSPGKVIENEIEILKSSSLMKKVVDSLGLNIRYFRSTPFGKREIYEEAPIRIVLTDPTPNLYRADLEIGIISPT
TVRLNDWVYPANQIINTPFGRLQIFIKQPVVYTNEPLVVQVMSPAQTIRYYQSKLTVAPSGKESTVLVLTIEDAVATKGE
AILNQMIANYSSASTTEKNRAVANTLSFIQTRLKLVSAELATLEKSIETYKAVNGISGIGSGAQSLLSSLQSNDAQLNRV
AIQLSTLGDVEKYVRSKGENRGVLPTTLKFSDPTLTALIGKLTELETQRTVLLRNSPEPSAVLRSLDDQIFATRASIGET
LATLRGILTNTRSQLLAANKRLEARIGVIPGKERALMNITRQQAIKNNLYNYLLQKQEETALSFASVASNSQVIDAASGS
LEPVKPIKWLILLLFGIVGLLIPIVVIRIKRFFNERVSGRAEINQATKAPVIGEIAYVRHEFPVVVNGRKRSVAAEQIRA
LRTNLQFLRENPNDSQVLLFTSSLSGEGKSFLSLNVAVSMALVGRPTLIMDMDLRRPKLHKALNMLNFRGSSSYLTGEAT
LDEVLQQVPGFDNLFIISCGPIPLNPSELLSGPRLRELIEEARTRFDNIIIDSPPIGLVTDAQLIGPFVDVTLYAIRHNI
TNRSYLKLVDLLYQEKRFPKLNVVLNSVKNKYSYDYRYYYYRKSGNDKPNLLRKYLLH
>gnl|bykdb|A0A369QP10 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Adhaeribacter sp. HMF7616] (length=811 residues).
MANKESIVLEELDNSNYASTIEVEEESRGSDIDFIMLLSLVRKSLIWVALLIVLGLIGSFLFLRYTKPLYKSSSTLKIDE
QSEAGRLGLDGTIENQQNLSNLSGEIEIIKSNLTYERLQQKLPLDISYYAIGNILNEELYRSSPFHISYEMSNEAYYNIK
FGVSILDATRYNLSYVQGDQEVTEEHTIGEPVQKPGFTFTLKLTAPLNSDILAQKYYFTINSTGAIRQYLTSNVAVNIVN
LDASTVDISFTDHNPFKAHEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMENFVKQNKTYDVRA
DVNKQMTKLEDLNKQRVDLRMELSLLNEIDQLIGRNTSLDQMIPSLKELDDEQLSNRISQLSNLQLDRSLMMQSYKTTTK
AYQLLEEEIDFSEKAVRKLLAQNKLLLQKEVNLIDTNIRNIQQELLQMPGKETQRARLQRLFDLHEKFYLMLMDKKVEFG
IARAGTVPDFQILAPASRPAAPIYPNRLLVYGIGLAGGLFLGLGLIAGRYLLHNTITSLPELERSSFAAVLGVIPRYKKE
KLPISKLIVDKNPKSAISESIRSVRTNLEFISSSKNKRLISITSTVSGEGKTFVAVNLGAIISQSNQRVIILDLDLRKPK
IHQAFDAENTKGISTILIDRHSVAECIRRTSMPNLDFISAGPTPPNPAELILNSSFDDMVEELYHSYDVIIVDTPPVGLV
TDGILVMRKADIPIYIVRAGFSKKTFLKNMNKIMRINNFNKMCTILNDADSMVAYGYGYGYSYGYGYGYSNSYYEEDQPE
SFVTRFKKRFT
>gnl|bykdb|A0A372E5P8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. CCM 8763] (length=818 residues).
MAVKEDAELEELIRQAGGGEPTEDEDDGGGLDLTTLLTVARRSLPWIILLVALGLTAAWLFLRYTPPLYKSSSTLKIDEK
TEAGVLGLGGLGGAVEQKQSLTKLSGEVELIKSDIIYSRLNDSLALDVNYYVQGTVLETEIYGASPFEVSYEATANAAFD
QKIALRFLSPTTFELILPEDLGGTEQQHTFGQPFTAAGFRLTIRQTKDYNLAALDGQYSFVINSAGALGNYFNTNLLVDI
VNLDANTISISFTDHNPAKARDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQAEENMEAFVKRTGSYDV
KGEVSQLTGLLQTLEEERAKLQEQSEMMSDVGQLLDREQLTTRADGDVMQSIPALADVKDGQLIQRITELSDAQLDLKRA
LLSYQPGATVAMQIKEQSITNIKKIVRQLLRKNQQLLKAQEAKLLGKRAELESKLRSLPDKYTEQARLQRPLELYEKYNL
MMLDKRIEFGISMAGATADFQILSPASPAVPISPVKVMIYAIGLAAGIVLGLGLIAVRYLLHNTVTNIRELERNTHAPVL
GVIPTYDKEKMAVSKLVVDRNPKSALSEAIRSIRTNLEFIASSKKKRLISVTSTISGEGKTFVAVNLAGIIAASDQRVVI
LDLDMRKPKVNLAFDAENTKGISTILIEKHTWQECVQHTSIPALDFISAGPTPPNPSELILSDMFDPLIAELQQHYDVII
IDTPPVGLVTDGILIMRKADVPIYVVRANYSKKSFLKNINKLIRTNGFTKLTTILNDAKTTGGYGYGYGYGYGYGQGYYD
EDNTPKGGLLTRLRKRAS
>gnl|bykdb|A0A373FYU5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF32-8BH] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A373HTL7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. AM16-43] (length=820 residues).
MTEYNNQQQHLQNDENENGSGLTLHDLLQMVLANWYWFALSVLICLGVAYYYLASTPKIYSRTATILVKDSRKGGDMELG
AFSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVRDGLRTLDLYGRSPIEVDFIDDDNQRLSLEVTELEDGR
IKLADFDDKYLTKQEKRRVIRAQYGDTIPTPLGQMVVHKTPFMDSTYVDRPITVTKSSPMVTTNAYRATVKSDVANKQAS
IVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKKSNQMIDITSEATR
SITESSKFKVEGLSIENQISVANYIRDYLDDPSHAGDLIPMVASLTNNGIVAQITEYNDAILRRQKLLENSSERSPVIQD
MDNVLAAVRRSIIASLNSHVSTLEIQLSNMRKEEALANHRISTMPSQEKVLLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDQAYGSPRPVSPRSMIILGISLLAGLAIPFGIIYLIGMLDTTIRGRKDIEENISAPFLGDIPFLEGENKGG
IVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLATAGKRVVLIDLDLRRHALSTT
LGRSNSKKGITSYLAGTITDIGELITPMDVHKNLDVICAGIQPPNPTEMLLSDRLDKLIAELRESYDYVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFRNMCVVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYDDYKETS
YRKRLKLFFSKIGRRIRNKE
>gnl|bykdb|A0A373ISF0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM16-15] (length=790 residues).
MIEKKAAAGKPADDFIRIQDLWGLFVPKWHWFVLSLFVTMSVAVLRLMSTPSIYTRSAAILVKDDSNSGSSGGAMSEFSD
MGIFRSNTNINNELFTLKSPALMTEVVRRLRLNETYTVRKGLKNVGLYKANPVAVTFGEVMEKPVSFTIRIDSKDAFTIS
GLKVAGVESENTFAGRMGDSIQTVAGTLFISPTKFYSDACIGTSIRYAIGKADGAADRYLNALRVELGSKEATIINLSIN
DTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFKSEHLLPDVQAASSLYMAQSAE
NKKELLTLNTQLSTARYILKELKEKSLSQPLPTNSGIANSNIESQISEYNNMVLNRNRLIDNSSEKNPLVKDLASSLQSM
QRTIIQSVDNLIVSLNTQIRSIRQQEATTTSQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMAPVSPQKMKILLIAFALGLAVPAGVIFLKENMNSKVRGRKDLEHLSLPLVGEIPLYGCEKKSIFGRKPLRNK
RVVVVEEGNRNVINEAFRVLRSNLDFMVANTPEATAFAVTSFNPGSGKSYLSANIAISFALKGKKVLLIDGDLRHGSLSA
YINSPQPGLSDYLSGRIGNWEETLVSHDKYANLKMIPVGTVPPNPTELLENGKFAGLLAQLRTRYDYIFVDCPPIDIVAD
TQIIEKVTDRTLFVVRAGLLERSMLSELENIYREKRFKNLAMILNGTERSHGRYSYRYGYHYGSYYHSGK
>gnl|bykdb|A0A374A9J5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. AF14-19] (length=816 residues).
MAEQQINSQIQTNNEELTNTITLHDIIRMVIANWYWFVLSTVCCLCAAYYYLASTPKIYSRTATILVKDSRKGGDVDLTA
FSDLAGFQNRRNVDNEVFILQSRRLMTNVVKQLNLTVNYSVSDGLRRRDLYGQAPIDVKFINDNDNQSLAMEITPIDDDK
IRLSEFKDQFVTKHESRSVITAAYGDTIPTPVGQVVVQKSLYMAPDYIGVPIRVTKSSLGRTTNAYRAAVKSDVANKQAS
VVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKKDNRMVDITSEAAR
SVSESSRYKTEGLSLENQINVAEYIRTYLNDPKNVGELIPAMAAAGTNTAIAKQIEDYNSAILRREKLLENSSERSPVIQ
DLDNLLAAVRRSIISSLDSNISTLEIQRDAMRKEETQANIRISTMPSQEKIILGITRQQKIKEELFLYLLNKQEENQLNY
AVAESNSRSIDYAYGSNAPVSPRPMMILGIALIVGLAIPFGLLYLIGMLDTTIRGRKDIEDNVNAPFLGDIPYHEGGGKA
GIVVRETGRDALSEAFRILRSNMTFMSVSAGTDIRTILFTSSDPHAGKTFVATNLAMTLAMAGKRVLLIDLDLRRHALSS
QLGHSNSKTGITSYLAGTVSDVESMIQNSGFHQNLDVIYAGVQPPNPAEMLLSDKLDKLIAEMRGRYDYVFLDSTPAMSV
ADAIITDRLADLCIYIVREGVLDRRQLPDIERLYREKKLHNMCIVLNSTRARRHGYGYGYGYGYGYGYGYGDDYKEVSYR
KRIKHFFRSLAHKVKR
>gnl|bykdb|A0A374THP7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. TF12-30] (length=818 residues).
MLRRNQADDFIRLQDLFYLCLAKWRWFILSLAVTLGIATYYILTTPNVYQRTASLMIKDDSKSQGISSDVSSMFADMGLG
NAKSNVNNELIAIQSPAVLLETGKRLKLDVDYAIDGAFHKEALYGGDLPVTVDFIGFTDDQSGSFQLQLKGDGSYVISKI
KGSNRDNLPVDDSDEISGRLGQIIHTPLGKIKVDKAPSYSQFVKNGDAPVLYVSRSNIYAMTDRIKGSLAASLSEEKSTV
IDLTYKDVLPKRAEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKSSNLLPDVEAAAQQY
MQKSTEVDKQIMDLNSRLAIAQYIRNYLTGKVGKNQLLPSNTGIESPGIEQQIAEYNKSQLERNNLVANSSEQNPLVADY
DQSLGSMRKSITASLDNFVVTLKTQLGTLQANEAATTTQIASNPNQAKYLQTVGRQQKVKESLYLFLLQKREENELSKAF
TAYNTRIITPPTGDNKPVAPVRRNIMLVAFVLGFLIPVVIIFVRENMNTTVRGRKDLKNMNVPFLGEIPYSISRKNRPTL
EQRIRFWKKPKEVRQIVVKAGKRDIVNEAFRVLRTNFEFTIGTHPEQNVIVFTSLNPGSGKSHLAANMAMSLAIKKKKVL
LIDGDLRHGSTSMLIGSPGEGLSDYLNGRIADIRDILHKGEESGLVKYFDLIPIGTIPPNPTELLFTPLLEQMIKTMRQE
YDYVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLMERNMLPEIDALYKEKKFKNMTMILNGTKARGGRYGSHYGYGYGY
GYGYGYNYNKEKSGGAKS
>gnl|bykdb|A0A385SFR9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Chryseolinea sp. KIS68-18] (length=777 residues).
MLEIPKNIPPQQSPANEPLDLNKLKIIFKRNWLWLVVLFLVINSIAYLKVRYTKNVYESSSELKLDIKKEATEFGIKPTV
EDPNLNLLSGEIELIESRLFLGRVLDSSDLNVSYFSVGRVLNDELFQSAPFVVRYKAQNESSFNAPIHLDDTGNDEFTLQ
VGDEGQKAAGRYNSKVSLNGVDLYIEKNEAFKKGDEIGYFFVLNTRDALLGYLLRNLTAEPLNFNANTLRISFKDNNPSK
ATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFENFTLQNKTNNLDEDLKKTVSAINRLDSQRY
ELTNKIVEVNTLMEGLKTGDLFISLTQLHALPPTIAKNLEQLEDLYRDQEKLKLSYKEVTFAYRQRQKDIETLRDKSGRQ
LEEQRAEWIKRLEQINQKKARLEHEFVNIPDKSTQFSKNLRFYKLYEQFYLSLMQSKSEFEITQAGSVPDYKILSPANLS
YTPISPNKLMITGIGFVGSVVAMLLVVGLLYVLNNKITSLLDIERVTSVPMLGVVPSSRHFTKNGLHVLDHPKSMVSEAI
RTLRTNLDFFNINGQRKVIAVSSTVSGEGKSFIALNLGAVMALSKKKVVLLDLDMRKPKQNLPVNVDDTTKGISTVLIRK
NTWQECVSTTALANFDYIPSGPHPPNPSELLLNGEFEELLNNLKTQYDYIILDTPPVGLVTDGIMAMKRADISIYIFRAN
YSKKDFVLNLQRIININKFSNITTLLNALPSTGEQSYGYGYYEEPGNRPWLKKIFNT
>gnl|bykdb|A0A395YYT3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=810 residues).
MTEKKTTASKPADDFIRIQDLWGIFMPRWHWFALSLFVTLATAALYLLGTPNIYTRTAAILVKDDSKGGTSTNVVSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTVRKGLKDVELYKSSPLAVTYRHLDETPVGFTIDISSKETFVIS
DMEVNGKAFGEDFSGKMGDSIRTEIGTLVINFTKYWNDSFVGTSIRYRKGNVCAVTDYYTAALHAELGNEDATIINLSIN
DASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAE
NKKELLALNSQLSTAQYIRKELNNKKLSQLLPTNSGIANVNIESQIGEYNTIVLERNRLIANSSEKNPLAKDMANSLQSM
QRTIIQSVDNLIVSLNTQIRNIRQQEATTTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMLPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSIPFIGEIPQYLSAKKKLGFDKHTQSV
MKAIVVKEGNRNIINEAFRVLRSNIDFMAGKDSGQNVFMLTSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSTS
SYVDSPKTGLSDYLGNRVSDWKEIIVKDEKYDNLHIIPIGTVPPNPTELLEDGKLATLIEVLRSEYDYIFIDCPPIDIVA
DAQIIEKLADRTVFVVRSGLLDRSMLPELENIYQEKRFKNLSVILNGTESAGGRYGYRYGYRYGYRNGYSSYYGNKGKMG
GGVNGWSSSD
>gnl|bykdb|A0A396N3D5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tannerella sp. AF04-6] (length=802 residues).
MAAVQNNPKSKQSEEFMRIQDLLYLCASNWYWFALSLMITLGAAVLYIKVTPPVYTRSASILIKEDSNGKSFSTDAGSFA
DLGLIQANTNVNNEIISLQSPAIMTDVVKRLHLNMDYLVDGGFYREVLYGHTLPINVSIDTPDNNESSALTVKILADSTV
ELSDFIRNGEELPGKLVKGQLTDTIMTPVGKVTVCPTPYYTSQFSQPIYVSCSSLYSAVRRYAPNLSVVLNDEKSTVVDL
SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKSEHLLPDVQAASSMYMAQ
VSETDAQLLALNNQLYMARYIRNYLGGESNKYQLLPANSGIENSNLGDQITEYNNKLLQRNSLVANSSDQNPLVIDLDHA
LAAMREAIIASIDNQVVTLNAQIKNLERSGQQTTTRIAESPAQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAY
NTRIITPAGGSMLPTAPLKKNILLVAFVAGLLIPVIVIFIAENMNTKVRGRKDLENMTIPFVGEIPLAYHQDKQGSIFRK
KKLPETHTIVVKEKSRNLVNEAFRVVRTNLEFMLGKEGQSRVIMVTSANPGSGKTFITMNLAKSLAIKGKKILVIDLDMR
KASLSSYVDSPRIGISNYLSGQVENFSEIIVKGKVYPGLDVIPVGTIPPNPTELLFDLRLEQMLSTLKTEYDCIFIDCPP
VEIVADASIINKLSDMTLFIIRSGLLDRSMLYEIEGFYTDQRYKNMAVILNGTSEAYGHYGYQYGYRYGYNYGYGKGYSE
EN
>gnl|bykdb|A0A397WLT5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=792 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKSEHLLPDVQAASNLYMSQSAE
NKKEIQALTNQLTTAQYIRRELNSKEMNQPLPTNSGIANVNIESQIGEYNKIVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEVATTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSALPMAPNKKNILLVAFALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYSNNKKKKNKSQEKTIV
VEEGNRNIINEAFRVLRSNVDFMKNKNTDQKVFVITSFNPGSGKSFFSVNIATSFAIKGKKVLVIDGDLRQGSISAYVGS
PKKGLSDYLGNRVANWNEALVIDKKHANLHVLPVGTIPPNPTELLEDEKFATLMQILRNEYDYIFVDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLSELESIYLEKRFKNLSVILNGTESTGGRYSYRYGYSYGYHNGYTSYYGNSK
>gnl|bykdb|A0A399D319 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Mariniphaga sediminis] (length=840 residues).
MTQMDINKNGHQINQSQDDDSIDLKKIIFRFLRNWYWFAFVVAITLGMAFLYNRYTTPIYEISSSLLVEEEKAGSPLASG
AGGSSEGIFQGLGMMNSMRNIYNQMVILNSTPIVSRTLNELDFEVSYYAVGRVAVSERYKEVPFQVVWDEEHPQVIDADF
FLTIEPNGKLKIDMEEEVISAYSYTEEEVVKRIPGYSFSRTIDPGTKITSDEFSFTILLNELFDSNASNNYKFRFNSKKA
LLKRYREQLDVTLNDKETSILNLTLRDFNVKKGVDFLNKLTEVYQLDNLEKKNENANRTIQFISSQLQSISDSLSISESR
METFQSEHQVLDISMQSQQLLEQMRELDEELVTLETQNKYYHYLRDYIHSDTNKEETIIAPSAMGIQDPLLNSLILRLNE
LITEKSSQTSIKRGSQHPIILQLNAQIESVKNSLRENVNNIISQSDMALVNLNKRVRQFEAQVRRLPATERNYVNIERKY
KLNNEIYTFLLQKLSEAQIAKASNIPDTQLIEEPQMMGLGPVEPKKMMIYAIALLLGLALPAGVMMLADFFNNKVVSQDD
IESITKYPIIGHVFQNTKGDISRTMVLDRPNSPASEPYRAIRTKLNLITKGNQNPVIAITSTFPKEGKSYNAVNIASSFA
LMRKKTVLLDLDLRNSKLKEEFKLDSDMGVVNYIIGKAEVEDITFKTKHPWLKIIPAGPIPPNPGEMLTDEKLAELLRKL
KEIYDVIVIDSAPIGYVSDLFHVHEFIDTNLFIIRHKFTHKIALKTALEEVSKHQLKGVGLIVNNIKLSKKNYSFSGGYG
YGYGYGYGYGYGYGYGKGYGNGKGDKKSTRKHLKPEEIKS
>gnl|bykdb|A0A399SH26 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pontibacter sp. KIRAN] (length=772 residues).
MSSSINNAPNNEENLLTVLLRKFLPYWPVFIGLAILSMALAWVYLRYATPVYEIAATLIIKDEKKGVDDARMTESINAFA
SKKIVENEIEVIQSRALMKKVALGLHLYAPVYEDTKFKEVAAYTSSPVIVTHYNPDAILATEDEPQKIYFTYNPDLEEVT
VDGKSYPLNKSIRMPYGVIKFIPNDHQSSQAKEQLYFQLLPLKAVTASLLNNLQVNAANKLSTVVNLQLKDAVPERGEAI
LNLLVHNYNQASVVERNILAENTLAFIEDRMQKVEKELDKLESRVQKYKTSKGIVDLSEQGRTFLQNMSANDSKVEDINL
QLAVLAKIENYIIAKDKSAGIVPSTLGINDPVLTQLLQKLYDNEIQYQRLRKTTAVNNPILLSIADEIEKIRPSILENIQ
NQRDNLLASRKNLTNTKGSYTTALQTIPKQERELLEISRQQAIKNNVYTLLLQKREETALSFAPSATDSKVVDVAESSFA
PVSPKRNIIYLGALAFAFIVSIVLVTAKDFFSSKILYRTDIEAYTHAPIVAELMKVKHDDSQLFTKPDNPVVIEQFRQLR
TSLGLYSRTFKKRKILVTSSIPGEGKSFVSTNLAYSLAASGKRVVLVDMDMRKPKTSTQFGMLNQKGVTDYINAQYAAEE
LLQRTPFDNLWILPAGSKPGDHTEALLNGRVEDLFHHLEADFDFIVIDTPPVDLVSDGYLISEFCDITLLIIRHDHTPKN
IIKYLNYSNKHKSLHNLAIVFNGVKPRGFANREYGYGYGYRYDHVYHNKAYS
>gnl|bykdb|A0A3A5QW67 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM44-19] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A3A5RFX4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM41-16] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLDKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSAKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIIFIRENMNTRVRGRKDLDGLSVPFIGEIPLSIRGKKRVKSYE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAISLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGHIDKLSDIIVTNEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|A0A3A5RQE6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM41-16] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A3A5TI83 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM27-13] (length=805 residues).
MTEKKTTASKPADDFIRIQDLWGIFMPRWHWFALSLFVTLATAALYLLGTPNIYTRTAAILVKDDSKGGTSTNVVSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTVRKGLKDVELYKSSPLAVTYRHLDETPVGFTIDISSKETFVIS
DMEVNGKAFGEDFSGKMGDSIRTEIGTLVINFTKYWNDSFVGTSIRYRKGNVCAVTDYYTAALHAELGNEDATIINLSIN
DASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAE
NKKELLALNSQLSTAQYIRKELNNKKLSQLLPTNSGIANVNIESQIGEYNTIVLERNRLIANSSEKNPLAKDMANSLQSM
QRTIIQSVDNLIVSLNTQIRNIRQQEATTTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMLPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSIPFIGEIPQYLSAKKKLGFDKHTQSV
MKAIVVKEGNRNIINEAFRVLRSNIDFMAGKDSGQNVFMLTSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSTS
SYVDSPKTGLSDYLGNRVSDWKEIIVKDEKYDNLHIIPIGTVPPNPTELLEDGKLATLIEVLRSEYDYIFIDCPPIDIVA
DAQIIEKLADRTVFVVRSGLLDRSMLPELENIYQEKRFKNLSVILNGTESAGGRYGYRYGYRNGYSSYYGNKGKMGGVNG
WSSSD
>gnl|bykdb|A0A3A5TZ72 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM26-2] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3A5XBP2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF32-15BH] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3A5YY33 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF25-38AC] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTHIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3A5Z014 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF25-17LB] (length=806 residues).
MTINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLHLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGSLLDSIPTPLGKIIINTTPNYVKGESYILYIDKSSLYNAVNSCSSNLSVSLNNEKSSVIDL
AFKDNSIQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAIVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPAKGLSDYLGGRIDNLNEIIVSDPKQKSMDILPVGTIPPNPTELLFDERLKQVIDTVRGQYDYVLIDCPPIEL
VADTQIIEKLADRAIFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYSSD
EKYRGK
>gnl|bykdb|A0A3A5Z900 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF20-13LB] (length=796 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSGKIESTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVCTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQTYMARYIKNYLTNENNKHQLLPANSGIENANLATQLNEYNTKLLERNSLVSHSSAKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPIVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
EHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQVDRISDIIVTDEKHASFSFIPVGTIPPNPTELLFDDRLREAIDTLKQQYDIVLIDCPPVELVA
DTQIIEKLADRTIFVVRAGLLERSMLPELENIYREMKYKNMSVILNGTEGSGGRYGYQYGYKYGYNYGYAGYTKEE
>gnl|bykdb|A0A3A6AAP4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF25-18] (length=801 residues).
MAIQNNTKPGQADDFLRIQDLFYLCAAKWQWFVLSLLVAFGIGYYYLLKTPPVYTRTAELLVKREYRGRSISSDIEGFDN
FGLFRSATNVNNELVALQSPSVMTEVVKRLHLDMSYYAPGRFHDRLLYGMTLPFQANIAGIQENDFAGFTVNVYKDGRVQ
LSDFVLKGELLKEVKPVTGKFPGTLNTPLGKVTLEATSGYVRGTEYKVHVVRSGLYGAVGTCSSRLSVALNDEESTVLSL
SYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISSYKSEHLLPDVQAASNLYMAQ
SSQTSSQILALSTQLSMVRYIRNYLATTAEQNQLLPANSGLENVGIEKQISEYNTLQLQRNNLVANSSEQNPLVMDLDQS
LATIRGAIISSIDNLEVTLNTRIRNLQRNEQQTTDRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIITPPMGSMVPTAPVRRNILLVAFALGLLIPAVIIFMRENMNTKIRGRKDLENLSLPFAGEIPLCGQKSRRAILTKK
VKEKNSVVVKEGKRDLINEAFRVLRTNVEFMSGEEKHSQILVVSSFNPGSGKTFLTMNLAASLSIKGKRILVIDGDLRHG
SASAYVGSPKTGLSDYLGERLEQLDEIIQPVPDYANLFILPVGTIPPNPTELLEKERFVTLMNSFRKEFDYILIDCPPVE
LVADTQIIESQADRMLFVVRTGLLERSMLNELEIFYKEKKFKNMALVLNGTEVNNRSYKYGYRYGYHYGYGCGYPYDSDK
R
>gnl|bykdb|A0A3A6BP07 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF15-14LB] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A3A6MEG9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. OF03-11BH] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3B0C2S4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pseudozobellia sp. CCMM003] (length=795 residues).
MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDETEESVNLWEVAQKYLRYWPWFVLGILICLGGAYAYMRYAPIVYE
SSAKIKIIDEAKEMDITVDPMALLSGNPGINLDNEIQVLKSYRILGQVVEALNLDVSYFQKGNIKTTEIWNPPFAITKLI
AEDSIGQPRVYDISLDAFEARITNMDGATTVVGLAEKDTVPIQLPFNITFLENAQPIAYEGIQFRVVLKSVKDAVFALSE
KLQVQPTDKRSEVLSLSIKGQSPERSETVINELINKFNQDGIIDRQLISKRTLEFIDERFAYLSGELDSIEVGKEDFKRL
NNLSYIESDVDFSLQRKAVAQDEVTNLETQISLAALLKNAVLGQSAYGLLPVDVGLENSGINSLVAEYNEMAIEREKLIS
TVGDNHPTLVTLSGQLENLKVNILRSLNVYQTQLKLSLRQLNREKSQANSMFSRLPEKEKTLRAIERQQSIKENLFLLLL
QKREEAAMNYATTAPSIKVVDYALTSNEPLSPKKRIVYPIGLLMGLVLPFAVLFIKFSANSKIEGSSDMELATSEISLLG
EIPHLRKVKKFHDAHDRSILAESFRILATNVNYFLPKSGQQGGKVIYMTSSIESEGKSLLAYNLSVAFASLNKKVLLVDA
DLRSPKLYDYFGMGKNTKGLSDYLKDPKIHWNEFVYPGLDDNRFHKVCLSGPVPPNAPQLLSDGGFETFIDAAKETYDYI
VVDTAPTMLVADTLLISKKADITLYVMRAGLTDKKLLNFSKELHHKGKLTHMAYVLNDVRPKDSKQYSYGYGKKH
>gnl|bykdb|A0A3B7RBP8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. sh-6] (length=816 residues).
MAIDKEAELEELIRSAGSTEGQEEETDTAFDISTLLMVVRRSLPWMILLVLLGVTAAWLYLRYTQPIYQSSSTLKIDQKT
QTAVLGLGAVGGAAEAQQNSKNLAGEVELIKSNIIYRKLQDSLNLNVGYFVEGTVLANELYTDTPFRVQYSTKDGFLFNK
KIYINFIDEQHFLLLYRKNDVEQKVNGKINQTLNIEGSSISVYSTNKSPQAGVNYYFVIHDDATVWGYIGENLTVEIINP
EANTIGISFKDHNPGKARDIVNKIDTLYLQEKLAKNSLATQQTLAFLEGQLDENRNKLQGAEVALQEFVRRNKTYDVKSD
VANIAEKMAALQEERVELQRKAGALAEVASLVQQNRVLTREGETIEQSIPALTVLEDAQLSQQIALLNDQQADLNRVLES
YKSTTTAVQIKQEQLDYTRRSIGRLLQQARQLLQSELAELDRQQREFESRLQLLPEKETELARLRRPFELYEKSYLMLMD
KKVEFSIQKAGTTPDFQILSPASLPTAPISPIKIMVYAIGLAAGIGLGLGLVAVRFLLHNSVSSLRELESGSVAPVLGVV
PSYDKEKLTVSKLIVDKNPKSAISEAIRSIRTNLEFLAPSRHKRLISITSTISGEGKTFVAVNLGGIIALSDQRVVIIDL
DMRKPKVNLAFEAENTKGVSTILIERHTVQECIQRTSIPTLDFISAGPTPPNPSELILHPQFDRMLEELKQQYDVVIIDT
PPVGLVTDGVLIMRKVDIPIYIVRAGYSKKTFLKNINKLVRGSGFTKLTTILNDAQSGGAYGYGYGYGYGYGTGYGYYEE
EKAPKGLLARLRRRFS
>gnl|bykdb|A0A3B8INU3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=801 residues).
MAETNQEDYRARIQGGYPGERLEPFGNSSVLDKIDTEKIASVLRRSIVWVVLIIVGAVASAYLVVRYTKPLYESVSDIKL
NFKSEATLFGFSNFNENPNLNYLSGEIELLKSRLFFSQVISALPLQVSYFTQGKILDDEKYKESPFEATITVRNPAVFDK
KVMVTILDNDRYEIRFPWVGEDVQPEEHRFGETLSVPHLDLRLESTSHLNSSYLGEPMYFVINSNGALLNYIGAHLAVTP
LNLNANTIRVSFQEYNRQKAQDMVGAITSIYQTYTKDQKKQANQQKIEFLDDQLMQTEERLDRYDKYFENFTISNQTTDL
SSDLQKTIQQIWTLDTLLGTARSKQKSVNRMFSSVIDSADIPDQSLLFPHLNTALQEYGNLKVELDQLLLSHDPRTLIVR
RTQQSLQILRDELLDAIDQERSMIDEQVRDLVSQRAKLEASFVKLPSKGTEYNQAQRFYNLYEEFYLTLMQRKAEFEIAQ
AGTTTESVILTPATLPAAPISPNKMFIFGIGIVGGLVFGFLLVALRYILHNTITSLSEIEKLTETPVLGGIPAYKGEKLA
QTRMIISKNPKSGISEAFRSIRTNMEFLSTNGGIHTISVTSTISGEGKTFVSANLGGIISLSGQRVVIVDLDMRRPRIHL
TFGQENPLKGTSTILINKHSIEECLLPTEFENLQYIPVGPTPPNPSELLLGDSFNRLVKDLKETFDVVIFDTPPIGLVTD
GVLVMKKVDLPIYVFRADYSKRVFARTLKRLRIVNKFNNLSVILNSMKSNNGQGYGYGYGYGYGYYQDDAKGIQIKKLFQ
R
>gnl|bykdb|A0A3B9CNN6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp] (length=815 residues).
MTENNKDIIDGRKEEENKSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSDLTG
FMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSPLKLTADTIRYTFNIHIKSIEDAD
GSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFRLERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQK
FSNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKSDNSAVDIISE
TKLSLETSRQYEDDLLKTEIQLEMLSAIGDILNGKEEIGILPVNIGIENQALSNAINKYNELVLERMRLGTETSDDNPVI
REMNAQIISMQHSLKKSIENVANSLQIQNESLRQQLAQVSDKVSNIPYLERETVSIERNQEIKAALYTYLLNKREETALS
MVATTPVAQVIDKALVNPIHVAPHRSMIVLLFFAIGLILPAIVIYLIEQLRVKVGSVSEVEDNIHVPIIGAIPSKTAGMH
NDKIVSPNSRDVVTEAFRMVRTNLDFTMPQGGKVIMVTSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKI
SGRRQTKGLVNYLVKKEENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLVTDT
MLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETSTYGYGYGYGYGYGYGNEKKMTLK
TRFRLFWKNLKKRKE
>gnl|bykdb|A0A3B9FAU3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp] (length=818 residues).
MATNNSLESEKNYSATAENNELENGGFNLRMLLDIVLGNWFWILQSVILFGAAGWYYLKITPNTYQRTALVVIKEDSPQR
GKDLNAMFANLGQNPDQSNVNNEMAAIQAPSNVLETVKRLNLDMNYTMEGRWHKNILYGRSLPANVRMMGLGDHESAAMQ
MELQPNGVVKLSNFMRNGKPVGSPEVTVTGRTSTIIGTPVGNVLVTPTQYYGSFVTHTKDPILVTRTDLYTKTEGVQRNL
SVELTDKMSTLVRISYKDKEPYRADDIINTLITVYKESWVREKNMLTIATTKFINERLAIIERELSGIDSDISSYKSSNL
LPSVQAASQMSMQQSQESQKQVLALNTQRSMAQYVKGMLTRGAKSRKLLPTNAGLESTGIEQQIAEYNTLLLQRNSLIAN
SSERNPIVSDYDEQLAQIRKVILEGIDNLCSTIDLQLSHAQQNENQATAKIASSPKQEKYLTSVGRQQQVKEQLYLFLLQ
KREENEMNQAFTAYNIRIITAPFGNAYPISPNHRNILLIALALGLMLPIGLFYLRESMNTTVRGRKDIEGLTIPFIGEIP
YTGKRKWWQRRNKHRDKLQIVVQEGKRNVMNEAFRVLRTKLEFLISEDRKDNVMIMTSFNSGSGKTYLSANIAMSLAIKQ
KKVLIIDCDIRKAMASALIGSPQVGLTHYLTGKDTDLHELIHTYKGNENLSILPVGIVPPNPTELLGNGRLKDLLEEVRS
QYDYVLLDCPPIEVVADTEIISSYVDRTIFIVRAGLIDRSLLKELQRLYNAGKYRNMALILNGTETRVGYHRYGYGYGYG
YGYGETDDDKKKHKSKKK
>gnl|bykdb|A0A3B9FXJ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=812 residues).
MSNNAKFQAAPQQESTSGSSGVDLQLLLLFTWKNRYIILLIMMLSLLAGYMVNKYSVPRYSAKSVVQFKEFDPSSSLDFA
DILRPGNVDRLNEEMTVITSKSYKYNALQELPIEISLIASGRIRNTDMYYNGPFWVDIDVQDSTVLGDVIELRPIGDQKI
RCAYEWKGETWSQELEYNKPYSTPAFSISVSRNGKGKVLAESYELIIRNKLTVAKAMEKRIRIDAENTYGGKIVIEYTDV
NDQRAKDVVNTIADAIVTNGLERKSVSANSIISFIQSQIDSLENELYIQENILKDFKKDAQLINPSIAEQNLMTKFNELD
QNKLDVQLEERSLKWLLDYANNNIEDLDALSGYFGNLKFNNFAPYFNSLSELEKQKANLMLSLPPTDPKVKLVTGQIDEV
KKNFKEALVNAQEQLEVRKNYLAEQERKYMGQFLQLPEKESEYMRLTRLSDIKEKYYLLLKEKQAEYEITLAGLVSDYAV
LDSATETVQVAPKVLQVWGIAIMAGLLLSFAFVYYQYLSNDTIFGVPDILRKTDISIAGVLPFHDDMQPGAPSVVVTNRA
TSIISESFRGLRTAVLQHFSRLPATTEGRIIAVTSTVSGEGKTFVTANLSRSLALMGKRVIVVDYDLRKPKVGKAFGEQA
REGVASILNNNTDWHDKVIHNEQYQLDLLLCGPVPPNPAELLAGPGALALLEALKKEYDFVVVDNAPVGMVSDVIPLLSE
VDINLYMIRAYFSRRRFIDNLDRLMEYHGITNIQAVLNNIGEQQGYGEGAYSYGYGYGYGYGYGYGYGYGSDGYLEERKP
KRGSIFKRLFRK
>gnl|bykdb|A0A3C0ZQC7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=793 residues).
MNIGKGDIERIHRDGISQEPTFQDYVQIVLRGKWMILASFLLVLAGTAVFTFTTSPVYESTATVLVDTKGQQSQMPLFDV
TGIGAVKNIKNELEILKSRSLAEAVAVRLIKRGYTDSTNSERILIIWDRAESGPEDILLTASEIAKRLMTAVEFEPIRDS
DVIKVTARSVQPKEAALIANTFAEAYYDRNLFSSRSRSRAAREFLDTQLKVRKSSLDESEGTLQKYMEQKGIVSLDDEAK
KVIDQLATLEAQRDAADIELQALSKTLTSYQEELAKQEPNVAKAIGEANDPYIRLLQEQLAMLEVRRDVTVAQNPTYVGQ
DIYTQKLKEIDVQINALREKLRKRTEEFLLSLLPGQRSTGSSNDPASFLSEAKQKIIETQIQIQSLQSKKDALQVVLTQY
ERHFESIPQKSIQYARLQRARLSSEKLYLLVEEKFNEASIKEKSEFGYIFVIDPAIVPLAPVSPKVRLNLLLGAILGLGL
GIGFVFLREYIDVRARTPEDLKKRGYSTLTAIALMDEEIQKLGGKTKIERDGRLVDAHLLSFVNPLSSIAESYRRLRTNV
QYAQLDEPLQSIMVTSANPGEGKSTTVSNLATTFAQTGKKIVLLDTDLRKPSLHAEFGLDRDPGLTDLLLGNATLESVLR
KTPVEGLDIIPSGSIPPNPSEMLGSQKMKELIKRLKERYDILMFDSPPVLAVTDPVVLSTLVDGVIVVVSSGHTRMDAVD
RTVELIQNVGAKSLGLVLNNFDLRLAYGGYYGYYRYKYYSYGYGYSYGQGPNGXXFLCDLVPLWQMTGFRPGF
>gnl|bykdb|A0A3C1E5L7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp] (length=824 residues).
MATNNSLESEKNYSATAENNELENGGFNLRMLLDIVLGNWFWILLSVILFGAAGWYYLKITPNTYQRTALVVIKEDSPQR
GKDLNAMFANLGQNPDQSNVNNEMAAIQAPSNVLETVKRLNLDMNYTMEGRWHKNILYGRSLPANVRMMGLGDHESAAMQ
MELQPNGVVKLSNFMRNGKPVGSPEVTVTGRTSTIIGTPVGNVLVTPTQYYGSFVTHTKDPILVTRTDLYTKTEGVQRNL
SMELADKMSTLVRISYKDKEPYRADDIINTLITVYKESWVRDKNMLTIATTKFINERLAIIERELSGIDSDISSYKSSNL
LPSVQAASQMSMQQSQESQKQVLALNTQRSMAQYVKGMLTRGAKSRKLLPTNAGLESTGIEQQIAEYNTLLLQRNSLIAN
SSERNPIVSDYDEQLAQIRKVILEGIDNLCSTIDLQLSHAQQNENQATAKIASSPKQEKYLTSVGRQQQVKEQLYLFLLQ
KREENEMNQAFTAYNIRIITAPFGNAYPISPNHRNILLIALALGLMLPIGLFYLRESMNTTVRGRKDIEGLTIPFIGEIP
YTGKRKWWQRRNKRRDKLQIVVQEGKRNVMNEAFRVLRTKLEFLISEDRKDNVMIMTSFNSGSGKTYLSANIAMSLAIKQ
KKVLIIDCDIRKAMVSALIGSPQVGLTHYLTGKETDLHELIHTYKGNENLSILPVGIVPPNPTELLGNGRLKDLLEEVRS
QYDYVLLDCPPIEVVADTEIISSYVDRTIFIVRAGLLDRSLLKELQRLYNAGKYRNMALILNGTETRVGYHRYGYGYGYG
YGYGYGYGYGETDDDKKKHKSKKK
>gnl|bykdb|A0A3C1ITV0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonadaceae bacterium] (length=812 residues).
MKEDYNSIGAAETEDQKNEFQLSDMISWTLCHKKFFAISIVICVALGLIYAQRAQRIYQRSASVMLRSDNKGQAQISELA
AFADLGIGSTGIDVYNELQAFQSPLLMQDVVNQLRLNVTYKSKNWIGYVTDWYDKTPICVEYKNLPDHVGEQPLNSVTFV
AEKEGQSQLTVKDFKINGIKSDAPAQTVKLGQPFKTPVGTVVLKATKEYGKNFEQAVIVGYERPELTAKSCQARLTAELA
DKLATVINFSYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFKSSNRLLDMN
AETAQVTQESSKYSEQAFLANNQLAVARFIREYLVDNTRQYDLLPSNSGVGSQAIEEQIAEYNKRLLERQRLVANSSDSN
PLVSDINNQLRMMRSTILRSVDNHISALKIQADRLSAQENAIENRISAGPGKAKELLTIERQQKIKEELYLYLLQKREEN
ELQASIVVNNTRLLKPATGDSVPVSPKKGIILAAAFILGLAIPYGYMFASNMLNTKVRSRKDLEGLEVPVLGDVPLADGA
KKLSLMSRLMKKENESETPRIVVEDHNRNVINEAYRVVRTNLDFMIGANKSEAIMATSLYPGSGKTFTSVNLATAMALKN
KKVIIVDLDIRKGTFSKIVNSPSTGVCAYLNGQVSLDDIILPSKTTKLLFDSIPTGHLAPNPAELLLSDRLQAMIDELKQ
RYDYVFVDCPPITMVTDASLIASHIDRTIFIARAGLMDRRTLPEIDEIYKENHYKNMCLLLNGSDESGTYTRYGYGYGYG
YGYGYGNDTKKQ
>gnl|bykdb|A0A3D0MYJ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=746 residues).
MNKNQDIFIDETKSGTETTINDIRFYFFSILKYKYIILITTIVGFLVAFFFARSLPNIYQSKVQINVEKKQQSILTGLSV
PEGSAGSDIQSQIAIMKGYYVREIVAKSILDTLNTIKDIDKSLYPNLYIKNKENTYNLINEDGLRKRLEGMASITAPKNL
NIIDISVKSTSFPEASLISIIYANSYLSYSLELSKSELTLKRKFLENEKEKKFNELSIAESNLENFQKQNGIVDVQQNVS
ELLGKSSEVENIKNLGKIELNAVEIQINNLRRKISEISPEVDLYVNSQANQSKFTTISNEIASLEVKRDIELSTVENPQV
YAKVESDYNKKISTLKSQYDKYYEEFVIGITSLTPDIKNDLTTELFKANIQKQAIQNKIGIVNSLSSQYNAQIKTLPSQV
IEYAKLERDKLAAEKLYAALESNYQESLINERTQTIKSYVIDPGYDDNSPIGPDRRNMNIFGIIAGLIIGLAFALMRIYF
NKNLSTPEELESKGVSLLSWIPNIEQITDKSDPTNDFIVAKKPSSQISEAFKALRTRITFSKLEDKPLKTILVTSSLPSD
GKTIVSVNLAGSFALDNKKVILIDCDLRKPRVHTVFEFDRFPGLSDFLFHHVNFEDIVRDSGFDNLSVITAGTIPPNPSE
MLGSLQMKKFLELVESKYDIVILDSPPLISVTDSEILYNLTDGTVLVAQAEKTDKKAFFKTYNQLKRINPHNLLGAVLNN
FKFNTSYGYYYNYYYYYSGDSKKKNN
>gnl|bykdb|A0A3D0VUF6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidales bacterium] (length=807 residues).
MTDSRKIKFNDEFDFKLFLNITRKSLIYIIVFSALLFTAVYVYLRYTQPVYESACIVQINTDDKAEKLFDNKTYYEDDIY
RKIEIMRSPVFMQRVVSNLPLGVSVFAKGNILNFELYDDVPFDIKYEIVDSTFYGVPLLIEVHDTGFVITEINGIQTDKS
FRFHEPVSLPQVNFVLTPINNDAHAFFKSNRNKQFIVQFNNLTDIAAQYSQQVNIAVINDVAKTIRISLKDYNPRKAADV
VNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQSSAPSVDSSLDRTALQSRLFELDNLISENSSEV
ESLEIFYKAFSSGNADIITLLPLISGIESQVYLSPYLQSLKDLEMRKQELLLRVTENSTAIESINAQIEFQNKIIRESTI
GLLTKYKRQYQRYVAEKNNILRMLGKPVIGTMDDQSRIERYYSVNEKFYNQLIEKKIEHSIAQAGYVSQLIVLQPAQSNF
APVSPNNKLIWIGAFVFAMVLSFAFLILRYILYNEVVSLRDVKKLTTVPVLGVIPKYKSFIPVSQLIVDTRPRSLLAEAL
RAIRTNLQFIKNITQAKVIAISSTVSGEGKTFVAINFAGVLAFNNKNVIVLDFDLRKPKIHLGFNTDNEKGISSILLKIN
TVEECIKQSSIPNLHFITAGPTPINPSELILTNETDELLTFLKTKYDYIIMDTPPIGLVSDAMKPLQYADYPIYVVRANY
SKRSYIYNIEKLYHENNLRFMSIILNNVDPEITGAGSSMGFAYGYGYGYGYNNSKHGYYDSEDIVKKSWKDRIFEKFRRK
DDGSSNV
>gnl|bykdb|A0A3D1KEX9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotellaceae bacterium] (length=821 residues).
MAEQYIEGAQQLQQEENEEMDIFSILRICVAVFLRNWKWFLLSVVACLLFALLFVKKQPRVYSRQSTLLIENNDNNGKYA
NNSALNALKQLNGVQVTDNLKNEIFILQSRRLMEMVVERMNLDVDYVMMKGLQPVTLFKHNPIKVEFLSPYFEDISFEVE
LLPSKQLKVSDMQIDDSDVDFKQVVSYGQSFNSPAGNIRISQAEFDPEFVGKIIHVTRIKKEDAITKFNKAVTASEVNKE
ASLISLTCKDNNKDRAEAILTVLMDLYKRDIVESKNSVAANTAKFVDQRIDLIGSELNDVENKLAKFKQNNKIVDFTENA
RTYLQQSALSQQELNKTQAELSVAKYLREYVVKNASNTNLIPDLNLGDNGAMQGQIGKYNDAVIQYTRLSANSSNSSSVI
QDYEKSLVAMRSAIKVSLDNYVNSLQLQLKKIQSVDNRFQSAMQGIPQKEIQALDITRQQTIKETLYTYLLNKREEVALQ
LAINEANIRIVEYPYGLPTPISPKTGIILFVAFLLGLAIPAMILWAKIQMDTNVRSRRDVEEVMTAPILGDIPEWVDDNN
EQKLLTKDDNGKAISEAFRVLRYNLNFVLKDKGVIMMTSSTPSQGKSFISRNLSVILGVAGKKTILVDADIRKNTLSNVV
RSHGTGLTGFLNGNTDNVDDIIVKDLSENLDFIPAGIRPPNPSELLMSDNLDKLVSELRKRYDYIVIDTTPAISVADAGI
VNRVADVTLYVIRVGIEDRRFLKQLELLYKSGKYHNLNIVVNGAHSGGEGGSYGYGYGYGYGYGYGYGYGYGNDENKKDG
NLFKSVIGKFSQIRRHNVRRR
>gnl|bykdb|A0A3D1NQW3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp] (length=816 residues).
MTPNNINPNSANSDTKQEEHITFSVHDLIQTVIANWYWFVISVFVCVGCGYIYILRTPKIYSRTANILVKDSRKGGDTDL
ATLSDLAGLSQRRNVDNEIYILQSRRLMTEVVKQLGLTVQYETKDGLRPQDLYGQSPIAVEFINDNDRQGFRFEVSLRPD
SIVKLNYFEIFGPDKQKFKQEISAVFGDTISTPVGQMIIRPTLYMSPDYYEKAPIRVTKGNLGVVTQFYQHEVKSFVANK
QASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKKDNKIYDIVSE
AEQTITESAQYKTDGLSLENQIRMTEFLKEYLLDPTKTNELIPGTLSINSPAINSQIEGYNTELQRYMKLNSESSENNPI
IQNLGNGLASTRRSIIATLDSYISTLQIQLAALRKEEALTNQRISSVPTQEKQILDIVRQQKIKEELYLYLLNKREENAI
TMVITESNSRTIDSAYGSPRPVSPNTVLIAGIAFLFGLGIPFLVIYLIQILDTTIRGRKDIEDNLSVPFLGDIPQYSGEK
QRGSFVVRENGRDPVSEAFRMIRSNMNFMNLGKGEIKVIMITSSNPHAGKTFVSTNLAMTFATTGKKVVIMDLDLRRRTL
SKQMGHGGDTNGISSYLSGNTELQAIIRKSKLSENLDIIYAGIQPPNPSEMLLSQRMEELTAELKLRYDYIIIDSTPAMA
VADAIITDRLADLSIYVVREGLLDRRQLPDIERLYREKKFHNMAIILNGASSTKRHGYGYGYGYGYGYGLDEEETTTKKG
FWGKLCEWTRNKFQKK
>gnl|bykdb|A0A3D2BF46 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes obesi] (length=833 residues).
MEENRNVNNVPAEGNEDSINFSIHDLIQMVIGNWFWFLLSTVVCLSCALFYIYTAPKVYNRTATILIKDGKKGSETDIAA
FGDLLGATARRNVDNEIIVLKSRNLMTEVVRRLNLHVNYVVKHGLRTENLYRRSPIDVTFIDDNERQALAFELTPVDNEK
FSLTKFVNRTSADSDKDKDSEIYEVEMTGRFNDTITTPCGLLVVTPTLYMSDDYFGDPISVSKQIVSSVASGYNKRIAIE
LVEKQANAISISLDDNIPRRAEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKISTYKKDNEMYD
ITAQATQSLTESSQFKTAGLSVENQISMAQYIRDYLLNDTKLRDLIPANVAITNVSISDQIKNYNELMLRRDKLAGNASS
NSPVIQDFDSELAALRRAIIASLQSHISTLEIQLNNIRREESLARTRIASATRQSTELLDNTRQQRIKEELYLYLLNKRE
ENELTKAIADNNARIIDPAYGSSTPVAPRSVIILFIALLFGLATPFGIIYLMEILDTTIRGRKDIEDKLSIPFLGDIPEY
HGSTRQGSVVVRDNGRDSVSEAFRLIRSNLGFMSVKSGKLQIIMVTSSNPHAGKTFVTTNLAMTLALADKKVVIVDLDLR
RRTLSKQMGQRDNRNGVSGYISGTIANLNDIVFQSGLHENLDIIFAGLQPPNPAEMLLSEKFDEFMADLRKRYDYVVIDS
VPAMAVADALITDRLADLTIYVIREGLLDRRQLPDIEKLYREKKFHNMSIVLNGSTGGARRGYGYGYGYGYGYGYGYGYG
YGEDESQKSSAVIDSRYNLTQRLKDFLGLNDKK
>gnl|bykdb|A0A3D3LS70 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=749 residues).
MSDKSNNIPSVLKKDKEIDNLHLFLNLVKSNWILILIVFIISAVFTGLYVFRAKDIYKSSTSLLIQKPQGSLLTSNMIPG
FSDYASDRSISNEIEILKSQTIRSLTATALIDSFKNSDSKTDFYYLINRNKKVNSEHILQDELTELLGGIVSISQKRGLD
IISIDVDSPSRTEARLIANVYAAAYLNYNLEFSRKGVKNVGDYLFEIKNKKLNDLNNSEAALQDFQQRGGIVFLDDQAKS
IVEQIATLEAQKNASEVELITSRRTYDALKSELEKLDPQLITYVESQISQSYVEEIQKTIANVEAERDMELTIPKDPKLI
EKVKNEYDAKITALKKSLDEKVELLKTGIYAGTPEERKEITAELLRSGISIQSSNARFNSLRNLLGKYEGEFSKLPSQSI
ELAKLERNRRADEKLYLLLEEKYQESVINEKSQLGNVSIIDKASLPIKPFKPNRMLIMAGGCTLGLLLGFGIAFLRNFLD
RTIKSPEDIESKGISMLAWIPSIENLKTKGSSLDEFFVANNPKSKESEAFKALRTRIQFSKLDGKPLQTILITSSVPSEG
KTTVAVNLAGSFALSDKKVLLIDCDLRKPRVHSLFETNRFPGLSDYLFGKVNFEEILNKTKLPLMEFITSGTIPPNPSEL
LSSQQFKNLLDMLREKYDYVILDSPPFISVTDSEILSRIVDGEVLVALANKTPIDVFLKSFQRLYSIDPHNFLGVVLNNF
NYNNVYGYYYNYYYYYNQENKNKTATNQN
>gnl|bykdb|A0A3D5KRY6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagales bacterium] (length=766 residues).
FIKATLLKNWYWLAAFSFAGMVGGYAYNKVVLPYYRISTTVLVHDESKTTDLNNIYRQLSTIQGGPAIQDEVGVLQSYNL
SLQTVKYFNWRYSWYQKRFIGKRDLYKNDPLTLVLPSDFIQLENVPIHIKIISKTKYEISCDEKIRIGGWSKHIQFHKEQ
TLGEAFKNEFFQFTISAKTGVAPQEDEEYVLIFNDLSRMALAYKEKLVVKALSAIDPTINSNMITLELKTNQLERDVDFL
DQLSKMYIQYGLEKKNRKASNTITFIDNQIAGVNYSLQSAGNMFTNFRAENRTVDLGREASLVVENLKKVEADRANLDLR
LESFNNLKYYLENRDQNKDLVFPSIEQLTDPALIETVKKLNGLYSNREVLSYTVQEKNPVLVSLNNEIRFTQKSLLENIE
SLISNAKLEQKTLDDQQARINSELSKLPKTEQNLIGIKRNFDLNNELYTFLLQRRAEAEITRASNTPDATVLDPVDQDIA
IILGPILWLDLAVGFAVGLLGALGLIILKEAATNTVSDADEVARLLDVATIGSISHNRYKTERPTIDFPRSSIAESFRGI
RGNLEFLFNDSPRKVLAIHSYMPGEGKSFVAFNIAVIFAMNNKKVLLVDGDLRKPRLHLMLKQENTTGLSLLLEKKTKAE
EIIRKTDIPNLSFVPSGPVLPNSSELLSTNLIKDFIQAAKEQFDYIIFDNAPIGVVFDGSLIGRHADINLILLRLNFSQK
SEISAINKIGHEGILKHVAIILNEIPQVEGYGYYSEDGKSKKSKKK
>gnl|bykdb|A0A3D8HG59 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. 426-9] (length=786 residues).
MEPNQELENLQQQEENELNLGDIIQIVRANWYWFALSVVVCMSAAFVYLQWAPKQYTRTASVLIKDDTKGSGAMSEASAF
SDLGMFSMKSSVDNEVLVFQSRQLMQNVVKRLKLDISYTQKRGLRTTELYTQSPVHLEFPDAEPNQQFRLVATAIDEGKV
ALSDFEADSVDVSDAVTVALNDTVQTPVGRVVVTPTLFYTTAYFGTPVRVTKSDLDETVLHFNRILQVALASKTATIINL
TLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFKRENQLTDIVSETGMYLKE
SSEYSREGLSLENQLTLARYIRSYLVDPSKEAELIPANTGISDSNVESQIGEYNALLLKRDRLVSSSSNRNPVVMSLNSS
IQAMKQTIVRSVDNLIVSLNIQIKNVRSREEQNVRRISAVPGQQKQVLSIERQQKIKEELYLYLLNKREENALSQAITES
NARIIDPASGSKKPVAPKSMMVMLASLILGCMIPAGVFWMQATMDTKVRTRKDLEGRMTIPFLGEIPSREKKDKNEIVVR
EGGRDSVSEAFRIVRTNMDFMRVKAKDLKVVMFTSFNPGAGKTFVSMNLAMSFALTKKKVVLVDLDVRKGTLTSHTAGSG
KGVTNFLSGKVTDVDEIISRNEFHENLDIIHAGPVPPNPAELLLSDRLETLIAGLKERYDYVILDNVPSGVVADAAIVNR
VADLTIYVIRAGLFDRRQLPDLERMYRQEKLRNLCVILNGVNYKRIGYGYGYGYGYGYGYGYGNKE
>gnl|bykdb|A0A3E1F1A3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Brumimicrobium aurantiacum] (length=771 residues).
MINQKGKIFVNTTLDFKVLKIVIKRNWYWCVLISLILGILAFSYVRYTKPIYESKMLIQINSENQGADVLGFAEARSDGS
IAKEIELLRSQMLFEKAVQNLPLTVSHYAKGEFLTETLYKQNSVSIDPVLLKDSSLFGVPIYLSVDEEKVLMRFNHKGVD
YNYKFIPNSLVQTPFFKMRVDILNWNQFKTNSSNNKYYIVLNEDKVLANNLHSGLSVSLVDNNAKTVEVAYRSSSPQLAT
DMVKSLVSNFFNYDEDLNKESADNILDFINQQLDSLTQELSVSKDSIMYYQRRENITNPEYLTSSVASKMEKLKAEENNA
LEEMRVLETVKKKIEGNPNSLDVYRLIPIIIGKSYESSLNQQIQELYELIEEKEDLLFQVTPQNEKISKLEGRIQVRKEN
IDEVVVLLSSRIKEKLAIIRKDLAEIEELYFKLPEKQMELSRLMNIKELNEKYFSLLTDKRVVYSISNAGYSTDNKILND
AVVPNQSVFPKVGMIYGAALFLSISLSILILLLRYLAFNEINQLSDLKTLIPDSVGVLGSIPLVKNKADHSILVVDKNPR
SMISEAFRTVRTNLSFVKNDIRTITVTSTVSGEGKTFIVLNLAGIIAMSGKKVLVVDLDMRRPVVHKGLGANNNKGMSNL
LARLCEKEDVIQKSRIQNLDFISAGPIPPNPSELILGSRFDELIEEFKEAYDMVIFDNPPVGIVSDGIQVLRKADVPIYV
FRSNYSKRHFSEKLFDISEIKELKNINIVLNAVDAKSSTYGYGYGNYYSED
>gnl|bykdb|A0A3E4JMC4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=792 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLTDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPTELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A3E4JP35 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3E4KP40 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides intestinalis] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3E4NX82 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. 20_3] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3E4SK73 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=830 residues).
MIQNNQATMQNVPGRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYYLLSTPSVYQRTAFILIKEDGKSQSIN
SDVASMFSDMGLSGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHGNLFSIVHVSGTDKAGNVVESDEEVQGKLGQTVRTAMGYVCVDQAPGYSAFVNGHESRKLHVTRTNLYAMTDHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDIKPVQPVRRNIILVAFVLGFLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYSISRKNRPTLLQRIQFWKKPKETRQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAAN
IAMSFAIKEKKVLVIDGDLRHGSISMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKGFDVLPIGTMPPNPTELLFT
DRLEKIIKQIRGEYDYVFIDCPPVEIVADTQIIEKFTDRTIFVVRSGLMQRSMLGDIEQLYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGGQK
>gnl|bykdb|A0A3E4SYU0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=804 residues).
MAINQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLVVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGSLLDSIPTPLGKIIINTTPNYVKGESYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDVLSMLISLYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSIYMAQ
SSQTNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVMDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFGKKP
QEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPARGLSDYLGGSIDNLNEIIVSDPKQKSMDILPVGTIPPNPTELLFDERLKQVIDTVRGQYDYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLERSMLAELEKIYEEKKCKNISLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYSSD
EKSM
>gnl|bykdb|A0A3E4WKT5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVINL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3E4XFU8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A3E4ZNL4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=790 residues).
MMEKRINAGKPVDDFIRIQDLWGIFVPKWYWFAISLFITLVCASLYLLSTPNIYTRTAAVLIKDDSKNGSSTSAMNEFAD
MGLFKSNTNINNELLTMKSPTLMTEVVRRLVLNETYIIRRGLKQIELYKNSPVWVTYLANNKKDVSFAIEINGSNQFHLS
EFVVAGEETDEQFEGNIGDSIQTSAGTLAVSLTSQYNDSFIGSTIHYSKNSADKVADNYAQALRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGERLGVIENELGHVDENISNYKSEHLLPDVQTASNLYMNQSAE
NKKEIQALSNQLSTAQYIRRELNSKDMNQPLPTNSGISSVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEAMNTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
VTTPRGSALPTAPVKKDILLVAFVLGLLIPAVIIFMQENMNTKVRGKKDLENLSIPYIGEIPLYGKGKKKNKSQEKIIVV
EEGNRNIINEAFRVLRSNVDFMTGKESKQKVFVVTSFNPGSGKSFFSVNIAMSFAIKGKKVLVIDGDLRHGSTSAYVGSP
KKGLSDYLGNRVANWNEALVTDKKHANLHVLPVGTIPPNPTELLEDGKFATLMQILRNEYDYIFVDCPPIDIVADTQIIE
QYADRTLFVIRAGLLDRSLLSALETFYQKKRFKNLAIVLNGTESTGGRYGYRYGYSFGYHNAYTSYYGNK
>gnl|bykdb|A0A3E4ZTK7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=791 residues).
MNTEQETNTRVEENELNLEDILQVVLANWHWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGALSESAAFEDL
GIFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKEGLRTVELYTQSPVLLSFPDAEEAQAFSLRAKPISAEEVVLS
DFVIDDESAGESMTVALNDTVTTPVGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVAIGFQANLQATLASKTATIINLTLQ
DVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGSVDSDIESYKREHQLTDISSETGMYLQTSSR
NQQEGLSLENQLSLAKYIKNYLTDPGKSSELIPANTGISDVNIESQIGEYNEMLLKRDKLISNSSNKNPVVQDLNNSLIA
MKQTIIRSVDNLIVGLNIKIKNVQAQEEQTNRRISAVPTQQKEILSVERRQKIKEELYLYLLNKREENELTQRMTESNAR
IIDPASGSNVPVAPKSMMIFLASIVLGCAIPAGVLWMLVISDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKNEVVVHENG
RDSVSEAFRIVRTNMDFMRVKDKNMQVVMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLDIRKGTLSSHVKVSDMGV
TNYLSGRVDNVDEIIRKGELYDKLDIIHAGPVPPNPAELLLSDRLETLVAELRKRYDYIILDNVPAGVVADAVIVNRVAD
LTIYVVRAGRMDRRALPEVEKLYKEGKLRNMSLILNGTMYKHGTYGYGYGYGYGYGYGYGYGYGDGHNKKK
>gnl|bykdb|A0A3E5BRW7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides oleiciplenus] (length=790 residues).
MVEKKKPADDFIRIQDLWGMFVPKWHWFAGSLLITLAIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMSDFSDLGIF
KSNTNINNELLTLKSPTLMTEVVNRLGLNDIFTVRRGLKNVDLYQSTPVTVTFFDKVETPLSFTIEFSSKDMFTISEFEI
SEESTRETFSARPGDSIHTSVGTMIISLTQEFTDALTDTPVRYARRSVRDVADAYTRELVAELGNEDATIINLSISDASI
RKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYKSEHLLPDVQAASSLYMTQSAENNKE
LSALNNQLSTAQYIRRELNAKLLDQPLPANSGIVNANIETLIGEYNNLVLDRNRLIANSSEKNPLVKNMANSLQSMQRTI
IQSVDNLIVSLNTQIRSIRQQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRLITAP
RGSMFPTAPRKMNILLVAFAIGLLVPAVVIFMKENMNTKVRGRKDLENLSVPFIGEIPQCSGTKRKWELKKRQKMNFIVV
NEGNRNIINEAFRVLRSNMDFMASKDSSQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGTISSDINSP
EKGLSDYLNSRVENWREIIVSHKEYANLQFLPIGTVPPNPTELLEDRKLADLITALRPEYDYIFIDCPPVDIVADAQIIE
KLADRTIFVIRSGLLDRTMLSELETMYTAKRFKNLSMILNGTESTGGRYGYGYRYGYHYGYASYYGGKDK
>gnl|bykdb|A0A3E5BU42 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=775 residues).
MQNNTLSNKNEQSINLVDLFVYLLSKWKWFVLSVLLFGGLAWYHYATLPLVFFRNVTVIIKDPSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVEEGLRMNELYNQSPINVSFINVMPERYISFTVTPKNAKQVLLSDFTGI
PAANDKTYTMRLNDTLTIGSERILITGTDRWGQAWTERDIRVSKNPLNAVAGRFQGSMGIRQEEDESSILVLSLKDDSPL
RAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIERELGGVETELEAFKQSNQLMDIGSLAGQYMGEAQTYSADA
LEQETQLKLAQFIKEYLTDPTKNRDLIPSGTGISDASVEGQINQYNALKLKRDKLIADSSESNPVVEELNNAIHALRQSI
IRAVDNMIVSINMKRNDARSRQAQAQARFTTVPTKERQMLSIERQQKIKESLYMFLLNRREENALSQAMADNNARTIDSV
DGPVGPIAPVRNRILLLGVLVGLAVPGVVFLMILFMDTRVRSRKDLKGAVSIPFLGEIPQDKEAAKTGVAVGRDDGMLSE
SFRILRTNMAFMAKKDKPMQVITFTSFNEGAGKTFVSRNLAMSLVLTKKRVVLVDLDIRKGTLSRHFSKHPVGVTNYLAD
ESIALDDIIHTDEKSGGLDIISSGTVAPNPAELLMDSRLDTMMAELRKRYDYVIVDNVPVGIVADATISNRISDLTIFVV
RAGKLDRRQLPDLEELYRDNKLCNMSLILNGVDPSRRGYGYGYGYGYGYGKRKNK
>gnl|bykdb|A0A3E5DXI5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 4_1_36] (length=804 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLVKEDSKGKSFSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGNLLDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKHN
>gnl|bykdb|A0A3E5E153 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 4_1_36] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A3E5E9M7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=831 residues).
MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYYLLSTPSVYQRTASILIKEDGKSQSIN
SDVTSMFSDMGLSGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHGNLFSIVHVSGTDKAGNQVESDEEVQGKLGQTVRTAMGYVCVDQAPGYSAFVNGHESRKLHVTRTNLYAMTDHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNLVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDTKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYSISRKNRPTLLQRIQFWKKPKETLQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGN
IAMSLAIKKKKVLVIDGDLRRGATSMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFT
DRLEKMIRQMRGEYDYVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLMQRSLLGDIEQFYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGGVQK
>gnl|bykdb|A0A3E5EM98 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=804 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLVKEDSKGKSFSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGNLLDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKHN
>gnl|bykdb|A0A3E5F453 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=804 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLVKEDSKGKSFSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGNLLDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKHN
>gnl|bykdb|A0A3E5HPT8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=787 residues).
MALTEEEKSINIVDLFIYLIAHWKWFVLSILLFGGYFWYSYCETPFVYSRTAIVMIKTPANSRSAMQLNNADFIGQVNVA
SEILQFKSKELMRKVIDRLHADVSYMVRDGLRPRELYTDSPVRVAFLEAGLDEVCSLSVIPKNKQQVELADFSLDELEQR
KTVNLNDTVDTPLGKLIVFAAENYSESYFDRPIKVTSKSREGMVAFWLSNLTIRQMSGDAALLSMTMNDLSPTRAADILD
MLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGMYIQDSRQYESSIKELDTQL
QLVSFIKQYLQDSNKDDELIPSNIGLSDLSIESQISRYNETLLRRNRLVSGSSSNNPVVQELNRIMQTMKQNIYMAVDNL
SKSLRLKKQDYMRQESHVRQKVQAVPGKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARILDPVSGSNLPI
SPNKYKKMMLGVGCGIIVPSVILLLILMLDTRVHNRKEVEAVVSAPFLADIPQTAKASVDAHEVVVRARGLDPLSEAFRI
LRTNLGFMLSQAQDHKIITLTSFNIGAGKTFVSVNLAASLVQTKKKVLILDLDLRKGKMSEMAHSKHVKGVAHYLSNPSI
VVDDLILRDAFGEGLDLIPIGVIAPNPTELLLSRRLDELMDRLRELYDYIIVDNVPIGLVADASIVNRISDLTLFIVRVG
KIDRRQLPELERLYQEHKLTNMAVVLNGTKKGSSGYGYGYGYGQGYGYKNAEKKKGLFGRKKKKSRK
>gnl|bykdb|A0A3L8AAP1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides acidifaciens] (length=772 residues).
MEYTQENNEKTVKESGLNINLRDIVELLIAKWYWFALSVFICVSAAYLYTRTLVPVYQRQAVMLVKTGGKTANSDISAML
ELQGGITGSGVENEMFILRSHQLVREVVNRLHLDVSYEKEGFFRNTSLYAESPVEVNFIDPYHAYYRTKVTPLDVKNYTI
SDKKYAYGDTVQTEAGRIVVNLKPENLSAYIGKPVSVTRISPETAAAIYKGGISTSLAGKGTTMVQITCTGDNVSRADAI
LNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQRNRIIGSEGNGSQFLAESSRMKTENLQMET
ELSIAQSIKSYLLDATRNNQLIPNVSGVGDASVQSQITAYNELMLQRNHLLAESGAKNPVVQTADKNLAEMRTVISGSMD
NYIKNLRLRLEKTRAVERQINSEIQAVPKQEKMALSIIRQQSIKEALYTFLLNKREENALQLAVTEANIRVVESPFGSNA
PIAPHPATFLLAALAVGLAIPLGIQILTMLWNTSVRGRKDIEDYTTIPLLGEIPSRKEDMADDAIVVDDKKNDFISESFR
LLRANINFVAKDARVLMFTSTMPGEGKSFVSRNLAVAIAIAGKKVVLVDTDMRKRTQSKLAGIKHKDGLSTYLSGQHNDI
DCILDKGLIHPSVDSLFVGPIPPNPSELLMSDRLEKLIEELKERYDYIILDNVPAQVVADAAIVNRVAELTLYIIRDGQL
DRRYLPELERLHKEGKFNHLCIVLNDSHIEKKKYGYGYGYSYGYGYKYEEYK
>gnl|bykdb|A0A3M1CDV2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=805 residues).
MLVANTDNEYHSYKQRLENFSNNLDIGLLIDITLKSKWWYVLFFSIAGISVFLYLRYSERIYSSQSIIQIVNSDAHQILQ
LNPANTEGNNKVAEAIEQIRSKTFLERIINNLNLQISYYNEGTFKNHELYKNSPYLADINIKNENIYGKKIYVDFNDNLQ
TGKIKILLSEDNLIQIPFHINTWTKHEWLDFFIRLNEKRDTTSIRKDLYNNQRTFIIIQSKDAVASYLQKKLEVKPLNDL
AQTISISIKDVNPQKTTDIVNTIAEEYLIYDVERKSESSKNILNFINAQLSVVYEELKNSETKLNEFKKQNNIVSTDNNS
ALSTSQSQIYSSVQEQLLQIELNEKLLDEILNNIQTQKNIDLYQLISLASGTSYEESIKNITSNIQKLLLEKENLLYQVT
PNSEQIKIINYQIENQKKILIETLYTLKQKYRTQYKNLLERKKEVKTEVYPNSNTEIELTRLTRIYSINEKYYTLLLEKK
TEYSISKAGFVSQNIILEKSYNAQFVSPSKKSSIILGLLSAFLCSFLLVFFKYVSNDTIYSLSNITKATNANVSILGIIP
KYNKKMDVSQLVIDKNSKSIIAEAFRSIRSNMQFIDSSTNPKIIALTSTISGEGKTFVAINLAAILEFTGKKVIVLDLDM
RKPKVDKSFQLPNTKGMSTLLSGLNSIEETIQQGPLPNLKIITAGPLPPNPSELILSDKMPEILNYLKTQFDYIIIDNPP
IGLVSDATPILKMADIPIYVFRANYSKMNFIQIYDRLKNENKIAKLSVILNGIEIKKNTYGYNYGYGYGYGYGYVYGKQS
NYYVD
>gnl|bykdb|A0A3M1N7Z3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroidetes bacterium] (length=786 residues).
MPIQQEWDLRRVLIVLSREWWWPTLSVLFAAFTAWAYLRYTEATYQTTAVVQVNLAQAVGGFQTQNTAGSFFPPEVLTEA
YLELWSRYDLIAQVVQQLRLNYEVYSIGKVGRSLVFPHPFQISFSSPRAESLFWQGGRVRVIFDAERKVEIWRAETLIVS
GKIGQWMALPGASSAQLRIDCDPNCPSEGQYEVVVFAPQATTFAWQRRVSVIPKRGTTILQVSVTDISPVRATRFLNALI
EQAREHERSIRQLQYTKALGYIDTLVNFFQNQLLVAQDTLYRVETKEDILFMEARKDRALSLYQDLNKLDKSLSVEYLNA
FSEKLRRVLDTLRQDPAAEVAFLPLGALPEVQVPLTELNQLLEQRLRLLKVYQPTSPIVSAHNQLILSRVRALLDQVEQR
KQELLYELSTISQNFLRERAQLYKDVLSERQITLLQEDIELRRAVYKSLLEKKMQIAIEREAVLSALQVTQPPVVPSVPL
YPNPWQVYVLFLLAGGVVGVGGVLVRHLIQQKLSYRVDIEQIAPVPVLGELPYVRQRSRAGFALSSLQLEVLRALRGALG
FVWEGEKPRILLVTSTVSGEGKTFVARSLAYVHALAGYRVLLIDADLRRASLSQSVGVRDQGLSLVLARLVEVERFEELL
VPLEQPGLFLLPAGPSAPNPPELLETPTFSHLIAEATQSFDYVVIDTAPVGIVPDTLAILRHLENAVTLYVFRADYSRVP
FLSHLADIIEKHHLKKVYLLFNGTKLSRPRYGYGYGFGYYGEGYARKYYHSGSTSFWERIRTWLPV
>gnl|bykdb|A0A3M9MNC3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rufibacter sp. R-22-1c-1] (length=810 residues).
MSVRTVNDLDELDHRLGGVEDEEDDGGANIDFVTLLHVVRRSIPWVLLLVLLGVSASYVYLRYTKKVYESSSTIKLDEQS
EAGVLGLENNGLKVESGIGKLQGEVDLIKSNIVYERLKKTMPLQVSYHIEARVLDAELYKSSPFEVVYDSTNFSLFDQKV
YIHFNSPSKFDIYIGKEGKHSSHAVGVPFALSGSTITVNSLPSFTSVNVGETYYFIVHSNQSLKGYIDNNLTTAILNPES
KTIQISFKDFNRYKAHDIVTNIDAVYLQHKIERSNQASRQTLTFLNDQLKETEDSLRKAENDIERFVRQNKSYDIKSNLQ
EALAQVQELEKEKLELRFQLSLLNTIQSKVQKNEDLGMIASTIQGQENQDPQLAEQLTELSDLQAQQRTRKLTSRGNTLA
DNALEERLQFAQGRLRDAINGSRSLVQTKIENINRNQTELTGKILQAPSQETERARLERIFGLYESFFTQILNKRVEYGI
AMAGTTPDFQILSPANLPDESSPISPNRMIIYAIGIAGGLFLGVGLIATRYLMHDTVTNVRELERNTSVPVLGVVPSYDK
QKMPFSKLVVNQNPKSALSESIRSIRTNLEFMSATKKKRIISVTSTISGEGKTFVAVNLGGIIAMSGLKVVILDLDMRKP
KVHIALDGDNSRGMSTILIDKHSVGESVQRTSIPDLDFISAGPTPPNPSELIMGSRFDNVLEELHQIYDIILVDSPPVGL
VTDGVLIMRKADIPLYIVRANYSKKAFLKGIDKLVRTNHLTNMAAILNDVSGANMYGYGYGYGYGYGYGQGYYDEEEKPS
VGNKLKSLFK
>gnl|bykdb|A0A3M9N829 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rufibacter immobilis] (length=812 residues).
MSVKAANDLDELDHRLGSDEGEEEDGGASIDFVTLLDVVKRSILWVVLLILLGGAGAYLYLRYTKKVYESSSTIKLDEQS
EAGVLGLESNGLPIEAGAGKLQGEVDLIKSDIVYERLKKTMPLQVSYHVDARVLDAELYKDSPFAVNYDTSAFDLFDQQI
FIAFSSPSRYEVYVGEEGERLVATVGQPVNISGNNITITTTSSFSSAKVGETYYFIVHSSQRLKRYIDENLSTAILNPES
KTIQISFKDFNRYKARDIVNNIDTVYLQHKLERSNQASRQTLNFLTEQLKETENSLKKVEDEIESFVRQNKSYDIRSSFQ
EAITEYRELEQKKLEQRFLLTLYNTIQSKMQQDEDLGLIVAGLQGQPNQDPQLSELLTELSQLQARSRTARMTSRGNTAA
DNLREEQLKFTQGRLNAIINSNKALVQAQIENIDRTQGELTGKMLQAPSQETERARLERLSGLYAGFFTQILNKRVEYGI
AMAGTTPDFQILSPASLPNEGNPISPNPIMIYAIGIAGGLFLGLGLIATRYLMHDTVTNVRELERNTSIPVLGVVPSYDK
QKMPFSKLVVNQNPKSALSESIRSIRTNLEFMSSSKRKRIVSITSTISGEGKTFVAVNLGGIIAMSGLKVVVLDLDMRKP
KVHLALDGDNSKGMSTILIDKHSVEECIQQTSITDLNFISAGPTPPNPSELIMGSRFDEVLQELHQTFDLILVDSPPVGL
VTDGVLIMRKADIPLYIVRANYSKKAFLRGIDKIMRTNQLSNMAAVLNDVNSMNMYGYGYGYGYGYGYGYGQGYYDEEEK
PTLGSRMKSLFK
>gnl|bykdb|A0A3N2KA63 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-036] (length=804 residues).
MSDNINVTQESEAAEEFSLKDFLARCLSKWRWFAVSIVLFCCLGVLYVLRQQPVYSRSMELLIKDQDGGGGVADISNAFS
SLGLVSSNTNVNNELISLSSPAVMYEVVKNLGLDVNYSTPGRFHEKTLYGSNLPVNVKFHDLEEQQCAGFRIELGKDGNV
VLSKFHLETPDGDEEIEKEVKAKIGAGPIETPVGKVSITANGNYTAPKGKKNKPVTEIIVERDGMQSTVETYSGLVKADL
ADKDADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKRDHRVPNL
EEAAKTQMKQSVEMSNKMLEVTNQMSMSIYLRDYLNNPGNAKSVIPVNTGIGSPTLEAQISNYNNLLLTRNTLAASSSDT
NPLVVDYDGQIKGLREAIVNAINGQIVALNKSLRNMEGAKGAAESQLASGSTQAKYLLSVERQQKVKESLYLYLLQKREE
NELTQKFTADNTRIITPPTGSLQPVAPKVKFILAICMFFGLCVPGVAIYIISATDTKVRSRKDLDRMSAPFAGEIPFVGK
KSIKDRMARLLPAKKNSKELERVVVAVKEGSRDAVSESFRIVRGNIDFMIRGKEGGNVIMITSFNPGSGKSFISFNLSAS
FALKGKKVLVVDGDLRHGSASQFVDMPSKGLSNYLTGNTDNWQSLVVPVAGQNGMSVMPIGHRPPNPSELLDNGRIGQFL
DEARKEYDYIFVDCPPTDVVVDTQIVEKYVDRTIFVVRAGLLDRKALEEIDAIYRNKRFKQMSIVLNGTEAASRKSYGAY
GYYG
>gnl|bykdb|A0A3N2KCL3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-039] (length=798 residues).
MAETIKSEARKSVNAGSAVPLTDILYRTLHHWPWVLLSLVVCVGAAVVYLLCTPKVYTTTASIMIKDEAAGKSAGAEDFG
DFGLFQNKTNIQNEITTLKSADLMEEVVRRLNLDMNYYIPGRFHDVVAYGSNLPVRVEMPGFAENGSASFRVEVDGDGKV
SVSDVKSGDLKSEERVQGAMNDTIMTAVGPMVVVAAEGYKPGEAVELEVVKAPVSATAGGYGSRMVIAMSGDKSSVINLT
VTDQSTQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISSYKSANLIPDVSAASSMYMSQN
QQISQQIMDLKNQLKQTLYIKSYLGAASDNEKMLPMNSGVANVDIQSQITDYNNLVLQRNSLLAKSSDKNPLVVQLNEQM
DQMRHAILASVDNSINALNMQISSLQGSQASTTSKIASNPSQAKYLLSVERQQKVKESLYLFLLQKREENELSQAFTAYN
TRVVNKPASFGPTAPNTRNILMMSFLLGLAIPFGVVYLMESNNTKVRGRKDVEHLAVPFLGELPQDGHEKKKEAGEANTI
VVKGGKRDIINEAFRVLRTNVEFMCNSSEGNKVIAMTSFNPGSGKSFVSMNLGMAIALKGKKVLIVDGDMRHGSTSAYMG
SPARGLADYLGGAVSEVDTLIVKTPECQNMQVLPIGSIPPNPTELLESPRFGELIGELKSRFDYVIIDCPPIEVVADAQI
IDKFADRTFFVIRAGLFDRSMLPELDRLYEEKKYRNMSFILNGSRNDQGRYGYSHTYRYGYGYGYGYGYNYGGGEKKK
>gnl|bykdb|A0A3N2L0E8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-039] (length=823 residues).
MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFFILCLNKWKWFVISIIIFLGLGVLYIMSTPETYTRTAS
VMINEDTESGSQGVASALSDIGLFQSSANVNNEMLAFQSPAIIADVIQRLGLQTDYIYRHNLKNITLYGDSCPVSVDFLS
IPSKQSASMGLDIRDDGKIDISKMMLNGVECDPSEMTVNIGDTVATSFGPITINPGPAYAKRFGNTIKIFRYSISDAIEA
YKARLSENLADDNSTVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADF
KGEHLVPDVAAASAMYMEDANENTKQQMQVSTQIAISKFILDYIKNPDTNGQLVPANAGLENPGIEAQINEFNQLQLERD
KLSNSTGDTNPLLQDYDKNLRSMRSALVSSLTNQERALQTQLNSLIRSDRATSRKIASSPGQAKYLLSVERQQKVKEALY
LYLLQKREENELTLAFTPYNTRIITPPMGSNRPTAPISRNILLICFALGILIPGFILFIDESMNSRLRNRGDLEGIRTPL
IGEIPESSDSNTLRVRRWRRRWRDILGKNSQIEEAPSLLVRDHGRSIIDESFRMVRANLEFMTRNSQNRVIMVTSFNPGS
GKSFISLNLAAALALKEKNRKVLIIDLDLRRASVSRILPDHSRGITDYISGATDNCDKYIQQTECPGLYLLPVGTIPPNP
SELLYSDRLKQLIEKYRQEYDYIFLDCPPAELVADASIIAPLADITIFILRAGLLDRRMIPEIDRIYDSRRYHNFMVILN
GTLTSGAPYNRYASYYSAYDKKS
>gnl|bykdb|A0A3N2LFC5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-077] (length=823 residues).
MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSSFNLHDFFILCLNKWKWFVISIIIFLGLGVLYIMSTPETYTRTAS
VMINEDTESGSQGVASALSDIGLFQSSANVNNEMLAFQSPAIIADVIQRLGLQTDYIYRHNLKNITLYGDSCPVSVDFLS
IPSKQSASMELDIRDDGKIDISKMMLNGVECDPSEMTVNIGDTVATSFGPITINPGPAYAKRFGNTIKIFRYSISDAIEA
YKARLSENLADDNSTVIDFTIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIADF
KGEHLVPDVAAASAMYMEDANENTKQQMQVSTQIAISKFILDYIKNPDTNGQLVPANAGLENPGIEAQINEFNQLQLERD
KLSNSTGDTNPLLQDYDKNLRSMRSALVSSLTNQERALQTQLNSLIRSDRATSRKIASSPGQAKYLLSVERQQKVKEALY
LYLLQKREENELTLAFTPYNTRIITPPMGSNRPTAPISRNILLICFALGILIPGFILFIDESMNSRLRNRGDLEGIRTPL
IGEIPESSDSNTLRVRRWRRRWRDILGKNSQIEEAPSLLVRDHGRSIIDESFRMVRANLEFMTRNSQNRVIMVTSFNPGS
GKSFISLNLAAALALKEKNRKVLIIDLDLRRASVSRILPDHSRGITDYISGATDNCDKYIQQTECPGLYLLPVGTIPPNP
SELLYSDRLKQLIEKYRQEYDYIFLDCPPAELVADASIIAPLADITIFILRAGLLDRRMIPEIDRIYDSRRYHNFMVILN
GTLTSGAPYNRYASYYSAYDKKS
>gnl|bykdb|A0A3N2M1H3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-037] (length=800 residues).
MDNTKTKPEGISGFSDFSIKDYIQACKSRWQWILLSLIICVGAGVLYILCQQPEYQRTEEVLIKDQEGGSGVPDMAGVFS
SFGLVSSNTSVYNELISLKSPAVMYEVARRLHLDMNYDRLGGFHPVTLYGHTLPYIVDMQGIEEQGGASFKMELSADGNI
KMREFRKFTIDGKIELAGEATLPKGKESVKTPIGIVKVTPNPEYDGLPITESIELKVVKKPMQTTVENYGEKLNGDLVNQ
DAEIIGLTIRDVSVQRAEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAKYQTTTGSPDLIAS
AQASMEKESNLEQSILNIENQLSITTYMKDFLDDSANKFNIIPANTGLDNPSIEKDIATYNTILLARNNLVSNSSERNPL
VEDYDSQLNGLRESITRSMSNRIAGLKTRLRSFREEKIKTTGKIAGTSEKALPLLSDTRQQKVKEGLYLFLLQKREENEL
SQKFTAENTRVITPPMGSLKPVSPKKKLILAVTFLLGLALPLITIYMLETGNTKVRSKKDLDGVKIPFAGEIPFVGKRKK
FKVVVKKNKKLEDEKPPLAVVEEGKRDVVNEAFRVIRSNIDFMSGKGDGSQIIMLTSFNPGSGKSFISYNLGLSFALKKK
RVLLIDCDLRHGSSSMFVGMPHKGITDYLTGNNDNWRSLIVKVQDNELLSILPVGKMPPNPAELLENGRLTDLLNEVRGE
YDYVLLDCPPVNIVVDTQIVGQYADRTLFVVRAGLLEREALTELNEFYENKKFKNMSLILNGTEAVHSRYYTYGNYQSYQ
>gnl|bykdb|A0A3N2N595 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-110] (length=810 residues).
MAEVNKIQSNKKSGAAGAVPLSDIIYRTLHYWPLVLLSLFICVGAAVMYLLCTPKIYTTSASILIKDNAKSNTPSMSVGG
DEFANMGLFQNKTNIQNEMTTFMSSDLMTEVVKRLKLDMNYFKDGTFHKEIAYGYTLPICAELIDFSAYGTLKFDLMVNG
DGNVTISGMKIGEKDIIKADFSGKLNDTIKTDAGPIVILPTDYYKPGDLIDLEIDKKPLGWAVATYLGNLMVSLNNKEGT
VIDLTLNDRSTQRAQDLLNTLIGVYNEYWISDKNQVAVSTSNFINERLGVIEGELGHVDSDISSYKSENLIPDVDAASTL
YMGESQRISQEIMGLRNQLQMTRYIRNYLSADNDNTKLLPIPSEVENVDVKSQLTNYNDLILQRNSLVDKSSDKNPLVVS
IDAQLSSIRSVILKSIDNSITALQAQINSLNSAQVSTTSKIASSPTQAKHLLSVERQQKVKESLYLFLLQKREENELSQA
FTAYNTRVIRKPASWGPTAPNSKKIVLVSIFMGLAIPFGIVFLLETNNTKVRGRKDVEHLAVPFLGEIPQYTLSSQSAKS
KSYTHANGILVKEGARNIINEAFRVLRTNVEFMCNTSEGHKIIALTSFNPGSGKSFISINLGMSLALKGRKVLVIDGDMR
HGSTSTYVGSPSKGLSNYLSGADTNIDALIVKNDTCDDFNLLPIGAIPPNPTELLESKRFETLIAALKPHYDYIIVDCPP
IEVVADAQIIDKYADRTFFIVRAGLFERSMLSELDRLYEEKKYANMAFVLNGTRNNQGRYGYNYSYRYGYGYGYGYGYNY
GEENNHQQHA
>gnl|bykdb|A0A3N2N6F7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-110] (length=813 residues).
MQNNTQQPLSQQMPVYQAAPVVSEEEDSINISDFLSLCVRCWKWFAFSVAACLIIGALYVLTSPKIYTRTAQVVVQDDEA
GSSSQSITSALSDMGLFTTSTNVANELLAFQSPALIGDVIERLGLRANYVYKKRLRPVSLYGDSMVLSVSLPDISVNRGL
RMRMTILEDGKVEVSDMYDHLGNELDVMTVTLGDTVSTSFGRMVISAGPNFSPDFDHDIRFSYWPMPTAISKYQAKLTET
LSNEDASVIDFAIKDDNVQRGDDFLSALIDIYNEKWVEQKAQMAVATSEFINERLNVIEKELGHVDDNIATFKGEHLVPD
VAAASEMYMANANENTKQQLGVMTQMEITRFLIDYMQSPANKGKLLPGNLGIENQGIVAQITEYNNLQLERDQLLSTTGE
NSPLVKDRDNSLASIRAALASSLNTQLRMLGTQLAALERSDRKTNAKIASSPSQAKYLLSVERQQKVKESLYLFLLQKRE
ENELSLAFTPYNTRVITPPMGSLKPSSPVTRNIMLVALVIGLLIPAIILFLSETLNNRLRSRADLEGVKAPFIGEIPEEV
TSKNRINRWRRRWRDTIGKESRIEEAPTLIVKPHGHSLLNESFRMVRSNLEFMTRGGKNKIAMITSFNPGSGKSFVTLNL
GATMAIKHKDVKVLIIDMDLRRASLSKVVGNYAPGVSDYLSEATDDIRKLIRPTSQEGLYMIPVGTVPPNPTELLYSTRM
QVMLDKLREEYDLILLDCPPADIVADSTIITPLADMTIFILRAGLLDRRLLPELNKMYDNHRFNNLMVVLNGTTSVATPY
RRYAYHNKYVTKD
>gnl|bykdb|A0A3N2N9B8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-110] (length=805 residues).
MAELLDLSSAPASPSATTRKKTAASNTLPISDILFLTLRKWPWIILSLTICVGAALTYILRTPTVYTRAAQIMIKDTSKG
KSAGMEEFSDFGLISTKTDVENEIINLRSGELMEEVVSRLKLDMDYYSHGRFHDEVAYGTTLPIELSIVNAPADASAEMN
VDISPEGKASISELRYAGKEFKGTFTGSIGDTISTPAGLVVINPSAYYLPKQPIALKVNRLPLDAARASYSSRLSVTQGS
DNSSLIRLTLSDRSIERADDVLSTLIDVYKDAWIRDKNEIAVSTSQFINDRLGVIESELGNVDQDISSYKSAHLIPDVQA
ASSMYMSENRQIASGIMDINNQLQMTRFVRNYLTAESSRNQLLPANSGLVGDIASQVGEYNDLLLQRNSLVEKSSESNPL
VISMDGQLAAMRNAIITTVDNQISALNTQLRSLQATQASTTSKIATSPEQAKYLLSVERQQKVKESLYLFLLQKREENEL
SQAFTAYNTRVINRPGPAGVPPTPAKAQILLAAALIGLALPFGVIFLIENSNTRIRGRRDIEHLTLPFLGEIPLSDTGTD
NSAKKGLKDVRSLVVKEGRRDVINEAFRVLRTNVEFMRTPTDGANVIAVTSFNPGSGKSFITMNLALAVALKGKRVLVID
GDMRHGSTSAYVGSPEQGLSNYLASAAGSPVELIINDPENANLSILPIGPVPPNPTELLESPRLAELLSQLRPHYDYIFI
DCPPIEIVADAQIIDSHVDRTIFVIRAGLLERSMLPELERIYEERKYRNIALILNGTPLTTSRHGYSHGYGYGYGYGYGN
SYGKE
>gnl|bykdb|A0A3N2NMI0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Muribaculaceae bacterium Isolate-110] (length=805 residues).
MAENNATAPAQRRKKTPESTPVPIVDIIFLTLRKWPWILLSLIVCVGAAMIYILRTPDVYTRATEIMIKEPSKGKSAGME
EFADLGLISSSTSVANEITNLRSGDLMEEVVRRLNLDVNYFRKGRFHNIVAYGTGLPIQLEIVNFPTDASATLELNISAD
KKVTIRELKQGELKWEESFTGSLGDSIATPVGIVIVNPSPAYTPGTAIELEVNKIPVKTAQAIYSSHLGVSQSGENSSVI
RLTLSDRSIQRADDVLATLIDVYKDSWIRDRNEIAVSTSQFINERLNVIEGELGNVDNDISSFKSEHLIPDIAAASSMYM
SQNQQIASEILAINNQIQMARFVRTYLTAEDSRNQLLPANSGLVGDIAKQVSEYNEMLLQRNALVEKSSDTNPLVVTIDQ
QLAALRNAIVATVDTQIAALNTQLRSLQHSQASTTSKIATSPAQAKYLLSVERQQKVKESLYLFLLQKREENELSQAFTA
YNTRVINKPGPAGVPTTPAKTSILMISVLVGLALPFGVTFVIETSNTRIRGRKDIEHLTLPFLGEIPEAGTASGRKNKKN
DRSINTLIVKEGKRDIINEAFRVLRTNVEFMRNNSGTGNVIAVTSFNPGSGKSFVSVNLAMTMALKGKRVLVIDGDMRHG
STSAYIGSPQEGIANYLANPGTQLHDIIVQDAENPLLDILPVGVVPPNPTELLESPRFGELITALRPAYDYIFIDCPPIE
VVADAQIIDAHVDRTIFIIRAGLLERSMLPELERIYEEKKYRSMALILNGTPLSRSRYGYSHGYRYGYGYGYGYGFNYGN
KKTGH
>gnl|bykdb|A0A3N4H5N3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cyclobacteriaceae bacterium YHN15] (length=853 residues).
MYMKRVLGNKMGNEEPIDLSVVFKSLVKHWYLFIICVIIFLGLAFLYLRIATPVYEISGSVIIKEGDRPTTVAESSVLNE
LDNLKTSIKLENEIEKLKSKSLMNEAVISNKAFIFLYDKIGFFKKEISPFSLPVEIEVHEINNDFVGGGELLQIHLKEEN
KFELILEDEKKAEFEFNEKIRTNFGVFSLVKKEEEGERLESVSSFVLNFVNPVLITEQFSKSLTLEQPSIKSSTIYLTML
NTSPARGKDIMSSVINGYNFLNLNQKNEVALKTINFIDERLALAREELNQVERDAEQYKQRNRITDIGLDSRIFLESTQE
MRKEISDISSKIEILESLENLINSQSSQGDLIPSSLVSLDPALGDLLTRYNDLQRDRQRLSRVVQPNNQQILSLNEQISS
LRSNIIQNISSTKTNLQIRNNNLVENLDESTAKVQRIPAIERELMEIDRQKSIKQEHYQFLLKKREESALALEMTGVNSL
QIIDPPSASVSPVKPNKIIVLGIGFVFGLIFPLGLIFLKTKLSTNISSKKTVESFLNVPILGEVGKNEENGVIAITPKSI
TPPAEQLRLIRSNLNFQSGKDNQVIAISSSMSQEGKTFMSINLALSLSLVEKKVVLVDFDLRRPSVLKSLKYSAEKSLND
FFNNSIRDFKRLIIPSEINQNLHIIGVNEAIENPSEIINSKKIGELLDYLKANYDHIIIDTSPIGLVADAYSLSDVVDMM
IFIVRMNFTKEYQLEAISEIIDKKIFKQHYVIINDSEKQYGKKFGYGYYATKKKEEEKKNFWEPNVSDKSTANPKTVSVN
PKAVPENSKSVPANSKSVPANSKPVPANSKTVPANGNKAVPEKKPLNNPRIKK
>gnl|bykdb|A0A3P1BT12 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Larkinella rosea] (length=776 residues).
MKSSNMYGYPMYPQGEITSSDVPGTLKDYLKHWKWFLISLITMIVAGFVYIWFTEPIYRIQASLLVKDDQKSPSDNGVLK
ELNIYSPSKVVENEIEILKSNSLMKKVVDSLGLNIRYFRSTPFGKREIYDDAPLRIILKEPTANLYRADLEIGIISPTTI
RLNDWVYPANQIINTPFGRMQIFIKQPVVYSNEPLIVQVMEHPQAIRYYLSKLNVEPSSKTSTVLVLTIEDAVPAKGEAI
LNQMIANYSSAATDDKNRVVASTLSFIQTRLKLVSGELAGLEKSIETYKSANRISGIGSDAQALLSTLQNNDAQLNQVAI
QLSTLGDVEKYIRAKGENRGMLPATLKFNDPALTSLISKLNDLEQQRSLLVRNSSDSNPVLRSLDDQISATKTSINETIA
TLRSILTNTRSQLLATNKRYEARIRVIPGKERMLMNITRQQAIKNNLYNYLLQKQEETALSYASIASNSQVIDAASSSPE
PVKPIKFLILFLFGTVGLIIPIAIIRVKKFFNERVSGRAEINQATDAPVIGEIAYVRHEFPVIVNGRKRSVAAEQIRALR
TNLQFLRETPNDSQVLLFTSSISGEGKSFLSLNVAVSLALVGRPTLIMDMDLRRPKLHKALNMLNFRGSSSYLTGEATLD
EVLQQVPGFENLFIISCGPIPLNPSELLSGPRLQKLIEEVRMRFDNIVIDSPPIGLVTDAQLIGPFADATLYAVRHNVTN
RAYLKLVDLLYEEKRFPKLNIVLNSVKNKYSYDYRYYYYRKSSNDKPNLLRKYLLH
>gnl|bykdb|A0A3P1CI15 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Larkinella knui] (length=776 residues).
MKSANMYNYPMYPQGEMSSSDGKGTLKDYLKHWKWILISLIAMLVAGFVYIWFTEPIYRIQASLLVKEGKDNVADEGLLK
QLHIYSPNKVVENEIEILKSNSLMKKVVDSLGLNVRFFRSTPFGKREIYEEAPIRLVLSDPTPNLYRADLEISIISPTTV
RLNDWVYPANQVINTPFGRLKIFIKQPVVYSNEPILVQVMTDPQAIRYYLSKLTVEPSSSTSSVLVLTIEDAVPAKGEAI
LNQMIVNYNSAATVDKNRVVASTLSFIQARLKLVSGELAALEKSIENYKSVNRITGMGSSAQALLSNLQSNDAQLNQVAI
QLSSLGDVEKYIRSKKDNRAALPATLKFNDPTLTSLLGKLTDLEVQRNLLARNSSESSPLLRSLDDQIATTRASLAETIA
TLRSILINTRSQLLATNKRYESRVRVIPGKERMLMNITRQQAIKNNLYNYLLQKQEETALSFASIASTSQVIDAASGSPE
PVKPIKALILVLFGAVGLLIPIAVIRIKNFFNERVSGRSEINQATEAPVIGEIAYVRHEFPVIVNGRKRSVAAEQIRALR
TNLQFLREKPSDSQVLLFTSSISGEGKSFLSLNVAVSMALVGRPTLIMDMDLRRPKLHKALNMLNFRGSSSYLTGEATLD
EILQQVPGFDNLFIISCGPIPLNPSELLSGPRLGELIQELRTRFDNIVIDSPPIGLVTDAQLIGPFADATLYSVRHNITN
RSYLKLVDLLYQEKRFPKLNIILNSVKNKYSYDYRYYYYRKSGNDKPNLLRKYLLH
>gnl|bykdb|A0A3P1Z8V4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alloprevotella sp. OH1205_COT-284] (length=811 residues).
MIQSSSSHPDYPHLPSDSDTNILPVLLKCWGIFRRYWYWFALSTVLSLIAGYVYQQMQDRVYSGEAVILIDSSSDSSHGG
MRSRSKNSLNTLMQLNGINVGDNLENELFILSSLRLMKQVVATLGLEVDYTCREGLHNVALYRDRPFTVHFDRPSKRYTR
MEAVINPDNTVTLTDFEGIRGLSSEQENLKLKVPFGVKTKTPIGTLTLYKETPFRRFPKGTPIVVHHYSNEIAARIYKKA
LTAAEYSKESSLLLLTCTDINKHRAEDVLNEVCNIYKKDIVDNKNRVAQRTAEFIDERLTLISRELSDVEHRLATFKQNN
SIVDLTATATAMTQQSIQARQKTIELETELSVASFLADHLRSSGKGKEVIPAVAGFTNAALAQQITEYNRLVLTRNRYAV
NSNDDTPAVRDLDRQLEALRSAINTSLANHVKSIELELRAARSTQSRFDGQAGAIPVKEREALDIVRQQNLKEALYTFLL
NKREEVALQLAIEEANVRVVEEPLFASRPISPRKGIIMLIALLLGILIPSFAFWLLDLFDHTVSGRQDVENALDIPIVGE
LPHVKKTTDQTLVYDVDTDQNSPSAEAFRLLRYGLHFMNRTAKVFLITSASPGQGKSFVSRNLAVALSMTGKKVLLVDTD
VRKQNLTAGFTNGRKKGLTEYLIGDSEAPHDIIHTDGVCKGVDFLPAGTIPPNVSELLMSERFEQMIATLRQHYDFILLD
TTPCFAVADAGIVSRVAEVTLFVMRVGVQSKHGLPAVAELYRSRKIGNICLVINDCDIKARTYGYGYGYGYGYGYGNNLD
ETASRKWWQLW
>gnl|bykdb|A0A3P1ZBJ5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alloprevotella sp. OH1205_COT-284] (length=807 residues).
MVENEVNAPQNEQTTGVDIQDILYLCLSKWYWFLLSLILSLALGVLIILRTTPVYNRYTTIMIKENTKGGGRSVEQQLSQ
LGLFENTSVSNEILSFQSPALMEDVVKRLHLDIDYSVEGFFHDITLYGRTLPFQVRFLSLNEEQGARLSINYQQDGSFEL
TGFESANTKKKDKELRIKGRFKQVVKTPVGDILVTPTKNFELLKKSIQVVKYPLSDVVDYFGRINVELKEKESTMVDISI
NDVSVERAEDVLKTLIDVYNQNWVEDKNQVAVNTSKFINERLRVIESDLGNVDKNISSYKSSNLLPDVESASKLYMQKTS
ANDDKLMELNNQLYMTRYVSQMLTNEKNKFDLLPANSGINSSSVEALIGDYNGNILQRNRLIMNSSEKSPTVIELEARIS
KQRQAIIASIDNLLLTIKTQIRNLEAQEKMLTSKIAQNPTQTSYLTSIGREQAVKEALYIYLLQKREENELSIAYTASNL
RVISPPMGKKKPVSPVKRNILLIAIVLGLALPFAYFYLREMLDTRVRGRKDIKDLSLPYIGEIPHINGSRDPLLKRLLAR
LKKENGATRTDNFELVVKPQSFNVINEAFRVLRTNFEFCSKRFGKGTVSMIVSANPGSGKTFLTMNLAMSLIIKGKKVII
IDLDMRKAASSQFIGRPKMGIANYLNGQCELPEVIKQYQDTDLDMIPVGTIPPNPTELLHDERLGLAIAELRKEYDYIFL
DCPPVEIVADDLIISTHADQTLFVVRAHLLERSMLPEIEDFYRSDRYPHMSLILNGTDDAYRGYGYHRHGYRYGYRYGYG
HISGEKK
>gnl|bykdb|A0A3Q9FR88 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Flammeovirga sp. L12M1] (length=825 residues).
MTDFDKEWDDLNNEGDNLSNNIDFDKLEFVIKKKFIWVILILMMAGICAFLYIRWTPRIYEASTLNQIKLTSSSQDFAEK
FGIMNNSLNDGKLESEMALITSGVTYNRVIDSLIDLTVTYQSVGDVRDSELFGDAVPFTFEYPNNVQPTLKDLPFFLEFS
NGGKDFIITYKIGEQQIEIAGKSGQRFSLGGRPIIIRSKSPNVDNNKYSFQFNSKSSITNFIRKNISVLIFDPKANTIQI
SFKAANREKAVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRAISYGKDLSSYMEAGPIVGNI
QELEKSLSSLKNEKKKYQKLRHFLEADSSIVYIQAYATILTDGSISSSLDELAKLETEALRIKDSYTSNTIASNAKLELY
KKLRYEVAESIKFAEEFLDGNIRDLQREISKLKTVFYKNIGGDPDLKKIEKRVEIYTSIYDLLTNKMIEVSMAQASTIES
SAVINEAYASKIPIAPKKFIAVAISMAIGLFISVIMLVIVYIRMDKISGIKHLERRTGMPILGLIPKYQKEEMAVSRLVV
SADPKSTMSEAFRSVRTNLDFMVSDSFDAENSKDARVISVTSTISGEGKTFIASNLAGIIAMSDKKVIMVDLDLRKPKVH
LAFGGSNIKGASSILIGQTTIEECLQDTDIPTLKYISAGPIPPNPSELVMSKNFINFLAKLKEEYDVVMLDSPPVGLVTD
GMIIMRHVTNPIYVVRADYSKVSFIDNANNLYKSSKFPNISIILNSVPDRRSYGGYGYGYGTMSYSADGFGYGYTYGYES
DMTEGDLAYFDEKKKPFWKKLFKNK
>gnl|bykdb|A0A3Q9IP20 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Butyricimonas faecalis] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A3R5XWG1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=815 residues).
MLRRNQGDDFLRLQDLFYLCLARWKWFVLSLFVTMGAAGYYLLSTPNVYQRTASLLIKDESKGSSINNDVESMFSDMGLG
GTKSNVNNELIAIKSPSVLLEVGKQLKLNVDYAVDGRFHRNVLYGNDLPVTVQFLTIGEEHYGSMTVYLKGGDKFELTDF
KGTSSNGTPVETNKTVTGKLGKLVQTPLGKVKLEAAPSYAAFIKGGDAPALYVSHTDLYSMTNRILGSLTVGLNEEKTTI
VNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKSANLLPDVETAAQQY
MQKSSDLSKQIMDLNSRLSIAQYIRSSLVGRVSKNQVLPSNTGIDSPGIEQQIAEYNKTLLERNNIVANSSEQNPLVADY
DQNLNAMRRSITASIDNFVVTLRTQLGTLQANEAHTTSQIASNPNQAKYLQTVGRQQKVKEALYLFLLQKREENELSKAF
TAYNTRVITPPTGSNLPVAPVRRNILLVAFALGFLIPVVIIFVRENMNTTVRGRKDLKNVTIPFLGEIPFYISRKNRPTL
KQLILFWKKPKEVRQIVVKAGKRDIVNEAFRVLRTNFEFTIGAHPEKNVIVITSFNPGSGKSYLATNIAMSLAIKEKKVL
VIDGDLRHGSTSMLVGNPAEGLSDYLNGRTDDLKGIICHGEENGLVKDFDILPIGTMPPNPTELLFSERLESLINQLRKE
YDYIFIDCPPVEIVADTQIIEKYADRTIFVVRSGLMERSMLGDIEQFYKDKKFKNMSLILNGTKAQGGRYYRYGYHYGYG
YGYHYGSDRNGGVQK
>gnl|bykdb|A0A3R5ZMK1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=792 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVVH
ENGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVRVSD
KGVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNR
VADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQRKNK
>gnl|bykdb|A0A3R5ZYK4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=790 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGREVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A0A3R6BKI7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=790 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVMMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A0A3R6D1V4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=802 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLMVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLKIQPDGTL
YLSDFIRNGTDLDEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSEANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYCYGYRYGYGSGYHYGSDGKRG
WR
>gnl|bykdb|A0A3R6EAF7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=804 residues).
MAINQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLVVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGSLLDSIPTPLGKIIINTTPNYVKGESYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYSSD
EKSM
>gnl|bykdb|A0A3R6EGW5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLDKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSAKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIIFIRENMNTRVRGRKDLDGLSVPFIGEIPLSIRGKKRVKSYE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAISLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTNEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|A0A3R6GKX5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=792 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKSEHLLPDVQAASNLYMSQSAE
NKKEIQALTNQLTTAQYIRRELNSKEMNQPLPTNSGIANVNIESQIGEYNKIVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEVATTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSALPTAPNKKNILLVAFALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYSNNKKKKNKSQEKTIV
VEEGNRNIINEAFRVLRSNVDFMKNKNTDQKVFVITSFNPGSGKSFFSVNIATSFAIKGKKVLVIDGDLRHGSTSAYVGS
PKKGLSDYLGNRVANWNEALVIDKKHANLHVLPAGTIPPNPTELLEDEKFATLMQILRNEYDYIFVDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLSELESIYLEKRFKNLSVILNGTESTGGRYSYRYGYSYGYHNGYTSYYGNSK
>gnl|bykdb|A0A3R6GM96 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=788 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKSEHLLPDVQAASNLYMSQSAE
NKKEIQALTNQLTTAQYIRRELNSKEMNQPLPTNSGIANVNIESQIGEYNKIVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A3R6HIK7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=794 residues).
MSTEYNPENNIRIEEESVLNLWDLFQIFKANWYWFVLSVILCVGAGYLYLLQAPRVYTRTASVLVKEEQRKSRAATTYGF
TDLDMFGLQRNVDNEVIVFKAYRLMEMVARRLHLDVSYQVKRGLRMVELYTHSPVVLSFPETEESQSFALKVTPLSKEKV
RLSDFIMADSNGQRVEIKKAQDVALNDTVQTPVGRVVVVPSLYYADNYYNIPIQVTKSRLKSVAKRYQSALQSTLADKMS
TIINLSLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFKRENQLTDIKSETG
MYLQNTSQYKQEGLSLENQVAVAKYIRDYLSDPQKALELIPANTITDMKVEQQISTYNEMLLKRDNFIANSSDKNPVVMD
LNNSLSAMKQSIIRSVDNLIKGLEINIKNIQMQEAQTAKRIAAVPSQQKYVLTVERQQKIKEELYLYLLNKREENALSQA
ITESNTRILDSAMGSSSPVSPKSQMILMASLVIGCCIPAGILWLLMAMDTKVHTRKEIQDATTIPFLGEVPMQSKKDKEK
LVVRSGSRDAVSEAFRIIRTNMDFMRVKEKKTQVIVFTSLNTGAGKTYVSSNLAASLVLMYKKVVLVDLDIRKGTLSGRT
AHTGKGVTHFLSGKVDSISEIIQKDGLIEGLDMVNAGPVPPNPAELLLSDRLDLLIDELRAQYDYVIIDNVPAGVVADAS
IVNRVADLTICVVRAGVMDRRQLPELERLYRTKQFHNMSIVLNCIGTKCLGGYGYGYGYGYGYGYGADDKKKKR
>gnl|bykdb|A0A3R6HK75 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=788 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETEERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A3R6I893 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLDKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASVGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSAKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIIFIRENMNTRVRGRKDLDGLSVPFIGEIPLSIRGKKRVKSYE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAISLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTNEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|A0A3R6K8X4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=791 residues).
MNIEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVILS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVRVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQRKNK
>gnl|bykdb|A0A3R6NLC1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. AF18-52] (length=797 residues).
MNPEQETNMLRAEENELNLIDIYRVVRANWYWYLLSVVVCCAIAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEINENLEIGLTVVPVSDKEVS
LSGFTSEELEEEGQSLEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVTKSSRDWVALNYNEALQVALASKTA
TILNLSLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFKRENQLTDIHSEAG
LYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDANVESQISEYNALLLKRDKLIGNSSNKNPVVM
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREAQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMAIPSGILWIQLTMNTTVCSRKDVEDNLSIPFLGEIPSRSRKDKS
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSLVLTNKKVILVDTDIRKGTLSAR
ISHANAGLTHYLSGRVEDVDKIIASSGLNDRLDVIHAGPVPPNPSELLLSNRLEELVKALRDRYDYVILDNVPAGMVADA
TIVNRVADLTIYVIRAGLMDRRQLPEVEKLYKQEKFHNMAVILNGINMKRAGYGYGYGYGYGYGYGYGNEKSQKGKK
>gnl|bykdb|A0A3R6NPG7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=796 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGNRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPEVGLSNYLGGQVDKLSDIIVTDKQHPSFSFIPVGTIPPNPTELLFDDRLQDAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGAGGRYGYRYGYRYGYGSGSYYGSSSK
>gnl|bykdb|A0A3R6S1H6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. TM07-1AC] (length=784 residues).
MKNEELIEDGTNALNLIDLWYMFKRYWYWFVLSVMVFLGGAVYYVKSTAKIYTCVASVLIKNDSKGTSLASEAAAFEDLN
VLNTKSSVDNEVLVFQSRNLMIEVVRRLNLNISYRVEAGLREIELYKESPVVLRFPDAEETSSLQMVVTPLDDKTVMLAG
WKGDDEEWKQKVALKDTVETPVGKVVVTPTLYYSKMYYSVPVTVTKYNLLQVAKACNAGLRAYLADKKASIINLAIEDVS
KARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFKKENLLTDIVSETGIYLQNSNLYQQ
EGLGLENQLSLARSIKEYLHDPQHERDLIPSNTGIPDVNIEQSIGKYNEMLLKRNKLQENSSEKNPIIQELNGSLSAMRQ
TIVRTVDNLIAGLNAQLQRIEQQERQANRRISAVPSQQKYVLSVERQQKIKEALYLYLLNKREENALSQSITSSNARVID
PAMCSDMPVAPKTSMILLAALVGGFALPGLILWLIFSLNTKINSRRELEEKLTAPILGEIPLLPKKHRRKEHEIYVSENG
RDAISEAFRIVRANMDFMEVNTNRLQVIVFSSFNPGAGKTFLSINMAVSMATGGKKVVLVDLDIRKGSLSERIGHKHEAG
VTNYLSGKETNLDNLLEKGKYYPNLDVLYNGPIPPNPSELLRSKRLDDLLEWLKERYDYVILDNVPSNMIADAIIVNRVA
DLTLYVLRAGYMDKRLLPEVEKLYKSNKLKNMAILLNGVDIRYNYGYGYGYYGKGYTYGYGSKD
>gnl|bykdb|A0A3R6S408 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. AF17-28] (length=786 residues).
MEPNQELENLQQQEENELNLGDIIQIVRANWYWFALSVVVCMSAAFVYLQWAPKQYTRTASVLIKDDTKGSGAMSEASAF
SDLGMFSMKSSVDNEVLVFQSRQLMQNVVKRLKLDISYTQKRGLRTTELYTQSPVHLEFPDAEPNQQFRLVATAIDESKV
ALSDFEADSVDVSDAMTVALNDTVQTPVGRVVVTPTLFYTTAYFGTPVRVTKSDLDETVLHFNRILQVALASKTATIINL
TLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIESFKRENQLTDIVSETGMYLKE
SSEYSREGLSLENQLTLARYIRSYLVDPSKEAELIPANTGISDSNVESQIGEYNALLLKRDRLVSSSSNRNPVVMSLNSS
IQAMKQTIVRSVDNLIVSLNIQIKNVRSREEQNVRRISAVPGQQKQVLSIERQQKIKEELYLYLLNKREENALSQAITES
NARIIDPASGSKNPVAPKSMMVMLASLILGCMIPAGVFWIRATMDTKVRTRKDLEGRMTIPFLGEIPSREKKDKNEIVVR
EGGRDSVSEAFRIVRTNMDFMRVKAKDLKVVMFTSFNPGAGKTFVSMNLAMSFALTKKKVVLVDLDIRKGTLTAHTAGSG
KGVTNFLSGKVTDVDEIISKNEIHENLDVIHTGPVPPNPAELLLSDRLETLIAGLKERYDYVLLDNVPSGVVADAAIVNR
VADLTIYVIRAGLFDRRQLPDLERMYRQEKLRNLCVILNGVNYKRTGYGYGYGYGYGYGYGYGNKE
>gnl|bykdb|A0A3R6SD81 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. AF18-52] (length=784 residues).
MKNEELIEDGTNALNLIDLWYMFKRYWYWFVLSVMVFLGGAVYYVKSTAKIYTCVASVLIKNDSKGTSLASEAAAFEDLN
VLNTKSSVDNEVLVFQSRNLMIEVVRRLNLNISYRVEAGLRELELYKESPVVLRFPDAEETSSLQMVVTPLDDKTVMLAG
WKGDDEEWKQKVALKDTVETPVGKVVVTPTLYYSKMYYSVPVTVTKYNLLQVAKACNAGLRAYLADKKASIINLAIEDVS
KARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIETFKKENLLTDIVSETGIYLQNSNLYQQ
EGLGLENQLSLARSIKEYLHDPQHERDLIPSNTGIPDVNIEQSIGKYNEMLLKRNKLQENSSEKNPIIQELNGSLSAMRQ
TIVRTVDNLIAGLNAQLQRIEQQERQANRRISAVPSQQKYVLSVERQQKIKEALYLYLLNKREENALSQSITSSNARVID
PAMCSDTPVAPKTSMILLAALVGGFALPGLILWLIFSLNTKINSRRELEEKLTAPILGEIPLLPKKHRRKEHEIYVSENG
RDAISEAFRIVRANMDFMEVNTNRLQVIVFSSFNPGAGKTFLSINMAVSMATGGKKVVLVDLDIRKGSLSERIGHKHEAG
VTNYLSGKETNLDNLLEKGKYHPNLDVLYNGPIPPNPSELLRSKRLDDLLEWLKERYDYVILDNVPSNMIADAIIVNRVA
DLTLYVLRAGYMDKRLLPEVEKLYKSNKLKNMAILLNGVDIRYNYGYGYGYYGKGYTYGYGSKD
>gnl|bykdb|A0A3R9P8H7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter rigui] (length=818 residues).
MAANEDAELEEMIRNAGGNESDGEDDGGGIDFTTLLTVARKSLPWMLLLIALGLTAAWLFLRYTPPLYQSSSTLKIDEKT
EAGVLGLGGLGGAVEQKQNLNKLSGEIELIKSDIIYRRLKDSLTLDVNYYVQGTVLETEMYNTSPFKVVYTPTDDAAYDQ
KIAVQFMSPTTFRLTLPESLGGGVQEHTIGTPFTAGGFRMEVRKTPQFNDKAFEGEYFFTINSNGALNAYFNKNLLVDIV
NVDANTISISFTDHNPTKARAIVNKIDSVYLVEKLLRKQEQAARAMSYINEQLGENNQKLGQAEENMQAFVKRNGTYDVK
GDVGQIMTALKEQETEREKLQEQVDMLNDVARLIEQDRLTDRADGDVLQSIPALTDAKDGQLVARIQELSDAQLDLKRAL
LSYQPGATTAMQTKEQFVADLKKIVRQLLRKDQQLLQKQLNKLDAKRAEMEGRLRALPELQTEQARLQRPLELYEKYNLT
MMDSKIQYGITMAGATADFQILSPASYGAPISPVKAMIYAIGLAAGIVLGLGLIAVRYLMHNTVTSVRELERSTGASMLG
IIPTYEKEKMAVSKLVVDRNPKSAISEAIRSIRTNLEFMASSKKKRLISITSTISGEGKTFVTVNLAGIIAASDQRVVIL
DLDMRKPKVNLAFDAENTKGISTILIEKHTWQECIQHTSIPTLDFISAGPTPPNPSELIISSHFDELITQLHQHYDVVMI
DTPPVGLVTDGILIMRKADVPIYIVRANYSKKSFLKNINKLMRVNGFTKLTTILNDAKTTGGYGYGYGYGYGYGYGQGYY
EESAAPGGFLARVRKRFS
>gnl|bykdb|A0A3S0QKV1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter gummosus] (length=832 residues).
MAVNENAELEELIRNATGGSGAAAPTASAPEAEEAGSGLDLPLLLSVTRRSLPWMLLLLLLGLAASWTYLRYTKPVYQSS
STIKIDEKRQDAELNLPGLVANPQQNVNKLAGEVELIKSDLIYSRLRDSLPLDVNYYAEGTVLETELYGNSPFRVEYTVR
EPIQFNKKFSVRLLEGKRFRLSYLMGQQEIDGEYQLEQPVTTPGFNLRLVPTKYFSGQLADATYYFTINDAAAINGYLSA
NLTVSVINPEASTIGISFSDNTPQKAQAIVNKIDSVYLNVKLDRSSQATQQTLAFLQGQLLDNRAKLQDAEKALEEFVRQ
SKTYDAKADVGTLTTQLSDLRKERETLQRKASLLTQVSRLVQQERITSRDDETVEQSIPGLALLEDPQLTQLMSVLNEQQ
RDMRKILESYQPNATAAVRIREDQLRRTRDGVQKLLQQNAELVRQEIAALDRRSAEFNSELLALPGKETELARLRRPVEL
YEKTYLMLMDKMVEFNIKKAGTTPDFQILSPASLPAAPIFPVKLMVYAIGLAVGAVLGLGLVAGRYLLHNTVTNIRELER
NSTAPVLGVVPSYDKEKLAVSKLIVDKNPKSAISEAIRSIRTNLEFVANSKQKRLISITSTISGEGKTFVAVNLGGIIAL
SDQRVIIIDLDMRKPKVNLAFDAENTKGVSTILIDRHTVQECIQRTNIPTLDFISAGPTPPNPSELILHPQFDKMLEELK
QQYDVIIIDTPPVGLVTDGVLIMRKVDVPIYIVRAGYSKKAFLKNISKLVKGGGFNKLTTILNDAQASGMYGYSYGYGYG
YGYGYGYGTGYGYYEEAPAPKGLLARLRRRFS
>gnl|bykdb|A0A401LPX7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. KCTC 15687] (length=798 residues).
MATIQNKSTVQNMQDFITIQDLFYLCLNKWHWFVISLVLCLGGATFYLLRTPSVYVRTASILIKDDSKGKSSSADMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVHVVIPNLSENESATFELYLAKDGAV
ELSSFTRNGTEIENDDIVKGSLNDSIQSPLGPIVVIPSAAYSGKTESTIYVTRQSLSAASAGCSANLTISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAASMYMT
QANEANTAIRELNNQAYMARYIKNYLTDENNKYQLLPANSGIENASLSTQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIIAKPGGSMIPTAPVKKNILLVAFALGILIPVIIVFMRENMNTRIRGRKDLEGLSIPFIGEIPLAIRGKKKVKSHE
AHTIVVKEGNRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDFRHASAS
AYFHSPKIGLSNYLGGQVDRISDIIITDEKHASFSFIPVGTIPPNPTELLFDDRLREAIDTLKQQYDIVLIDCPPVELVA
DTQIIEKLADRTIFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNGRSK
>gnl|bykdb|A0A401UAP7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cytophagaceae bacterium Ys] (length=771 residues).
MDKGFTNESETIDFSKLKSILLKNTVWILLLFILCNLSAYLYIRYTKNVYEAEAEIKLEVNNEANEFGITKIMEDQNLNL
ISGEIELIQSNLFLSRVIDSLKLDVSYYSVGEFLDYELYKNSPFKVTPIEVNNSYYNLNHTIDKKSEAQFEITLSDGEKL
TGNFGKVVQMEGFKVLIESAKGYTYEPKNTYSFMLNDAQALRAYFTERLMVTPKNYNANTIRISFKEFSAEKAMDIVNKI
VNIYLGFSNEQKNFANKHKIDWVNNELEQIEEKMSQYEDYFKDFTLKNKTQDLTADMSRTVEQINALDTSSFTINSRLRL
IRKLKEDLKDGKTERYVSLTDKETLPQEVINDVLAYQKKREAINELKLSYKESTFAYQELQRDIEFAEKALVIQLTELEK
IVLDQARRADTRRRLLEREFATMPDKATEYNKNQRYYKLYEEFYFTLMQSRSEFEIAQAGTIPDFKILSAANLPGKPISP
KRILITIGGFTTSLVVIFFFVGFLYLIDDKITSVHELERIAKVPILGIIPAFRNSRKDNLPVQNQPHSMVSESIRTLRTN
LDFFNVNGVQKVISISSTVSGEGKSFVARNLGAVIAMSNKRVVLVDLDMRKPKDDQPPPFNNKALGVSGVLIGKNTWQEC
AQSTSVANFDVIPAGPHPPNPSELLVNGAFEKLIQELRQAYDFVIIDTPPVGIVTDGIMAMKRSDVCVYLFRANYSKKEF
LHNLKRINSLHNFSNVTAILNALPATAQTYGYGYYHEEKKSKYFESIFFNR
>gnl|bykdb|A0A412B7D1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=788 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETEERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A412DM15 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=790 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVILS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A0A412DP39 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADVLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A412IIJ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDAFIGTSIRYVRGSMRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKTIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTVPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|A0A412M2W1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=791 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNTPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVRVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQRKNK
>gnl|bykdb|A0A412MJT7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKDKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A412N2D9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides clarus] (length=808 residues).
MGKDRFEDLDFIDFNDSRQQESTVIADMLSAVYRNRKWFILSVVVCVLIGFLYLKSSPEIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLNVSYKEWDGLRKKELYTSTPFTVNFLDADPAQKISLTVTMTDN
GKVTLTDMVLQNELEEEEFDESLTVQPGDTVSTPVGKIAVQPTLFTNESYIGKSVYVAKGNLKEVAEEYNKALNAGVTNK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIENYKKKNKLTDIASE
SALYLKSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTDPIPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSEGNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQAANMKNKERENSDKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKAQVILISLLAGIMLPALWIYIRSLLNTSVHTKKELKTGVSIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTAGKVVLVTSANPDSGKTFITLNLAMSMALANVRVVILDLDLRKGSL
SKCVGIGMKKTGISNYLSGKVDDVKELVQVCGEDSRLHIITSGALPPNPAELLKSGRLDRLIEELKKNYDYILLDNPPYG
IVADTQLCGRMADQTIYVVRSGLFDKRMLPELQELYDSGKMKNMSLLLNGIDYVKTGYGYGYGYGYGNYGNDEERKNKKP
LHKRIFGI
>gnl|bykdb|A0A412RG70 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A412S0N6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETYTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDVFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKIIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTIPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|A0A412SND6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=792 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLTDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPTELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A412TD37 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A412TGL3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKNIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKSYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A412VNY9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=788 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETEERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A412WV15 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Butyricimonas virosa] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A412YDB9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides intestinalis] (length=795 residues).
MVEKKTPAGKPADDFIRIQDLWSMFVPKWYWFAVCLFITLAIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSSMSDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVSRLGLNETFTVRRGLKKVDLYKAAPFTVTFRDQPEAPLSFTIEFSSKDTFTIS
DLKVSDESTGETFSAQMGDSIRTSAGTMILHPAQKNANAFIDTPIQYVRGSVSAAADTYANTLVAELGSDDATIINLSIS
DASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKSEHLLPDVQAASSLYMAQSAE
NNKELSALNNQLSTAQYIRRELNTKQLNQTLPTNSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRVEDATTTRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVIIFMKENMNTKVRGRKDLQNLSIPFIGEIPQYSGTKKKWWELKHRRRQ
DLKTVVVNEGNRNIINEAFRVLRSNMDFMINKDSNQHVFVLTSFNPGSGKSFLAINIAMSFAIKKKKVLVIDGDLRHRTA
SSYVDSPDKGLSNYLNNQVENWKEIIVPYKEYANLHILPIGTVPPNPTELLENNKLATLIAALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFIVRSGLLDRSMLPELENMYTEKRFKNLSMILNGTEGAGGRYGYRYGYHYGYASYYGDKEK
>gnl|bykdb|A0A413BA42 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVVNMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A413DBH9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=830 residues).
MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYYLLSTPSVYQRTASILIKEDGKSQSIN
SDVTSMFSDMGLSGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSANLDV
EVKHDDLFSIVHVSGTDKDGNQVESDEEVQGKLGQTVRTAMGYVCVDQAPGYSAFINGHESRKLHVTRTNLYAMTNHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDTKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYSISRKNRPTLLQRIQFWKKPKETRQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGN
IAMSFAIKEKKVLVIDGDLRHGSISMLVGSPGEGLSDYLNGRTDDLEGIICHGEEHGLVKGFDVLPIGTMPPNPTELLFT
DRLEKIIKQVRGEYDYVFIDCPPVEIVADTQIIEKFTDRTIFVVRSGLMQRSMLGDIEQLYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGGQK
>gnl|bykdb|A0A413GAA4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A413H235 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercorirosoris] (length=788 residues).
MVEKKKPADDFIRIQDLWGMFVPKWYWFAGSLFVTLTIAALYLLSTPPIYTRTAAILVKDNSKSNSSTNAMSDFSDLGIF
KSNTNINNELLTLKSPTLMTEVVSRLGLNESFTVRRGLKNVDLYKSAPVAVTFLDKVEAPLSFTIEFSSKDTFAISEFEV
SGVDTRENFSAQTGDSIHTPAGTMIISSTQASSDAFMGVPIRYVRRSVRSVSDAYAKELVAELGNEDATIINLSINDAST
RKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMAQSAENKKE
LSALNNQLSTAQYIRRELNSKQLNQPLPANSGIVNANIETLISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSMQRTI
IQSVDNLIVSLNTQIRSINRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRLITAP
RGSMFPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSMPFIGEIPQCSGTGKKWELKKRQKTDTIVV
NDGNRNIINEAFRVLRSNMDFMAGKDNSQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILIIDGDLRHGSISSDIDSP
KIGLSNYLGNRIENWREIIVPYKEYTNLHIIPIGTVPPNPTELLEDGKLAALITALRPEYDYIFIDCPPVDIVADAQIIE
KLADRTIFVIRSGLLDRSMLSELETMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYGSYYGGKGK
>gnl|bykdb|A0A413ICP6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Odoribacter splanchnicus] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A413MY74 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKAQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGQLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A413PP50 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=814 residues).
MTEKKTTVGKPADDFIRIQDLWGMFVPRWHWFALSLFVALSVAALYLLSTPNIYTRTAAILVKDDSKSGSSTGAMNEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTIRKGLKDVGLYKSNPIAVTYRHQDETPVSFKIDLPSKGEFVLS
DVMVNGEKSGKEFSGKMGDSIRTEIGTLVINPTKYWDDSFVGTSIRYGKGGVRAVTDYYAAALRADLGSEDATIINLSID
DASIQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAE
NKKELLALNSQLSTAQYIRKELNNKELSQLLPTNSGIANVNIESQIGEYNTMVLDRNRLIANSSEKNPLAKDMANSLQSM
QRTIIQSVDNLIVSLNTQIRSIRQQEAATTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMLPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLESLSIPFIGEIPQYFSTRKKLGFNKKTQPD
MKAIVVKEGNRNIINEAFRVLRSNMDFMAGKDSSQNVFVLTSFNPGSGKSFLTMNIAMSFVIKKKKILVIDGDLRHGSTS
SYVDSPKTGLSDYLGNRVSDWKEIIVKDGKYDNLHILPIGTVPPNPTELLEDGKLATLIGALRGEYDYIFIDCPPIDIVA
DTQIIEKLADRTLFVVRSGLLDRCMLPELENIYQEKRFKNLSVILNGTESAGGRYSYRYGYRYGYRYGYHNGYSSYYGSK
AKMGGVNGWLSNNQ
>gnl|bykdb|A0A413TW79 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=827 residues).
MQNAPGRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYYLLSTPGVYQRTASILIKEDGKSQSINSDVASMFS
DMGLSGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEGGTFHPVALYGRTLPVTVHFYSLNDMQSASLDVEVKHGNLF
SIVHVSGTDKAGNQVESDEEVQGKLGQTVRTVMGYVCVDQAPGYSAFVNGYESRKLHVTRTNLYAMTDHIKASLSASISE
EKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSRNLLPDVET
AAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLVANSSEQNP
LVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFLLQKREENE
LSKAFTAYNTRIITPPTGDIKPVQPVRRNIILVAFVLGFLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGEIPYSISRK
NRPTLLQRIQFWKKPKETRQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAGNIAMSLAIK
KKRVLVIDGDLRHGSASMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFTDRLEKMIK
QVRGEYDYVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLMQRSLLGDIEQFYKDKKFKNMSLILNGTKAQGGRYYRYGY
HYGYGYHYGSDKNGGCKNRKVENWIKE
>gnl|bykdb|A0A413VJ33 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFMDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKNIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKSYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A413VXJ7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides nordii] (length=821 residues).
MSTEQNINKESKTSKNSKQEEEISIADILQLIWSNRYWFALSIILCIGIAFFYIQSTSKVYSRKATVLIRDDSKGGGISE
SSAFADLGLFGGKRNVDNEVLIFQSRHLMEEVARRLHLDISYKIKEGLRNKELYTHSPIILSFPEAEERQSILVTVTPID
SARVRLSDLKMSVGDGEVTSNEVLEVNLHDTIQTPVGAMVVMPTLYYSDNFYEKPISVTKSNMERVVDAYQSSMEVSLAS
KTATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKRENQLTDITS
ETGMYLANTSLYRQEGLSLENQLSIAKYIKDYLVDPQKNADLIPANTGISDNSVESQISEYNEMLLKRDKLVSGSSSKNP
IVIDLNNSLAAMKQTIIRSVDNLIVGLNIKLKNNREHEEQTQKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENA
LTQAITESNARIIDPASGSSKPVAPRTMVILFAAILIGGAIPMIFFWLQKTLDTKVRTRKDLEDALSVPILGDIPQCSEK
DRKESPIIVHENSRSPISEAFRIIRTNMDFMRVKTENLQVVMLTSSNPGAGKTFISCNLAMSIAQMNKKVILVDVDIRKG
TLSNIFTDIPARMGLTNYLSGKTDKIEDIIITNDKYKNLDIIFAGPVPPNPAELLLSERFDRIVTELKKHYDYVILDNVP
VDIVADASIINRVVDLTIYVVRAGIMDHRQLPNLERMYELDKLRNMAIVLNGVNYDRKGYGYGYGYGYGYGYGYGNDEGR
KSKNKSLTKRLKKRISNLFNK
>gnl|bykdb|A0A413XDP6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=796 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGNRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPEVGLSNYLGGQVDKLSDIIVTDKQHPSFSFIPVGTIPPNPTELLFDDRLQDAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGAGGRYGYRYGYRYGYGSGSYYGSSSK
>gnl|bykdb|A0A413ZSE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A414GI87 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=791 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGREVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQRKNK
>gnl|bykdb|A0A414IEQ9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=792 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLTDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPAELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A414KYB9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A414L0W6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTMIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKNIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKSYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A414LGK8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides intestinalis] (length=795 residues).
MVEKKTPAGKPADDFIRIQDLWSMFVPKWYWFAVCLFITLAIAVLYLLSTPPIYTRTAAILVKDNSKSNSSTSSMSDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVSRLGLNEVFTVRKGLKKVDLYKAAPFTVTFRDQPEAPLSFTIEFSSKNTFTIS
DLKVSDESTGETFSAQMGDSIRTSAGTMILHPAQKNADAFINTPIQYVRGSVSATADTYANALVAELGSDDATIINLSIS
DASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKSEHLLPDVQAASSLYMAQSAE
NNKELSALNNQLSTAQYIRRELNTKQLNQTLPTNSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRVEDATTTRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVIIFMKENMNTKVRGRKDLQNLSIPFIGEIPQYSGTKKKWWELKHRKRQ
DQKTVVVNEGNRNIINEAFRVLRSNMDFMINKDSNQHVFVLTSFNPGSGKSFLAINIAMSFAIKKKKVLVIDGDLRHRTA
SSYVDSPDKGLSNYLNNQVENWKEIIVPYKEYANLHILPIGTVPPNPTELLESSKLATLIAALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFIVRSGLLDRSMLPELENMYTEKRFKNLSMILNGTEGAGGRYGYRYGYHYGYASYYGDKEK
>gnl|bykdb|A0A414LPI6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=790 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A0A414LTU9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=788 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A0A414M7I4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides eggerthii] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|A0A414Q925 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTELVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKAQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A414XX40 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=790 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRMVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVILS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A0A414YFM3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=820 residues).
MLRRNQGDDFLRLQDLFYLCLARWKWFVLSLFVTMGAAGYYLLSTPNVYQRTASLLIKDESKGSSINNDVESMFSDMGLG
GTKSNVNNELIAIKSPSVLLEVGKQLKLNVDYAVDGRFHRNVLYGNDLPVTVQFLTIGEEHYGSMTVYLKGGDKFELTDF
KGTSSNGTPVETNKTVTGKLGKLVQTPLGKVKLEAAPSYAAFIKGGDAPALYVSHTDLYSMTNRILGSLTVGLNEEKTTI
VNLTYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISSFKSANLLPDVETAAQQY
MQKSSDLSKQIMDLNSRLSIAQYIRSSLVGRVSKNQVLPSNTGIDSPGIEQQIAEYNKTLLERNNIVANSSEQNPLVADY
DQNLNAMRRSITASIDNFVVTLRTQLGTLQANEAHTTSQIASNPNQAKYLQTVGRQQKVKEALYLFLLQKREENELSKAF
TAYNTRVITPPTGSNLPVAPVRRNILLVAFALGFLIPVVIIFVRENMNTTVRGRKDLKNVTIPFLGEIPFYISRKNRPTL
KQLILFWKKPKEVRQIVVKAGKRDIVNEAFRVLRTNFEFTIGAHPEKNVIVITSFNPGSGKSYLATNIAMSLAIKEKKVL
VIDGDLRHGSTSMLVGNPAEGLSDYLNGRTDDLKGIICHGEENGLVKDFDILPIGTMPPNPTELLFSERLESLINQLRKE
YDYIFIDCPPVEIVADTQIIEKYADRTIFVVRSGLMERSMLGDIEQFYKDKKFKNMSLILNGTKAQGGRYGHYYRYGYHY
GYGYGYHYGSDKNGGAKIGK
>gnl|bykdb|A0A414ZBF2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM16-24] (length=807 residues).
MRKDKFEDFDFIDFNESRSEESTVMADMIGVLAHHRKWFILSVAVCLLVGFIYVRSTPKTFSRTATILVKDEQGGGNMGE
SAAFRDVFSLGNSKVDNEMGFFKSKRLMMEVTRQLRLDVSYKERNGLRKRELYNSTPFTVVFQDAEPGQEISLTATAIDG
NRALLSDFVLDENDFDEVVTVQMGDTTDTPVGKVVVASTLFMNEEYMGKPVYVKKGNRKNVSDNYNANLQVEVVDKSSLI
NLTIEDENIGRAEDVLNTLIEAYKNDAIEDKNKVVINTANFIKDRLTIIEADLGVIDTEIEDYKRENKLTDVTSESALLL
QNSSRLGGESLSIENEVVMAEYIKDYLQDNSKTAELIPSSIGINDNGIQNQINEYNTTLTKKNKLMANSSANNPIVREMN
ASLVSMRASISKAVDNLVAGLKMQVRNMKRKELENMNRKAFVPTQQKYVISIERQQKIKEELYLYLLNKKEESELQLSIT
ESNCRIVDPADGPDLPVSPRKAQVLLICILLGFTIPTLWLYIRSLLNTTVQTKRDLKAGVSVPFLGEIPLKKGKREKDIV
VKEGSREYICEAFKILRDNLDFMDTEKKAGGKVVQVTSFNPDSGKTFIIANLAMSMALSNAKVIVLDLDLRKGSLTKNSG
IGTKEKGMSAYLSGKVNRVEEIIRPYEEGSRLDIITSGALPPNPAELLKSDKLDELIAGLKETYDYILLDNPPYGMVVDA
SLCARLVDQSVYIVRAGMFDKRLLPELQELYDSGKMKHLSVVLNAVNYEKGGYGYGYGYGYGYGYGYGNDNDRKPKKTAF
CKRVFGI
>gnl|bykdb|A0A415BDM7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=791 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGREVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVRVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQRKNK
>gnl|bykdb|A0A415EEZ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AM07-16] (length=772 residues).
MNDSYKVNDLQNGDFNIRAIVDILKAKWYWFAFSIFVCLGVAWFYYQISPEVGEQKAIVLIKDKEKTDAAFLEKQLFQAN
SNLANEQIMLKSRFLMSKVINRLGLETEYSMKDGFRRKVLYPDIPIRVKFDSLFNKNVSLSVIPLSETYYQIEDFSEDPD
WSVKGSFGTPLNTPVGELNIIRTSYFTPSYIGQAIYVKHSTVSSVVSSFITPLTVEKVDDTATLLDITYKDMNQDRSAAI
IETLIEAYNDDATQDKNQILFNTSLFIDDRLQIINKELGLVDGDIEKYKKKNGLTNLSSEASLYLNNNNANRQEIIQLTN
QMELVRFIREYLNDPTKQSELLPANSGILDTGVEGLINQYNENMLLRKKLIRISSDRNPTVGTLSNELASLKNTVLYSLD
NLYRSLQIKLNDAQRQEALTAHRIGTVPTQERYIMSVERQQKIKEELFLYLLNKREENALSMATVEDKIRVIDTPYSTGR
SSGMSFMVLMLAAVVVGIFIPSVWFYIEPMLDVSVRNRKDLKDALTIPFLGEIPRKKKTKERIVLDKDVRDGVSEAFRVI
RSNLDFVLPLKQDAQVIMFTSANPNSGKTFISSNLAVSLSMTGKRVLLLDMDLRKGSGRKQDGSFYPGVSTYLSGKTDDW
KSLVHAPKEYPDFYVIHSGPIPPNPAELLLTSRLDDLIREARREYDYILIDTVPYGIMADPQIISRVADMVIYVIREGLM
DRRMLSDVENLYREKKFSGMTVVLNDAGAKNTPYNYGYGYAYKYGKKKRKLI
>gnl|bykdb|A0A415GGC6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella copri] (length=830 residues).
MIQNNQATMQNVPGRRPQQAEDFIRLQDLMYLCLVRWRWFVISLVVTLGIATYYLLSTPSVYQRTASILIKEDGKSQSIN
SDVASMFSDMGLSGGKSNVNNELIAIQSPAVLLEAGKQLKLDVNYSEDGTFHPVALYGRTLPVTVHFYSLNDMQSASLDV
EVKHGNLFSIVHVSGTDKAGNVVESAVEVQGKLGQTVRTAMGYVCVDQAPGYSAFVNGYESRKLHVTRTNLYAMTDHIKA
SLSASISEEKATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSR
NLLPDVETAAQQYMQKSGDVDKQILELNSRLSMARYLRDFLTGKVGKNQLLPANIGIDSPGIEQQITEYNKQQLERNNLV
ANSSEQNPLVADYDQSLASMRHSIVTSIDNFVVTLNSQLGNLQANEAQTTSQIASNPSQAKYLQTVGRQQKVKEALYLFL
LQKREENELSKAFTAYNTRIITPPTGDIKPVQPVRRNIILVAFVLGVLIPVVVIFIRENMNTTVRGRNDLKNITIPFLGE
IPYSISRKNRPTLLQRIQFWKKPKETRQIVVKAGKRDIVNEAFRVLRTNLEFMIGTHPEQNVIILTSFNPGSGKSHLAAN
IAMSFAIKEKKVLVIDGDLRHGSASMLVGSPGEGLSDYLNGRTDDLEGIICHGEEYGLVKGFDVLPIGTMPPNHTELLFT
DRLEKIIKQIRGEYDYVFIDCPPVEIVADTQIIEKFTDRTIFVVRSGLMQRSMLGDIEQLYKDKKFKNMSLILNGTKAQG
GRYGHYYRYGYHYGYGYGYHYGSDKNGGQK
>gnl|bykdb|A0A415IPQ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF39-11AC] (length=808 residues).
MVEKKTPAGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMSDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRRGLKSVDLYKGSPVTITFCDKIEVPLSFTIEFSSKEAFTIS
EFEISGESIGETFSAQIGDSIRTSAGIIIISPTEKFTDAFTGTSILYSRGSVRAAADTYANALVAELGNEDATIINLSIN
DASIQKAEDILNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NKKELSALNNQLSTAQYIRRELNAKQPDQPLPTNSGIVNANIETLISEYNNLVLDRNRLIANSSEKNPLVSNMANSLQSM
QRTIIQSVDNLIVSLNTQIRSIRQQEDATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRRMNILLVALAIGLLVPAVVIFMKENMNTKVRGRKDLENLSVPFIGEIPQYAGTKRKWINGFRKRQE
MKTIVVKEGSRNIINEAFRVLRSNLDFMTSKDSNQHVFVLTSFNPGSGKSFLTLNIAISFAIKKKKVLVIDGDLRHGSTS
SYIDSPDKGLSDYLGNRVKDWREIIVPDKSYENLHILPIGTIPPNPTELLEDNRLATLIAALRPEYDYIFLDCPPVDIVA
DAQIIEKWADRTIFVIRSGLLDRTMLSELENMYTEKRFKNLSMILNGTESTGGRYSYRYGYHYGYASYYGSNADSRGGVG
VNGWLSDK
>gnl|bykdb|A0A415NEB6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides intestinalis] (length=805 residues).
MTEKKTTASKPADDFIRIQDLWGIFMPRWHWFALSLFVTLATAALYLLGTPNIYTRTAAILVKDDSKGGTSTNAVSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTVRKGLKDVELYKSSPLAVTYRHLDETPVGFTIDISSKETFVIS
DMEVNGKAFGEEFSGKMGDSIRTEIGTLVINFTKYWNDSFVGTSIRYRKGNVCAVTDYYTAALHAELGNEDATIINLSIN
DASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAE
NKKELLALNSQLSTAQYIRKELNNKKLSQLLPTNSGIANVNIESQIGEYNTIVLERNRLIANSSEKNPLAKDMANSLQSM
QRTIIQSVDNLIVSLNTQIRNIRQQEATTTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMLPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSIPFIGEIPQYLSAKKKLGFDKHTQSV
MKAIVVKEGNRNIINEAFRVLRSNIDFMAGKDSGQNVFMLTSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSTS
SYVDSPKTGLSDYLGNRVSDWKEIIVKDEKYDNLHIIPIGTVPPNPTELLEDGKLATLIEVLRSEYDYIFIDCPPIDIVA
DAQIIEKLADRTVFVVRSGLLDRSMLPELENIYQEKRFKNLSVILNGTESAGGRYGYRYGYRNGYSSYYGNKGKMGGVNG
WSSSD
>gnl|bykdb|A0A415PUS9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTELVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKAQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|A0A415TAH7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides caccae] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESARFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A415UKN5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae] (length=792 residues).
MIKNRTNAGKPADNFIRIQDLWGMFIPKWYWFALSLFVALATASLYLLSTPNIYTRTAVILIKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLVDNKKNVSFDIEVDTQNKFYLS
NFIVAGKETGERFEGNIGDSIQTSAGTLAISLTSQYENSFTGSTIQYSKEPADAVADSYTQKLRADLGNENATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLTTAQYIRRELNSKDMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALVLGLLVPAVIIFMQENMNTKVRGKKDLENLSVPCLGEIPLYLSNKKKNNKSPEHVIV
VEESNRNIINEAFRVLRSNVDFIKNKNTQQKVFVVTSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLTDYLGYEETSWNELLITDKKYPNLHTIPVGTIPPNPTELLEDKSLATLIQALRNEYDYIFIDCPPIDIVADAQII
EQYADRTFFVVRAGLLDRSLLSELENIYQEKRFKNLSIILNGTESTGGRYSYRYGYSYGYHNGYASYCRDKK
>gnl|bykdb|A0A415ZDP9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tannerella sp. AM09-19] (length=802 residues).
MAAVQNNPKSKQSEEFMRIQDLLYLCASNWYWFALSLMITLGAAVLYIKVTPPVYTRSASILIKEDSKGKSLSADAGSFA
DLGLIQANTNVNNEIISLQSPAIMTDVVKRLHLNMDYHVDGGFYQEVLYGRTLPINVSIDTPDNNESSALTVKILADSTV
ELSDFIRNGEELPGKLVKGQLTDTIMTPVGKVTVCPTPYYTSQFSQPIYVSRSGLYSAVRRYVPNLSVVLNDEKSTVVDL
SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKSEHLLPDVQAASSMYMAQ
VSETDAQLLALNNQLYMARYIRNYLGGESNKYQLLPANSGIENSNLGDQITEYNNKLLQRNSLVANSSDQNPLVIDLDHA
LAAMREAIIASIDNQVVTLNAQIKNLERSGQQTTTRIAESPAQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAY
NTRIITPAGGSMLPTAPLKKNILLVAFVAGLLIPVIVIFIAENMNTKVRGRKDLENMTIPFVGEIPLAYHQGKQGSIFRK
KKLPEMHTVVVKEKSRNLVNEAFRVVRTNLEFMLGKEGQSRVIMVTSANPGSGKTFITMNLAKSLAIKGKKILVIDLDMR
KASLSSYVDSPRIGISNYLSGQVENFSEIVVKGKIYPGLDVISVGTIPPNPTELLFDLRLEQMLSTLKAEYDCIFIDCPP
VEIVADASIINKLSDMTLFIIRSGLLDRSMLYEIEEFYTDQRYKNMAVILNGTSEAYGHYGYQYGYRYGYNYGYGKGYSE
EN
>gnl|bykdb|A0A416GA42 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. OF04-15BH] (length=793 residues).
MEQQNKQNVSGSGLELNPMDLLHVALKKWYYYVGAVVCCLLFAYIYLHRTAPMYQRMATVLIKDKESGTRTPSEAEIFKE
VGFMNLSGNVENEILIFKSLHLAEQVVRRLDLDVCYQVKGFWRPTDLYGVSPVTVHFVQGDDLACSFRLRLLPGRKVELS
QLKYQAQELTETKTFVLNDTVQTAVGQLVVVPTGFYQKFDRELEIEVLKSTVRNTGNALVARLGVAKASKESSMIQLNIT
DPVPQRAEDILNTLVDAYKEDIVNDKNTVARNTERFVVDRLAILEKELGNVDNQIASYRSANQLIDGTQSGLYLQRADQF
QNEAVQLQTELELTRYLKEFLLQPKNDKSLIPVNIGVSETNLVNQIAEYNKMRLQCDKMESTTAVENPVVQDLQQAMLSL
RESILRTMDNHIEALQLRLRSTVQQEVRSSGKAANIPNHQKVVLSAERQQKVKEQLYVYLLQKREENALAEYIAESNARV
VDRAKGSNLPVSPKTQMVYLSALILGLALPTAVIFLMLIMDTKVRNRKDVENKLTMPFLGDIPYHSWEKGKAHDTVVRAD
GLDAVTEAFRILRTNLDFMKGEQQGPLKIMFTSMNPDAGKTFVISNLAKMFAFAGKRVLLVDLDIRKGSLSRIFGGRKAT
GITQYLIDRQMTAKELICPVKDCPGLDVIYSGVVPPNPAELLMSARLDQLLEELVASYDYILIDSVPSAVVADASIVNRL
ADLTVFVIRAGLMDRRQLPDVERIYQEKKLKRMVTLLNGVKKEHAGYGYYGYYGGYGYGYGDQKKKKKNFGLF
>gnl|bykdb|A0A416GGJ1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. OF04-15BH] (length=772 residues).
MQTNKKVDSGLNLIDVFSFLASKWKWFLLSVLVFGSAAWLYYARKPFVYFRSATVIIKDPSNKTTTAGFDRYDNYINKVN
VANEILQFRSKRLMREVVQRMHGDVDYLIEDGLRHIELYTKAPVTVSFPGMSPNGAVQFKLKMLNLKEAQITTLGDAGKT
YKVQLRDTTAIGNFKIAVTPTNFLNKSWIGQEITVRKNPLESVVSYYSGNFAIRQEEDESSILTLALRDFSPERAEELLN
TMINVYNEEAIEDKNQVAINTANFINERLIIIEKDLGVVESDLETFKSSNQLMDVSSTAGMYMSESQKYGADGMELETQL
RLAQYIKEYLIDPAKETDLIPANTGLSDASVESQINTYNELKLRRDKLIDDSSDKNPVVEEMNNSLRAMKQNIVRAVDNL
IVSLNVRRRDALSRETRAQVRFSSIPKKERKMLSIERQQKIKESLYMFLLNRREENALTQAMADNNARLIDEADKGSGPI
APVRNRILILGLLAGIALPGVACLLILFLDTRVHGRKDLEGVVTAPLLGEIPLDKKLAKKKKTVHGPRLFLDKQDDIIAE
AFRILRTNMAFMAKKGVPVKVITFTSFREGAGKTFILRNLAVSLMAAKKKVVVLDLDIRKRTLSRHFAKHPYGMTNYLSD
ASIRLEDILVKGNGVDIPDAILAGPVAPNPAELLLENRLDELIEELKTMYDYVIVDNVPIGIIADASIANRVADLTLFVV
RAGSVDRRLLPEIEDLYENKKLNNMAVVLNAVEHRTVYGYGYGYSYQYKGGE
>gnl|bykdb|A0A416TME1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. AF18-52] (length=788 residues).
MNSEQETTYLREKENELNLNDLFHIVLANWYWFLLSTLFCCGVAFLYLKWAPKVYTRTASVLIKDNTKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMNIVSERLNLDVSYTEKDGLRTVELYTQSPVAVQFPEAEATQAFSLVVTPLSEKEVLL
SDFSMAEGKMQKVVLNDTVATPAGKLVVTPTLYYSDKYFGKSVVVGKKNREDVALNYSNALQVVLASKTATIINLTLQDV
SIPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYKRENRLTDISSETGMYLQESSQYS
KEGLGLENQRTLAKYIRDYLTDPHKSADLIPANTGIADVNIEGQISEYNNLLLKRDKLISNSSNKNPVVMDLNNSLNAMK
QTIIRAVDNLIVGLNIKIKNIKEREVQTTRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRSPVAPKSMMILLAAMVLGLAIPAGIIWLRIVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTSKKVILIDLDIRKGTLSSHVSASTNMGVT
NYLSGKVDDVDVIIGKEEIAKNLDIIHTGPVPPNPSELLLSTRLDTLIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
TIYILRAGLMDRRQLPELEKLYKQDKFRNMSLILNGVRYNHSGYGYGYGYGYGYGYGYGYGNEKKKSK
>gnl|bykdb|A0A416WYC9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. AF14-59] (length=797 residues).
MNPEQETNMLRAEENELNLIDIYRVVRANWYWYLLSVVVCCAIAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEINENLEIGLTVVPVSDKEVS
LSGFTSEELEEEGQTLEDQTQTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVTKSSRDRVALNYNEALQVALASKTA
TILNLSLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEVFKRENQLTDIHSEAG
LYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDANVESQISEYNALLLKRDKLIGNSSNKNPVVM
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREAQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMAIPSGILWIQLTMNTTVCSRKDVEDNLSIPFLGEIPSRSRKDKS
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSLVLTNKKVILVDTDIRKGTLSAR
ISHANAGLTHYLSGRVEDVDKIIASSGLNDRLDVIHAGPVPPNPSELLLSNRLEELVKALRDRYDYVILDNVPAGMVADA
TIVNRVADLTIYVIRAGLMDRRQLPEVEKLYKQEKFHNMAVILNGINMKRAGYGYGYGYGYGYGYGYGNEKSQKGKK
>gnl|bykdb|A0A416X133 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF14-46] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|A0A416X8R7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF14-46] (length=803 residues).
MELIQETKNDKKNEGGVTLRDIVELVFDNWYWIVLSVVICMSVAWFYLAMQTPLYKRSAVMLVKSENKSGNDMSAVLELN
GGISGSGVENEIYILQSHQLMREVVGRLHLDVTYQVKNWLHYDQLYAESPIRVNFLDAYTAPVSMEIKPLNGNRFLLNQL
KIGKEKSDNEGQEFLFGDTIISAAGRFIVEDIPDKISAYYNVPVEVSRIDLNTAANIYHSFISTSLAGERTTLVQINCVD
SNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQKNRIVSIDAAATQFMSESSKM
RDELVQLETEYAIARAVERYLTDNEHSKQLIPNVSGVGDSGLQNQITTYNEILLQRERLAANSGENNPLVKDLDNNLAAV
RVNLTASMDSYLSTLKLKLKKAREVESQTLDHIESVPQQEKKALGIIRQQSIKESLYTFLLNKREENALQLAITEANIRV
IESPFGSSAPVAPARRMLLMGAFIVGLIIPLAIQLLRLLWNTGVRGRKDIEDYTSMPILGEIPLMKDRDGEQAIVVEENK
TSSVAESFRLLRSNMDFVAPQARVVMFTSTMPGEGKSFVSRNFAVTLAMTNKKVVLLDMDLRKRTLSKTLDLTTKNGVST
WLSGKNNSVSELVQSSNIHAMFDIISAGIVPPNPSELLMSDRLPVLVEELKKQYDYIILDCVPALVVADSSIIGRVADLT
IYVIRNGMLDRRYLPELEKLYRRNKFKNLTVVINGIEMESKKYGYGYGYGYGYGYGYGVEQGRKKKRNVIYKIAHRIGRI
FRG
>gnl|bykdb|A0A416XAH0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. AF14-46] (length=780 residues).
MEEKYTSERRNDNIDIVALWRAACRKWYLFVGSIVVCVALVVCYLKIAKPVYEVSADILVNEDEKKGGGGLSSLMGDIAG
GGFSLDGMIGGGSVNDEILVISSHSLIREMVQRLDLNISYTSKKNFFKKKEYYRNSPLTVEIPESMVDTLSSGFVVKVQT
GDSDDKIKVLLKKGFFTTLVEMEATSFPIKVDYGEGIIIDKTQFYEPGKKLKFVAHVNGYDGEAEILEKRLDIDLSDKKA
NCISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVERYKRENDLSDIDAEAK
IILEANSQYRKLLLEAETQYSIISMVDSFLNKPENKYSLVPVTTGLPDRGAAEAINEYNKLLLERMRLLRTAKDSNLALR
TLTAQIDVMRENILNTVSKAKESSDIARTDLKKQEEDFRSRLRGFPEQEREYMDIKRNQLIKNELYTFLMKRREESAMTL
AATSPKCRIVNPAYSKNKPVAPQSLILLLIACGIGLVLPVVYLYGKTVFSVKFNNKNDLRRLTDLPIAGEICHSSTSGYV
VLRENSVSPAAEMFRLLRSNLQFMLPGGGKGILLVTSSEPGEGKSFVSLNLAYSIALMRKRTVLIDLDLRNPKIADYLGL
SVTTGLTNYLVSNKEGGENDLIHHVAQEGFLDVITAGPVPPNPSELLLSEKLDSLMARLREKYDYVIVDTAPVERVSDTF
SLTRFVDATLYVCRADYTHKNSVFNVEDFVAEGSLKNVMFVLNDTEIKKTYGYSVKHTRG
>gnl|bykdb|A0A416XPE8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. AF14-59] (length=786 residues).
MNSEQETTYLREKENELNLNDLFHIVLANWYWFLLSTLFCCGVAFLYLKWAPKVYTRTASVLIKDNTKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMNIVSERLNLDVSYTEKDGLRTVELYTQSPVAVQFPEAEATQAFSLVVTPLSEKEVLL
SDFSMAEGKMQKVVLNDTVATPAGKLVVTPTLYYSDKYFGKSVVVGKKNREDVALNYSNALQVVLASKTATIINLTLQDV
SIPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIETYKRENRLTDISSETGMYLQESSQYS
KEGLGLENQRTLAKYIRDYLTDPHKSADLIPANTGIADVNIEGQISEYNNLLLKRDKLISNSSNKNPVVMDLNNSLNAMK
QTIIRAVDNLIVGLNIKIKNIKEREVQTTRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRSPVAPKSMMILLAAMVLGLAIPAGIIWLRIVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTSKKVILIDLDIRKGTLSSHVSASTNMGVT
NYLSGKVDDVDVIIGKEEIAKNLDIIHTGPVPPNPSELLLSTRLDTLIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
TIYILRAGLMDRRQLPELEKLYKQDKFRNMSLILNGVRYNHSGYGYGYGYGYGYGYGYGNEKKKSK
>gnl|bykdb|A0A417LKQ2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. TM07-1AC] (length=788 residues).
MNSEQETTYLREEENELNLRDLFNIVRANWYWFLLSVLLCSGAAFLYLKWAPKVYTRTASVLIKDNAKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMNIVAERLNLDVSYTVKEGLRTVELYTQSPVAVQFPETEAVQAFSLTVTPLSEKEVML
SDFSTDEGKMQKIALNDTVTTPVGKLVVTPTLYYSDKYFGKPVAVGKKNREDVTLSYSNALQVALASKTATIINLTLQDV
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEKELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
KEGLGLENQRTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLISNSSNKNPVVMDLNNSLNAMK
QTIIRAVDNLIVGLNIKIKNIKEREVQTTRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRLPVAPKSMMILLAAMVLGLAIPAGVIWLQVVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKEMKVVMFTSFNPNAGKTFVSMNLAMSFALTSKKVILIDLDIRKGTLTSHVSGAANMGVT
NYLSGKVDDIDAIIQKGELAENLDIIHTGPVPPNPSELLLSNRLDTLMEALKERYDYIILDNVPAGMVADAAIVNRVADL
TIYILRARLMDRRQLPELEKLYRQEKFKNMCLILNGVRYNHSGYGYGYGYGYGYGYGYGYGYGNEKKK
>gnl|bykdb|A0A418M8U8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fibrisoma sp. HYT19] (length=772 residues).
MNNQFQHSYVPYKMMEPEELRVSDLLPKFTRNWPWILFSVCVFLVAAYTYLAYKQPVYKIQASLLIQDEKKGNERDQPLK
ELDAYVPKKVVENETEILRSYTLMNRVVDKLHLDVRYFEKTAFGKREIYKASPVDVFVEFGKPELYEEPMLLTFIDSSSV
EINEQVYPLNQRIKTPQGRFLIKTRRSVGDTTNQVLVQAMKRPAAVNGYLRTLQAEPTSKASTVVVLTLEDAVPEKGEAV
LNQLIDEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTTVEKEVERYKATQGITDLSTQAASFLQAIQQNDGLLNQVNI
QLSALSDLQRYINNRSLDRGATPALVGLNDPVLFSLIEKLTQLDLQRSQLARTTSDQNPLLQTIDTQINSLKGNMEDNIR
TMKTMLMSSQQQYRTKNAQLESSIRTIPQKERTLLTISRQQAIKNNLYTYLLQKREETAVSHASSISDSRTIDVAQSTDA
PIKPVPLMIYGLFGFLGFIIPIGLIGSRELINTRVTRRVDVEKITQAPIIGELTRKQEPDYLVVTMTNQSLIAEQFRTLR
ASLPDIQSDRSQVLLLTSSISGEGKSFISLNLGASLALVGKPTVILDMDLRRPRLHKEFNWSNTTGISSYLTGKCTVYDI
LKPVPGHDNLFIIPSGPPPTNPSELLSGQPLKQLVEQLREHFDNIIIDTAPIGLVSDARLVAPLADISFFVVRHDVTPKN
YLRQVEALYREQRFKKLNIILNAIDKDESYYYAKMYSYTSSLLGKKKWLSFS
>gnl|bykdb|A0A418R9X5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter rubripertinctus] (length=815 residues).
MAAKEDAELEELIRNAGGEPEEEEEGGGLDLTTLLMVARRSLPWMVLLIMIGLTASWLFLRYTPPVYRASSTLKIDEKSE
AGVLLGGIGQAAEQKQTLNKLSGEVELIKSDIIYRRLKDSLTLDVNYYVQGTVLESELYSLSPVRIEYKAGKGAMFNQKI
GLQLLENDRFSLQLPNGASATQALKFGQPIDIAGFTLYMYKTAQYEGANRDANYSFIINDQNAINGYLNQNLSVDIINPD
ASTISISFTDYNPSKASDIVNYVDSVYLVEKILRKQETMARATNYIDRQLGVNSDKLSQAEAKMQDFVRKNKVFDVKSEA
GLVTNQLNMLESQQEELQEQADMLAELSRLVEQERLTSRQDGDVMQTIPALSTIEDAQLTKRITELSDLQLDLSQLLKSY
QETTTAVKLRRAEIANIKAIIRELLSKDRQLVRRKIAKMAAKKAELESKLGNLPEKQTEQARLQRPLELYEKYNMLMMDS
KIQFGISMAGTTADFQILSPAIVPAVPISPVRLMIYAIGLAAGIALGLALIAVRYLLHNTVTNIRELERNTNASVLGVIP
TYDKEKMAVSKLVVDRNPKSALSEAIRSIRTNLEFVATSKKKRLISITSTISGEGKTFVTVNLAGIIAASDQRVVILDLD
MRKPKVNLAFEAENTKGISTILIEKHTWQDCLQHTSIPTLDFISAGPTPPNPSELILSPNFDALIVQLHQHYDVVIIDTP
PVGLVTDGILIMRKADVPIYIVRANYSKKSFLKNINKLMRANNFTKLTTILNDAQTTGGYGYGYGYGYGYGYGQGYYDEE
AAPTGLFSRLRKRFS
>gnl|bykdb|A0A419VXB7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Mangrovibacterium diazotrophicum] (length=795 residues).
MDRKEELLKLLLQKEEQPQNIKDFLFKLLYHWKWFVLTVVVGVGIAFVFNRYTPATYRVKSLLFIKDKESSGVDLQNIFS
SSPLKSDVKLSNHIEILKSFSLNYEVLENLGWNVSWYRHMPLGDFILYGNEPCHVEFEPDAFNLKGVPVHISPINDREFK
IEVKSKANLLGINTEVDFEGTGVFGEKFENRYFSFTLQKKVLPTEGDYYFEFNDLEKLTLSYLRQLQVSTVNKDADVISL
QLTGQNPDQKISYLNELSRVYIQYGLQQKNQISDNTIHFINQQLKDIVDTLKSTSNEFTKYRSSNKVFDLSQEATLVTGK
LSNLDTKRSMAEMQLEYYKNLRGYIGEDGNMKNIVFPSVVGITDVGLNSMVVRLSELNSKKETLSYSVHSKNPGIQVIDK
ELEYVKKSLVENLDNLIFNTENELKSIKQDIEEVDKQLEAYPKTEQDLINIKRMVDLNNELYNFLLQKRAESQITKASNV
PDVDVLDVARRATTEQIGPKKKVNLMIGLFLGLAVPFLFIVVRNFLEDGIQDREQVQKLTELPVIADVMHNTYNEYLPVV
NYPRSVLAESLRELRTSLDYLSFGRNGGIIGIHSLIPGEGKSFIASNLAVMLAMNNQKVVLIDADLRKPTLHHCFDLTKD
VGLSTYLIGRHTREQIVQPVSIKNLSVITSGLIPPNPVELLGSDEFDTLLKELGEQFDVIVIDNSPVTLVTDAAVVSRHT
QCNLFVVRQKRSPKKMVQLLSQIVAKNKMQKTGIVLNDVDPKRYGNYAYRYGGYYHKAYYGESGNYFDDKSKAEM
>gnl|bykdb|A0A428JSJ3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter sp. 9PBR-2] (length=815 residues).
MAAKEDAELEELIRSAGGEPEEEEDGGGLDLSTLLMVARKSLPWMLLLIALGVTASWLFLRYTPPLYKASSTLKIDEKSE
AGLLLGDVGQAAEQKQNLNKLSGEVELIKSDIIYRRLKDSLELDVNYYVQGTVLESELYNLSPVRVEYTANKGAAFNQKI
GLELLDNDQFKLHLPGNGSETSALTFGQPFQAAGFTLRVYKTAQYTSADRDATYSFVIQDGGTVNAYLTQNLAVDIVNPD
ASTISISFADHNPVKASDIVNKIDTVYLVEKLLRKQETMARATSYIDQQLGINDNKLGQAESNMQDFVKRNRVFDVKSEA
SLINNQLTTQEAEQEKLQEEADMLADLARLVEQERLTDREDGDVFQTIPALSTIKDGQLLQRITELSNLQLDLSQLLKSY
QETTTAVKLRRSEIANIKGIIRELLRKNQQLVRRQLAKMSAKRAELEGKLQTLPEKQTEQARLQRPLELYEKYNMLMMDR
KINFGISMAGTTADFQILSPATVPTVPISPVKLMVYAIGLAAGIVLGLGLIAVRYLMHNTITNIRELERNTSAAVLGVIP
TYDKEKMAVSKLVVDRNPKSAISEAIRSIRTNLEFMASSKKKRLISITSTISGEGKTFVTVNLAGIIAASDQRVVILDLD
MRKPKVNLAFDADNTKGVSTILIEKHTWQECVQHTSIPTLDFISAGPTPPNPSELILSSHFDELITQLHQHYDVVMIDTP
PVGLVTDGILIMRKADVPIYIVRANYSKKSFLKNINKLMRANGFTKLTTILNDAKTTGGYGYGYGYGYGYGYGQGYYEEP
SAPTGLLTRIRKRFS
>gnl|bykdb|A0A428KI59 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter perfusus] (length=816 residues).
MAAKEDAELEELIRNAGAEPEEEEEGGGLDLTTLLMVARKSLPWMLLLIALGVTASWLFLRYTPPLYKASSTLKIDEKSE
AGVLLGDIGQAAEQKQTLNKLSGEIELIKSDIIYRRLKDSLALDVNYYVQGTVLESELYNLSPVRVEYKAGKGAMFNQKI
GFQLLENDRFRLQLPGGAAETGELSYGQPIEAAGFTLQVYKTPQHASADPDANYSFVINDDGTVNGYLNQNLAVEIVNPD
ASTISIAFTDHNSVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFVKRSRVFDVKSEA
NLVTNQLTAQELEQEQLQEQADMLAELARLIEQERLTDREDGDVFQTIPALSTIKDGQLTQRIIELSDLQLDLSQLLKSY
QETTTAVKLRRSEIANVKSIIRELLRKNQQLVRRQLAKMTQKKTDLEAKLGGLPEKQTEQARLARPLGLYEKYNMLMMDK
KIEYGISMAGITADFQILSPATVPTVPVSPVKLMVYAIGLAAGIVLGLGLIAVRYLMHNTVTNIRELERNTSASVLGVIP
TYDKEKMAVSKLVVDRNPKSAISESIRSIRTNLEFISTSKKKRLISITSTISGEGKTFVTVNLAGIIAASDQRVVILDLD
MRKPKVNLAFDAENVKGVSTILIEKHTWQECIQHTSIPTLDFISAGPTPPNPSELILSTRFDELIKSLHEQYDVVMIDTP
PVGLVTDGILIMRKADVPIYIVRANYSKKSFLKNINKLIRANGFTKLTTILNDAQTTGGYGYGYGYGYGYGYGQGYYEDS
GAAPKGFLSRLRKRFS
>gnl|bykdb|A1ZKR2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Microscilla marina ATCC 23134] (length=817 residues).
MTDQSNIPNINTPSEDDDFLNALDLEKVWEIFRKSIIWMLLLPLFTISIGHLWLRYTKPVYKSSSTLKLAIKDEGVGMLG
IKGLIPGGSYSGGNLVGEIEFIRSQIIFNDVINAMDLWISYYQQGNILDAEYYKNPPFKVIDHQVKSDAFLDKNINIEII
DDQRFQLSYVLGTQTVKKTYRFDQPIVTSYYSFKVIKTSFYKPAFRQIPFYFKINSRQALISYLNNNLQVGILNKSARII
GINFRDHHPQKARDIVHVIDTIYLHKTLENKKRANTQQKAYLNRRLGEIEDSMRTYEAKIQSFMLKFKTNDVNKKLEESV
KEIEKLIKEKIVFNEQLAAIKELDDLVNKQGDLSEFLPTLTTPIQGLGQLQPLISKLNQLQENKKILALKATGSSIVVKD
INQKLELQRTQVQKLLARVRKNIYKKIVAIQSTINELEADFGGLPAQEAEYKRVERLYKIYEGYYLQMLNRKAEIGISEA
GIVPEFVILSNANLPKIPISPKHLLIYGITGGFGLFLSLALVVIRYLLHNKVTNLRELERVTKAPILGTIPRYKHRKLKY
TKLLVHLNPKSSLNEALRSIRTNLAFILPEGQNLYDIKDAKIISITSTISGEGKTFVATNLGGIIAMSDKKVILIDCDMR
KPKLHIAFDVENEKGVSNILIKQNVIEDCIQKTPIDTLDFISAGPTPPNPSELILRNDFDDLLAKLKEIYDIIIIDTPPV
GLVTDGVLIMKRVDVPLYVVKAHYSRKIFGKGIDKLVQSNNFHNLSIVLNSVKHLTGYGGYKYGYGYGRYYGGGYYEDKS
NKQSFLLRLLSIFKRKK
>gnl|bykdb|A6EBM4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Pedobacter sp. BAL39] (length=801 residues).
MTGESRKGQRGPSHREVDLLKITMVLFSRWYIIASTTLICLIAAYAYLWYTPKTYATTAILKFEEQKTALSDIADALNTN
TATNMQSESFAIESRHLLLNAIKRLQYHISFYSYERLLQTDLYPQQPLQIDILKIDSLQSGRQLILFDPIDHEKFTLTWT
IGKEDIRKNFRFNSRIKVGNVSFMIRNTAQAAPSSSYLFRFNTPEDFLDRIREGLRIGEAGKNSNILSLQQTDVNPRFAA
DILNAILQEYLDYDKLQKTQSATQMIGFINEQLKHLSSAVSGAEKSLETYKQQSKVMDISVTSEHTLDKVSDLESQQSIL
RIQLIAIDQLRNTITTEQTNTPLNLSLEGTIDPLLATLAQNLNSLLHEKEELLKVYNGDAQAVMRLNRQIQEVRKAAMEN
INASQSRTRKSIDYLAGQIAQINGQISSLPTAEKDLFGLRRTFQLNEKVFSFLSEKNLETQINRAAIVPGATIIERAETN
ETPVSPREKEIYRTAVVLGLLSGIAIIILIRALNTYIYDATFVMEATSTPILGSLRKTMVLSGKKEDVNILCLSQPRSIF
AESIRNIRTNINFIAAEKTSKVICITSEISGEGKSFVSVNLASTMALIDKKTVIIDADLRRPKLHQTFPAQKDNGLSNYL
IGQLQSADIVHHSGHKNLDYIHSGPTPPNPAELLHSKRMQSLISELRTKYDIILIDTAPVGLVSDPIPLIRWADISIFVI
RYGVSKNSAANLPQSLSTQYKLDNTYIILNAFEDNSLYADIYKRNNGNAAFGSYHQPDGKAYYLDEQTPDRWWNIRSWFK
S
>gnl|bykdb|A6KY94 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=792 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLSELESIYLEKRFKNLSVILNGTESTGGRYSYRYGYSYGYHNGYTFYYGNSK
>gnl|bykdb|A6L0K5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus] (length=788 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A6LE40 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=806 residues).
MMTINPKNTKPGQQDDFLRIQDLLFLCLAKWQWFVLSLVVTVGAATVHLLRTPAVYTRTASVLIKEDSKGKSVSSDLESF
SEFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRKVAYGLTLPVDVTISDLPENESAGFTLEVQPDGT
LFLSDFTRNGTELDGKDIKGSLLDSIPTPLGKIIIHTTPNYVKGEAYILYISKSSLYNAVNSYSSNLSISLNNEKASVID
LSLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMA
QSSQTNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQ
ALASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTA
YNTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLENVTVPFIGEIPLFTRKKKGIFGKK
PQEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHG
SASSYIDSPARGLSDYLGGSIDNLNEIIVSDPKQKSMDILPVGTIPPNPTELLFDERLKQVIDTVRGQYDYVLIDCPPIE
LVADTQIIEKLADRTIFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGS
DKKRGG
>gnl|bykdb|A6LGY1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides distasonis] (length=807 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLVVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGSLFDSIPTPLGKIIIHTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVMDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFGKKP
QEVKAVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPAKGLSDYLGGRIDNLNEIIVSDPKQKSMDILPVGTIPPNPTELLFDERLKQVIDTVRGQYDYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKRIGIG
>gnl|bykdb|A7ACT5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae ATCC 43184] (length=788 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVDFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|A7AEU7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae ATCC 43184] (length=790 residues).
MNTEQETNIRMEENELNLGDILQTVLANWYWFVLSVVVCAGTAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGSKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVILS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLANKASTIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSHVHVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQHKK
>gnl|bykdb|A7AJ60 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae ATCC 43184] (length=805 residues).
MTEKKTTASKPADDFIRIQDLWGIFMPRWHWFALSLFVTLATAALYLLGTPNIYTRTAAILVKDDSKGGTSTNVVSEFSD
LGIFKSNTNINNELLTLKSPTLMTEVVQRLGLNETYTVRKGLKDVELYKSSPLAVTYRHLDETPVGFTIDISSKETFVIS
DMEVNGKAFGEDFSGKMGDSIRTEIGTLVINFTKYWNDSFVGTSIRYRKGNVCAVTDYYTAALHAELGNEDATIINLSIN
DASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAGYKSEHLLPDVQAASSLYLSQSAE
NKKELLALNSQLSTAQYIRKELNNKKLSQLLPTNSGIANVNIESQIGEYNTIVLERNRLIANSSEKNPLAKDMANSLQSM
QRTIIQSVDNLIVSLNTQIRNIRQQEATTTSQLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMLPTAPRKMNILLVAFAIGLLVPAVIIFMKENMNTKVRGRKDLENLSIPFIGEIPQYLSAKKKLGFDKHTQSV
MKAIVVKEGNRNIINEAFRVLRSNIDFMAGKDSGQNVFMLTSFNPGSGKSFLAMNIAMSFAIKKKRILVIDGDLRHGSTS
SYVDSPKTGLSDYLGNRVSDWKEIIVKDEKYDNLHIIPIGTVPPNPTELLEDGKLATLIEVLRSEYDYIFIDCPPIDIVA
DAQIIEKLADRTVFVVRSGLLDRSMLPELENIYQEKRFKNLSVILNGTESAGGRYGYRYGYRNGYSSYYGNKGKMGGVNG
WSSSD
>gnl|bykdb|A7V4S1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides uniformis] (length=792 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKSEHLLPDVQAASNLYMSQSAE
NKKEIQALTNQLTTAQYIRRELNSKEMNQPLPTNSGIANVNIESQIGEYNKIVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEVATTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSALPMAPNKKNILLVAFALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYSNNKKKKNKSQEKTIV
VEEGNRNIINEAFRVLRSNVDFMKNKNTDQKVFVITSFNPGSGKSFFSVNIATSFAIKGKKVLVIDGDLRRGSISAYVGS
PKKGLSDYLGNRVANWNEALVIDKKHANLHVLPVGTIPPNPTELLEDEKFATLMQILRNEYDYIFVDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLSELESIYLEKRFKNLSVILNGTESTGGRYSYRYGYSYGYHNGYTSYYGNSK
>gnl|bykdb|B0MT10 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes putredinis DSM 17216] (length=816 residues).
MTPNNINPNSANSDTKQEEHITFSVHDLIQTVIANWYWFVISVFVCVGCGYIYILRTPKIYSRTANILVKDSRKGGDTDL
ATLSDLAGLSQRRNVDNEIYILQSRRLMTEVVKQLGLTVQYETKDGLRPQDLYGQSPIAVEFINDNDRQGFRFEVSLRPD
SIVKLNYFEIFGPDKQKFKQEISAVFGDTISTPVGQMIIRPTLYMSPDYYEKAPIRVTKGNLGVVTQFYQHEVKSFVANK
QASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKKDNKIYDIVSE
AEQTITESAQYKTDGLSLENQIRMTEFLKEYLLDPTKTNELIPGTLSINSPAINSQIEGYNTELQRYMKLNSESSENNPI
IQNLGNGLASTRRSIIATLDSYISTLQIQLAALRKEEALTNQRISSVPTQEKQILDIVRQQKIKEELYLYLLNKREENAI
TMVITESNSRTIDSAYGSPRPVSPNTVLIAGIAFLFGLGIPFLIIYLIQILDTTIRGRKDIEDNLSAPFLGDIPQYSGEK
QQGSFVVRENGRDPVSEAFRMIRSNMNFMNLGKGEIKVIMVTSSNPHAGKTFVSTNLAMTFATTGKKVVIMDLDLRRRTF
SKQMGHGGDTNGVSSYLSGSTELQAIIRKSKLSEKLDIIYAGIQPPNPSEMLLSQRMEELIAELKLHYDYIIIDSTPAMA
VADAIITDRLADLSIYVVREGLLDRRQLPDIERLYREKKFHNMAIILNGASSTKRHGYGYGYGYGYGYGLDEEETTTKKG
FWGKLCEWTRNKFQKK
>gnl|bykdb|B0NP84 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris ATCC 43183] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|B0NU19 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris ATCC 43183] (length=792 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKSEHLLPDVQAASNLYMSQSAE
NKKEIQALTNQLTTAQYIRRELNSKEMNQPLPTNSGIANVNIESQIGEYNKIVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEVATTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSALPMAPNKKNILLVAFALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYSNNKKKKNKSQEKTIV
VEEGNRNIINEAFRVLRSNVDFMKNKNTDQKVFVITSFNPGSGKSFFSVNIATSFAIKGKKVLVIDGDLRRGSISAYVGS
PKKGLSDYLGNRVANWNEALVIDKKHANLHVLPVGTIPPNPTELLEDEKFATLMQILRNEYDYIFVDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLSELESIYLEKRFKNLSVILNGTESTGGRYSYRYGYSYGYHNGYTSYYGNSK
>gnl|bykdb|B2RKZ8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis] (length=821 residues).
MNLIEDSKNTLAESRSRIYTKEETSFFSIEEYLLGLLSSWKWIVGSIIVCLLVAYIYTQRQSPAYIAQAAVLIKSAEKSG
APRSMKQFEEIGLFMDNSEVENEILVLKSKRLTAIVVDKLDLDVSISKDGFWRHESLYGKSPVSIRITDRDSTESYSFKI
DIKDSRSFQLSDFKQQKLNRISEIKVEGSFGRPIATPVGELQIDKTIFFADSWKGGILYVTKENIRKVIQRYNKDLQISL
ADKNATIVNLSMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKSNNITDI
STDVGAFLKSNADLQKDQLVVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNDLKLKYDRLKQSSSES
NPLVQEMAMQLVAMRKSINAAVDNYIKTLNLQLREVNREMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKREE
NALRLAITESNAKIVDVADGPSAPIAPRKPLIFMAAFLLGLVLPSTFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYSG
ERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSHDLKAVMFTSANPGSGKSFMTVNLAISIALTGKKVIVVDLDIR
KGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKNRYDYVFLDSVP
AMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYSNKEYDKQGK
KLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|B3JI46 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides coprocola DSM 17136] (length=797 residues).
MMTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESF
SEFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGT
LYLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVID
LSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMA
QSSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQ
ALASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTA
YNTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKK
PQEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHA
SASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVE
LVADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|C3J7R8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas endodontalis] (length=834 residues).
MEYRESETKSIEQELKRPSLVEAASFITLSDIGLILRSNWYWFAITLCVAIGGASAYLLHTPNVYKREASILVKDKMDAS
NVLSELFESSALTSLGGRSAVENELFILKTDFLIDQVIERLNLDVSYSQSRGIRTEMLYKDTPLEVRFVGNSSDVYCKLE
VSSVDASHVSLLCEESSIEAARGTTSQVQIGVPQDTPMGRVLVTATEHFPSSEASFSLEVEKNTRERSIRSFSHIFNVSS
ASKQGSIITLTMQHQNPEVAEDFLNTLVQIYNENSRMEKVRVAQKTEHFIDGRLAIIGGELGSVDTEIEQFKQNNRIADI
QQEARSYITGTAEFARQMTEVNNKLAVANYLKDYLKSPSSKDELIPANVGLNEASADNLIREYNSLLLRRDQLIANAETQ
NPVVETLEKQLASMHVAVVKSVDNLIKSLSVQAASINRQAGLNEGRISSVPMQEKTVGSIYRNQKIKEELYLFLLNAREK
NSLAMEAADSEIRLIQPAMGSSIPVAPRKGMILLVAFILGLILPAGVLYLRFIINNKVRGCKDIKSYTSLPFLGEIPRYE
TQSLHHRIIPKVFRSKESKRHLRQKERYKNILLFNAKERVVISEAFTVVRTNLAYMLHGIESKGKVLMTTSAIPESGKTF
ISANFSSCLASLEGNRVLLIDADIRKASLSDALASYMTQRSKGGLSSYLLGSSTDLSDLIVRIDASSPFDFLPAGVVPPN
PTELLLGDRFSQLIEKVREMYDYILIDSIPFVNVADALITNRVADMTMVIVREGHLPRPLLLEIEALYRSKKLINPAIVL
NDAGAMSGTTGSSYGSYGAYGSYGGYGSYGSYGS
>gnl|bykdb|C3RFN5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides dorei 5_1_36/D4] (length=815 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLVVTIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRKVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGSLFDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVMDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLQQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPVVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPAKGLSDYLGGRINNLNEIIVTAPKQEHLDILPIGTIPPNPTELLFDDRLKQVIDTVKEQYDYVLIDCPPIEL
VADTQIIEKQADRTIFVVRTGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
KTRGVGGVNNWISDN
>gnl|bykdb|C6IJ48 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=787 residues).
MALTEEEKSINIVDLFIYLIAHWKWFVLSILLFGGYFWYSYCETPFVYSRTAIVMIKTPANSRSAMQLNNADFIGQVNVA
SEILQFKSKELMRKVIDRLHADVSYMVRDGLRPRELYTDSPVRVAFLEAGLDEVCSLSVIPKNKQQVELADFSLDELEQR
KTVNLNDTVDTPLGKLIVFTAENYSESYFDRPIKVTSKSREGMVAFWLSNLTIRQMSGDAALLSMTMNDLSPTRAADILD
MLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGMYIQDSRQYESSIKELDTQL
QLVSFIKQYLQDSNKDDELIPSNIGLSDLSIESQISRYNETLLRRNRLVSGSSSNNPVVQELNRIMQTMKQNIYMAVDNL
SKSLRLKKQDYMRQESHVRQKVQAVPGKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARILDPVSGSNLPI
SPNKYKKMILGVGCGIIVPSVILLLILMLDTRVHNRKEVEAVVSAPFLADIPQTAKASVDAHEVVVRARGLDPLSEAFRI
LRTNLGFMLSQAQDHKIITLTSFNIGAGKTFVSVNLAASLVQTKKKVLILDLDLRKGKMSEMAHSKHVKGVAHYLSNPSI
VVDDLILRDAFGEGLDLIPIGVIAPNPTELLLSRRLDELMDRLRELYDYIIVDNVPIGLVADASVVNRISDLTLFIVRVG
KIDRRQLPELERLYQEHKLTNMAVVLNGTKKGSSGYGYGYGYGQGYGYKNAEKKKGLFGRKKKKSRK
>gnl|bykdb|C6VS52 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dyadobacter fermentans] (length=753 residues).
MLTTKGPTNDYPPFQDWANHPLWKAIQFRWYWLVVSPIVSLLLGTAFLRYKTPRYQVTASLMVRDDSRGSDLHETALLEE
LGLPDAAGSVENEIEILKSRTLLGQVVDDLHLTIQYFASGLLKTTELYEKAPYRVRFIQKQPPRPETYHIVRQAGDFYII
EISGSRFRGRFSSPLALPQGVAVIVDTTRFKPSALYQYSFRTLAKETVVDHYARTLSIQAPNKIASMVNLSIQDVLARKG
EAILKQLIVRYQKASIDEKNKVADNTIAFINHNLERVSAELASVETNIEGLRKQHKLIDIAEDTRQALQKLAANTSEERE
WATHLKIVQLLEDHLRKSPSTAIPSLLYPQESNFSALASTFNEMQLNRVKALTTLAPNHPAVTTLDSQIAAARGNLFDAI
HQQKQELALRLASVHAYGKGFHAEIIQIPTHQRALLTHSREQGIQQELYLFLLKKRMETAISRSANIANARVIDPPKAGI
APTFPNPALTILVALFAGILAPISTLYVARILNNKVTSKEDILLHCNAVIIGEISQQKPNSRFTVADSRSLVSEQFRSLR
TNIRFISGARPHTVILLTSAMGGEGKSFVAAHLAHSLALASKSVLLVDLDLRKPSLAQLLKLKNEGITESIASSSKPEIQ
AAGREHSFDFIAAGAPCPGAGEIVLSSHLTGLISSLRCRYDYILLDSPPIGLVADAGVLGSHADMTLYIVRQHFTFLHQL
ADMKRLHEQSLLPDLHVILNGTRDLHRYQYNYY
>gnl|bykdb|C7XEQ8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. D13] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNDQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTDEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|C9KX15 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides finegoldii DSM 17565] (length=789 residues).
MEYIQENERTPKKDEGGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMSAMLEV
SGGITGTSVDNEIYILRSHQLLREVVNRLHLDVGYAKDGILRDAPLYAESPVEVHFIDPYNQPVSFNITPLNTTKFRISD
WKVAGEKGRMQEQDLTYNDTIRTEAGRIVVQLRPENLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCS
DTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQRNQIVDMSANATQYLAESSK
VKEESAQLETELSIARSIKTYLADVTRKDQLIPNVTGVGDVSMQSQITAYNELMLQRNRLKESSGEKNPVVQAADKNLEG
MRATISGSMDNYMKTLRLRLDKAKAVENRLASSIQAVPKQEKMALSIMRQQSIKETLYTFLLNKREENALQLAITEANIR
VVEEPFGSYSPVSPARSSILAAAFIVGLLIPLGVQVIILLLNTSVRGRKDIEEYTTIPIVGEIPARKDSEGDDAIVVSDS
RNDRISEAFRMLRVDLNFIAKEARVLMFTSTLSGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLS
TYLSGLNSNPDTLITVGAFHPQVDTIFAGIIPPNPAELLMNERFDQLIDELKKRYDYIILDNVPALVVADAAIVSRVTDL
TIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGYGQGYGYGYGYGHVNGYYSEKE
>gnl|bykdb|D0MHQ9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rhodothermus marinus] (length=790 residues).
MAHYRHHSLIVARGGQRGGLPPASDEKRDEGRINFAEIWHTIRRGKWIILLTMLVVAGAIGAYTYTLPPVYESSAIVFVD
TRGGGNAPVSVAAFTPIERRALSNELGILRNSAELATRVAEAIVATAETAGAKDRFPILAPAEDGREPSIREIAFRLRER
VRFSPLSDQDMIVITAESTTPEEAAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFARSRQ
VVRLGPQGERLVAEVAQLEAQRDAARFQLEQEKSALQFIEQELQKLEPGLVDELVKSRQVSTLEAQIDALSKKIAELKVQ
AEQYYVFNPKLRGNEEKLGDQQLVEIVRQIDHFEKQREQLQAQLVKEMIGRDSQAPASEPLSYVEQLRARRIEKQLAIQE
LERQVEAFNQELAKYEGQLARLPRQQIELEQLERRRALAEQWYTTFVQELQRIMIAEQSELGYVKIVSSAFVPTVPVRPN
RAQNIVLGILIGLGLGLGLAFLRQAMHTQLDDPEKVREHGYTLLGVVPAMEPYIRKHFRGRKVVEVDERPRSTTLITLLD
PWSPIAENFRLIRTNLQQHTPAKGRAVTWLVTSPEMGDGKTVVAANLAVATAHGGQRTLLIDADLRRPRAHEVLGMADQP
GLAELLLGKIRPEPESWATDIPNLYFLPAGVVDQPPPELLGSQRMVQVLDFLRKHFDVIVIDSPPVLAVTDAVLLAQRCE
ATLMVVSAGRTDAKALDIARQTLESVNVSIAGVVFNRYRADKRKGYAYGYGYGRRYHKGYGYYAREAAAG
>gnl|bykdb|D4IJ36 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes shahii WAL 8301] (length=818 residues).
MAEQQINSQIQTNNEELTNTITLHDIIRMVIANWYWFVLSTVCCLCAAYYYLASTPKIYSRTATILVKDSRKGGDVDLTA
FSDLAGFQNRRNVDNEVFILQSRRLMTNVVKQLNLTVNYSVSDGLRRRDLYGQAPIDVKFINDNDNQSLAMEITPIDDDK
IRLSEFKDQFVTKHESRSVITAAYGDTIPTPVGQVVVQKSLYMAPDYIGVPIRVTKSSLGRTTNAYRAAVKSDVANKQAS
VVTISMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIEDIKKDNRMVDITSEAAR
SVSESSRYKTEGLSLENQINVAEYIRTYLNDPKNVGELIPAMAAAGTNTAIAKQIEDYNSAILRREKLLENSSERSPVIQ
DLDNLLAAVRRSIISSLDSNISTLEIQRDAMRKEETQANIRISTMPSQEKVILGITRQQKIKEELFLYLLNKQEENQLNY
AVAESNSRSIDYAYGSNAPVSPRPMMILGIALIVGLAIPFGLLYLIGMLDTTIRGRKDIEDNVNAPFLGDIPYHEGGGKA
GIVVRETGRDALSEAFRILRSNMTFMSVSAGTDIRTILFTSSDPHAGKTFVATNLAMTLAMAGKRVLLIDLDLRRHALSS
QLGHSNSKTGITSYLAGTVSDVESMIQNSGFHQNLDVIYAGVQPPNPAEMLLSDKLDKLIAEMRGRYDYVFLDSTPAMSV
ADAIITDRLADLCIYIVREGVLDRRQLPDIERLYREKKLHNMCIVLNSTRARRHGYGYGYGYGYGYGYGYGYGDDYKEVS
YRKRIKLFFRSLAHKVKR
>gnl|bykdb|D4V601 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides vulgatus PC510] (length=792 residues).
MIKNRTNTGKPTDDFIRIQDLWGMFIPKWYWFATSLFVALATASLYLLSTPNVYTRTAAILIKDDSKNNSPASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTIRRGLKRIELYKSSPILVTYLFDNKKSVSFDIEVGAQNKFYLS
NFIVAGEETGERFEGIIGDSIQTSAGTLAISLTSQYENFFTGSTIQYSKEPADMVADSYTQKLWAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISSYKSEHLLPDVQAASNLYMSQSAE
NKKEIQALTNQLTTAQYIRRELNSKEMNQPLPTNSGIANVNIESQIGEYNKIVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEVATTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSALPMAPNKKNILLVAFALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYSNNKKKKNKSQEKTIV
VEEGNRNIINEAFRVLRSNVDFMKNKNTDQKVFVITSFNPGSGKSFFSVNIATSFAIKGKKVLVIDGDLRRGSISAYVGS
PKKGLSDYLGNRVANWNEALVIDKKHANLHVLPVGTIPPNPTELLEDEKFATLMQILRNEYDYIFVDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLSELESIYLEKRFKNLSVILNGTESTGGRYSYRYGYSYGYHNGYTSYYGNSK
>gnl|bykdb|D5H561 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Salinibacter ruber] (length=822 residues).
MAHLQRRDPDQNGQGDIVRSWEGGTNGAAGPSSGRQGIKGQIEELLDLLRRRKWLIVLVCLATVAGAALYTYTQVPVYRT
SSLVLVEKGQQSGTESAIGAQAQAQGSGLLPSSSSLRNELMFLRNSQALRERVAERLLEQGEARRVLSSQGVSPFGRLMD
RAWAWAGQGTGGAEGGASGDDPSPVDTTQLSPASVAPALAGRVRFSRAGAETNVIQIVAQDETPAVARRLANLFTEAYIE
LTQKSSRERVKASRTFLEQRSQELERELETIEQRIQRFQRSEDAVSLDQRQGSLTSRIAETESSLEQARIELRMEQSSLE
SLREELESIQPGQLSDQLASTVDQEISSLQSEIAKLELSKQQLELQSGAPTPADSAQAAQIDRRIQKLRARIQRLSDRYV
EELMGGGLSPKQGAQRINELKRRIAEKKIQITGLNSRIDVLSERLSEYEQELNAIPGKSMTLAQLRRDQKYAEQMYGFVT
KQLQQVRVREKSELGYATQISEAGMPGIPVRPQPRRNLILGLMLGLLGGGGLALLRDQMDNRLYKPDQIRDMGYHGIGVI
PNLTPLIEDQMGGQATVERDGHQLETGLVAALKPYSAATEAYRKVWTNLQLGRPDGESGTVLVTSPGSGDGKSLTAANLA
AITAQAGHATLLVDGDLRRPRLHEIFDVSRAPGLTETLQNDLEEHAMKRPLDENLCVLPAGTEVESPAKVLGSARFREFL
GEAQQYFDHIIVDSSPVLATADGPMLSDLCDTTLCVARAGATTEDELHDALEVLGEVGADVAGVIFNGFDISMAYGYKYR
YRHYGRYGPYDQYRSLPEDATA
>gnl|bykdb|D7INX6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 3_1_19] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTDEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|E2NMQ4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus DSM 14838] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDAFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKTIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTIPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|E4M8L3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. HGB5] (length=819 residues).
MTEQNINPHLLNEESENTNGITLHDLIQMVLANWYWFALSAIICLGTAYYYLASTPKIYSRTATILVKDSRKGGDTDLGA
FSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVREGLRTADLYGRSPIEVDFINDNSKQKLSLEVTPLRNGK
IELTDFEDKFVTRQETKRVILAEYGDTVATPVGQVVVHKTLFMDSTYLKKPITVIKNSLAATTNAYRAAVKSDVANKQAS
IVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKKSNKMIDITSEATR
TITESTRYKAESLTIENQISVADFIREYLNDPSHAGDLIPMVASMTNNGIVAQISEYNEAILRREKLLENSSERSPVIQD
LDNGLAAVRRSIIASLNSHISTLEIQLETMRKEEAQVNRRISTMPSQEKVMLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDMAYGSARPVSPRSTIILGISLLAGLAIPFGILYLIGMLDTTIRGRKDVEENLSAPFLGDIPFLEGDNKGG
VVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLAMAGKRVVLIDLDLRRHALTTH
LGRSNSKNGMSGYLAGTITDIDQLVTNMGFHENLDVICAGIQPPNPTEMLLSNRLDKLVEQLKERYDFVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFHNMCIVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYGDDHQEV
SYRKRIKLFFSKLARKVKK
>gnl|bykdb|E4TQD2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Marivirga tractuosa] (length=790 residues).
MSNQQTRYQRNLEGNTSQKPQNQESEVVDFYKLKTILKKNLPWAILLIAIAVFVAFIYVRYTNVKFQSYAELKLNKRSEA
SVFGFNPLKEENSNLNTLSGEVELIRSKLFLKQVIDKLPLDVSYHVIGRFKNEERYRFSPFTVSYEKSCANYDQKFYVDI
IDKENFKLTTNPDEDQWINQKFGEYFTFNGCGYKLETTPHFFNTERLFFTISTPESLINYVESNLSVAPENLNANTIKIT
FEDYNPYKVQAIVEQVSELYTKYSKEQKNKANQLKIEFLNKQLKQTENELSNYETYIEEFTIKNKTVNPSQDVSRLISEM
VSMDSILYGINYQLAEINNIQSQLDKDTLSFDKINYLVLPSNMQPLFEEFSELKRDYQMAKTRYKKESQVLLQRNLEINA
LKDRINNYLNNKVEILQDRKSTILNRKREIENKFNQLPAKTNELNQKMRFYSLYEELYLSLMQKKTEFEIAQAGTLSEVD
ILTPANLPKDPIGPSTNLIYIGSFAVGFILSFIFIGLRYLLYDEINSIHELERLTNIPIIAKISRLKRYVAKKSGVIVSE
KPRSQISEAFRTLRTSLDFIGIKDGKKVISISSTTSGEGKTFISVNLAAILAMSSKKVIILDLDMRKPRAQYAFNLEQNE
MGISSILSGGIHWKECINITKTENLHFIPSGILPPNPAELLEGDHFSQLLNELKQEYDIILLDTPPIGLVSDGIIALKKS
DHSLFVVRADYSKRSFIDDLHRSLNLNNIQNISIIFNAVKKENKGYGYYQDYYNDNGSRSISTLKRLFNI
>gnl|bykdb|E5UZA2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. 3_1_40A] (length=796 residues).
MTVNQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAVTIGAATAYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFRSPSLMTEVVKRLRLDMNYFVRGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEIQPDGTL
YLSDFIRNGTDLEEKDVKGSLLDSITTPLGKIIIHTTPNYVKGEAYTLYVGKSSLYNAVNSCSSNLSVSLNSEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSAANAQILSLNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLENLTIPFIGEIPLFTRKKKGILGKKP
QEVKAVIVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTVFVVRAGLLERSMLAELEKIYEEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYH
>gnl|bykdb|E5WX00 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides eggerthii 1_2_48FAA] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|F2IKD6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fluviicola taffensis] (length=787 residues).
MNNSNTSIFINKDYNPIIAQVILRRYWWWVLLLIIFFMSVAFFYLRYTKPVYDSTTLIQLVEKDQGKQLLEIDNINKRID
ISTEIELLRSQLLFDMTIARMNMNVSVFSKGKILTEEKYHQNTFTILPYSLSDSSLCDIPIWIETLENRKIRLSYSLLGR
NYSKVSAINQTIKTSHFEIGFKVNNWQSLKQEDVSNDLYFTFNNQKNLAARLISNLEVNPVDANAKTIELRYTGNNPELC
RDIIKSVSLTFFNYDEEMKRKGADNILAFIQIQLDSISGELKDSKDSLTDFQRKSHLTDPEGTGGSLSENMDKFQDILFD
LENELTTLKVVNSKLKTEPNRLDIYRLIPEMLGKSYESSLTKQITDLNTLLERKEELLTNVTENNSELKNLNTRIQSKIQ
YIRRSIEVIQERIRSQVQVISGKIGEIEGEYIKLPQKKMEYNRLKSLQDLNEKYYTLLTEKKVMYSISNAGYTSSNRVLN
EASLSSIPFSPNRKMVYASFIFIGFVFGIGFLFIKYITFNEINTIEDLKNLLPDKITILGNIPQLKETSEYSQLMVHSSP
KSILAESMRNIRTNLSFVNPNAQVIAISSSISGEGKTFVALNLAGIISLSGKKTIVIDLDLRKPKVHLGLNVSNEAGISN
LIVKQAELDSCIRKSEIDNLDFITAGPIPPNPSELILSDSFFEILEELKSRYDIVIIDNPPVGLVTDGVQILAKADIPIY
IFKAHYSKRIFAGRVRELFEMNQISHLNIILNGTKNFKGKYGYGYGYGYGQGYYEEENKKKKKGRSS
>gnl|bykdb|F3PXM2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fluxus YIT 12057] (length=793 residues).
MIENKNAVGKPADDFIRIQDLGSMFVPRWRWFALSLAVALSAAALYLLRTPAIYTRHAAILVKDDSKGGATSGSMGEFAD
FGLFKSNTNINNELLTLASPTLMTEVVKRLGLDETYTVRRGLRRVELYRSAPVAVRFCGKAERPVAFDLELTSRNDFLLS
GFKVEGEETGETFSGKTGDTLRTSVGTLLIDATPYATDDFMGTSIHYGKQSVQAVTDYYTGALRAELGNEDATIINLSID
DSSVWKAEDILNTLIEVYNEYWIRDKNQIAVSTSQFIGDRLGVIENELGHVDANIAGYKSEHLLPDVQAASSLYLMQSAE
NKKELLALNNQLSTARYIRGELNGKGLTQLLPANSDIGNSHIESLIGEYNAQVLERNRLAANSSEKNPLVVDLTASLRNL
HHTVVQSVDNLIVSLDTQLQSVRRREAATTGQLASNPDQARYLLSVERQQKVKEQLYLYLLQKREENELSQAFTAYNTRI
ITAPRGSLLPTAPRKFNILLAAFAVGLLLPAVLIFMKENMNTKVRGRKDLEGVTVPFIGEIPLFVRRQKKWFGKAPETNT
IVVKEGSRDIINEAFRVLRTNLEFMTDKGGRSNVIVFTSFNPGSGKSFLAMNISVSLAIKGKKVLVVDGDLRHASASAYI
GSPKVGLSDYLNGRVAHLDNIIVKDPERKLPDVLPVGTIPPNPTELLFDERLRQVIDTVRTQYDYVLIDCPPVELVADTQ
IIEQLADRTVFVVRAGLLERSMLAELENIYSEKKYKNMSMILNATIGGGGRYGYSYGYRYGYHYGYGYHYGSN
>gnl|bykdb|F3ZRU7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides coprosuis DSM 18011] (length=787 residues).
MEQQNLDNKIQQEHTEQEIDLVEIGTMLMRHWLWYIVAVALALVLGFLYIKSTPKTYERHASVLIKDDKASGGANMQGVA
ALTDLADFGLKSSVDNEILIFQSNSLLREVSTRLSLNTTYSVRQGLRKKDLYGNNPFEVVFLEASTEQPIQLKGKLKENQ
VQFTDVKTWTGGEEVELPHFSVQLNDTVDSPLGLLLVKTTGLGKAYEGETIQIHHRGLKNVTLGYGNAIQIALADKKATI
INLSLRDEVPQRAEDILNTLIDVYNEEAINDKNQMAMNTSEFINERLIIIEKELGGVDTQIETFKKTEKLTNITSDAEMF
ITETTGLKKEELEVLNQLSLGQYIKDYLIDPANRGKLIPANTGISDNTTEGQIKEYNTMLLQRDRLLSNSSDKNPVVSDL
NKSLFAMEQTINRSVDNVISGLNLKLKNIRARDKQTNQRIEAVPSQEKYVLSVGRQQKIKESLYLFLLNKREENALAQAI
TQSNARVIDSARGSDQPVAPRSMMIMAGALFLGLLLPTGVILVLTFLDNKVRTRQDIEDKLDIPFLGEIPLLNDKGEEDL
VVEEHSRNAVSEAFRIIRTNLSFMEQNKEQKVLSFTSLTPDSGKSFVAVNLAMSLAMAGKKVVLLDLDIRKGQLSQRLGS
DHMQGATNYLSGGVEKVKDVVYQSIYHPNLFYIPSGPTPPNPAELLLSKNLDAMVEELRKEFDYILIDSVPAMAVADAAI
TNRVVDRTVYVMRAGILDKRSLSLVDKIYRSGKFKNLCIVLNGVKPTKRSYGYGYGYGYGYGYENED
>gnl|bykdb|F4KK08 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas asaccharolytica] (length=834 residues).
MEYQTASTQQEPIRSSEEVSTFSLRDILMILKANWLFILLSFLVCLALGFLYIKSSSHQYSRSASLLIKSETSINSAIER
LAQFTGDKHSYSDDVSNQIIILGTERVVSETVRRLGLDVQYHYDAGLREKDLYKQSPVSIRFVNADPDEKISLRIKSDKE
AHNQVILYDIKSSLIGKVQEPIAATLGDTIATPIGKVVVEATPYYSNFPNYEVLKVQKDNFNAVVRNYMKALQVSLQQKD
ASVIKLTIQAGNPLLAEDFLSTLILVYTELERSDKVKIAESTQRFVDDRLAIISSELGQVDAEIEDFKQSQQIADIQAEA
QEYIKGSSEVKTRLVELNNSISIAQFVRGHLKDKNQMESLIPANVGIASPSIEAAIAKYNEFLLKRDQLQANSSSQNPLV
QELNTQLAAQRLSIITSIDNLISTLEVERQGILSEQSSYKGRITSVPMQERIVGSIYRQQKIKEELYLFLLNVREQNALS
IEAAESNARLIQTPTGPTEPVSPRAPIIMLAAGLLGLLIPMGILYIRGIANNKIRGKADIERYTSIPVLGEIPHYKASKK
HIKQVEEQIKDQLVGLSSKERNEIIDQAARMFIVGHHRRSVVSEAFTVVRSNISFLTPNSTQQVKRIMITSAILGSGKTF
SSSNLALSLAQAGSRVLLIDCDLRKNTLSKAIGMHRSGLDGLSTYLSDSKVDPQKIICPTTVADSLFFTPSGPIPPNPTE
LFMSPRFEALLDYADKQFDYIVLDTIPVLNLADTRVISPLADITIMIARENHLPRRLLPELETLYRERLLKGLSIVVNDA
GVGASSYGYGYGYGYGYGYGYGYGSESEHDSKSN
>gnl|bykdb|F5IU11 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas gadei ATCC BAA-286] (length=790 residues).
MKKNTEEDFIRIQDLWKMSVEKWHWFVISLGICLISASLYIAITPPVYTRMAAVLIKDNSAKGGMLSDNINTFSDMGLFK
SNTNINNEILTFKSPLLMREVVQRMKLDEDYSIKGFFRNRSLYKNSPVIVSTGPVNVNESFSFQIELLSQNKIRLSDLIL
NGEELDFTDKEINLSEPVNTPLGNITIHPTAFYSKGYYDQKILFTKFNLRGIVNNYTNALNVGLSNENATIINISLNDVS
AQRAEDVLDTLITVYNKNWIQDRTQIAVNTSSFIEERLNVIEKELGGVEDSISRFKSQNLIPDIQAASNLYMVKSNENDT
KIQALNTQYTIAKYILSHLKNPRTKDILLPANLGIEGANIEGQINEYNTLLLKRNTLQANSSDNNPLVLDMKQSLLFMRE
AIISSVDNLLVTLDTQIKHTQKSETKINERIASSPEQAKYLLSVERQQAVKEALYLFLLQKQEENQLSQAFAVYNTKIIT
PPSGNMSPATPRKTSILLVAVAIGFLLPIIIIIIMENMTITLRGRNDLSSLSLPFVGEIPQIMNGKKALLLKSKSTKDRD
DIIVREGKKDYMNEAFRVIRTNLDFILSTNGEKHQKVIMFTSFNIGSGKTFTTINLAISMAIKGKKVVVIDLDMRKASLS
SYIDSPSAGISNYLGKMIDNTDQIIRKGAIHPNLDIIPAGTIPPNPAELLLDDRLQELLDELREKYDYIFLDCPPVEIVT
DASIVGKVTDITIFVVRAGLLDRRILPEIEEIYQKGQYNNMTVLLNGTQYMQGQYGYNRYGYTHADNYLA
>gnl|bykdb|F8X3A5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Dysgonomonas mossii DSM 22836] (length=804 residues).
MTSVQHNKTERKQTEDLIRLQDLLYLCLFRWRWFVISLFITLSIATFYILTTPPIYIRSASILIKEDSKSQSISSDVASM
FADFGLSQPNTNVNNELIAIQSPAIILETVKRLHLDVNYQIKDAFYKKVLYGPDLPITVSFTDLADNESAELIIKLLADG
TFECSDFACDNKDIANNVIKGKLNDTIDTPLGKIIVFPTSYYTKTEMPLIYISRTNLYSATDLFKQNLTASLSEEKATVI
DLSYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISSYKRQNLVPDVDAASSMYM
AQSRETSNLMLDLNTRLSMARYMRNHLMTSTNNNQLIPANSGIESASVENQITEYNTIQLQRNNLVSNSSEQNPLVVDLD
QSLQSMRKAIVSSIDNLTVSLNTQIKNLQSNEQETTAQIAANPDQAKYLLSVGRQQKVKEALYLFLLQKREENELSQAFI
AYNTRMITPPYGNLNSIAPQKRNILLVAFVLGLLIPLVIIFIRENTNSTIRGRKDLDNLILPFIGEIPLFYPPKRGWRFW
KKQPDESKVVVKEENRDVINEAFRVLRTNLEFMTAKKDNLNVIILTSFNPGSGKTFLTINMAISLAIKGKKVLVIDGDLR
YGSTSSFVNSPKQGLSNYLGKQIDNINDTIIVDEKYTNLSILPVGTIPPNPTELLFEERLEILINDMRGKYDYIFIDCPP
IDIVADTQIIERLADRTLFVVRAGLLERSMLSDLNNIYREERFKNMALILNGTTSSIGYHKYGYRYGYQYGYYGFNSQTK
KRGK
>gnl|bykdb|G2SF81 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Rhodothermus marinus SG0.5JP17-172] (length=790 residues).
MAHYRHHSLIVARGGQRGGLPPASGETRDEGRINFAEIWHTIRRGKWIILLTTLVVAGIIGAYTYTLPPVYESSAIVFVD
TRGSGNAPVSVAAFTPIERRALSNELGILRNSAELATRVAEAIVATAETAGAKDRFPILAPTEDGREPSIREIAFRLRER
VRFSPLSDQDMIVITAESTTPEEAAVIANRYAEEYERYSRERSRESLAAAREFVEKQVEQRRQELEELERQWEAFARSRQ
VVRLGPQGERLVAEVAQLEAQRDAARFQLEQEKSALQFIEQELQKLEPGLVDELVKSRQVSTLEAQIDALSKKIAELKVQ
AEQYYVFNPKLRGNEEKLGDQQLVEIVRQIDHFEKQREQLQAQLVKEMIGRDSQAPASEPLSYVEQLRARRIEKQLAIQE
LERQVEAFNQELAKYEDQLARLPRQQIELEQLERRRAMAEQWYTTFVQELQRIMIAEQSELGYVKIVSSAFVPTVPVRPN
RAQNIVLGILIGLGLGLGLAFLRQAMHTQLDDPEKVREHGYTLLGVVPAMEPYIRKHFRGRKVVEVDERPCSTTLITLLD
PWSPIAENFRLIRTNLQQHTPAKGRAVTWLVTSPEMGDGKTVVAANLAVATAHGGQRTLLIDADLRRPRAHEVLGVADQP
GLSELLLGKVRPDPESWATDTPNLYFLPAGVVDQPPPELLGSQRMVQLLEFLRKHFDVIVIDSPPVLAVTDSVLLAQLCE
ATLMMISAGRTDAKALDIARQTLESVNVSIAGVIFNRYRADKRKGYAYGYGYGRRYHKGYGYYAREAATG
>gnl|bykdb|G5GD56 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alloprevotella rava F0323] (length=817 residues).
MSGSVQNKNKEEDIQLIPLFKMCWALFLANLKWFVLSVILCLVLGYLYQARQSRVYQRQAVILFEDNESGSGGGMSRSAR
NNGLNTLMQLNGISVGDNLKNEMFILTSERLMTRVVDSLGLDVDYTTSAGLHSVALYTDRPFEIAFQQKAENLVRFEAKI
QADGTVKLSDFVCYNRSTGKKKIFKEHLSVRPGVMVKTPIGDLAINKTTFFSRFPVGKTIQIHHLPIEMAAKIYQEKIKA
SAYDKETSLVVLSAQDINTARAEDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQVENRLASFKQQNRVI
DFQQAAGTVTAQSADARQQALQLETQLSVARYLQEFLQNNSNEHQIIPAINLERATFNGQIDTYNQLMNERNKNAANSSG
QSPLVRDLDKQLAAQRTSILSSVRSYVRSIEMQVNAARSNEKSLMGQVGHAPQAAKEALDIQRQQNLKETLYTYLLNKRE
EVALQLAINEANVRMVENPLGPSSPVSPRKMIIMLLAFLIGLVIPAVILWVRELFDITISGRQDVEGVVTAPVVGELPRW
DSPSEDALITHCAANDPIVEAFRMLRFSLSFVRRTAKVIVVTSTTPHHGKSFISRNLSVVFAMANKRVLLIDADIRKRTL
SGDFGRTAGLTSWLVDEDGQTCLEDIVVKDGLTKGVDFLPAGILPPNPAELLMSGRLEELVAIAREQYDFIIFDTTPIFG
VADASIVDRVADLTLYVLRVGVQEKAFLPELEKMYQDKKMRNLCLVLNDSDVKSRKTGYGYGYGYGYGQYGYGYGYGYTK
ERKKQKLGRGLLGKLRK
>gnl|bykdb|G8TRZ6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Niastella koreensis] (length=811 residues).
MQTNINSKSKSEKNIGSLIINWYLPYWPLFLILTVVGLAAAWAYINFVAVKQYESYATVMVKDNKKGVDESGAMEALQVY
PMQNIAENEIEVLQSKTLMTDVVNQLHLYAPIYEGIDFSQWKFNETSAYISSPVSIVARNPDELTETGDTDIAIAVNYYS
PKEMQVAHNGYKDKVKEVVIENKKYPLREWCQTRWGVVKFMPNERQTSKPVGPLFFNLNKTKDVVPGLLLNLLVVSPNKL
SSTIDLTLRDEIPKRGEDILNRLLTDYTQQSIDEKQDQATNTLNFIEVRLGKVERELDSIESVVQTFRTDKGVVDLGEQG
KMYLDNVGDNDRKIADLSMQIAAVDEMENYVNQKSNTGDLIPSTLGIADPILSDLMSKLYSKRVEYESLLKTTTVNNPAA
TSAAKEIEALRPLVLEKLRNYRISLEAGKRNLASTSNDYNSMLRTIPQKERELMAISREQATKKGIYSFLLEKREQTALA
SSSATSDSKIIDFANSSILPVSPKKLLTYFMALALFGGLGVGFVSLKEMMNKRILFRSEIESLTSVPVIAEISATKDKES
LLKSTSRVSIVAEQFRHLRASIGLFGRKKEIKIKRILVTSSVAGEGKTYISTSLATSLALAGNKVVLVDLDIRKPRTSAI
MGIDQQAGVAEFLDGAKTPEEIISTTEVKNLYVVSAGRGEEHSRELILSGRLDILIDYLNDTFDYIVLDASPIDPVSDSY
TFSGFCDITLFIIRHNRTPKTMVQILDNNNKFKALKNPRIVFNGIRSRGVMKKMYGYSYGYGYENVYRDREKRSKFQKIF
HFPKKDKKIRV
>gnl|bykdb|G9S1S8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tannerella sp. 6_1_58FAA_CT1] (length=802 residues).
MAAVQNNPKSKQSEEFMRIQDLLYLCASNWYWFALSLMITLGAAFLYIKVTPPVYTRSASILIKEDSKGKSLSADAGSFA
DLGLIQANTNVNNEIISLQSPAIMTDVVKRLHLNMDYHVDGGFYREMLYGRTLPINVSIDTPDNNESSALTVKILADSTV
ELSDFIRNGEELPGKLLKGQLRDTIMTPVGKVTICPTPYYTSQFSQPIYVSRSGLYSAVRRYAPNLSVVLNDEKSTVVDL
SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKSEHLLPDVQAASSMYMAQ
VSETDAQLLALNNQLYMARYIRNYLGGESNKYQLLPANSGIENSNLGDQITEYNNKLLQRNSLVANSSDQNPLVIDLDHA
LAAMRKAIVASIDNQVVTLNAQIKNLERSGQQTTTRIAESPAQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAY
NTRIITPAGGSMLPTAPLKKNILLVAFVAGLLMPAIVIFIAENMNTKVRGRKDLENMTIPFVGEIPLAYHQDKQGSIFRK
KKLPETHTIVVKEKSRNLVNEAFRVVRTNLEFMLGKEGQSRVIMVTSANPGSGKTFITMNLAKSLAIKGKKILVIDLDMR
KASLSSYVDSPRIGISNYLSGQVENFSEIIVKGKVYPGLDVIPVGTIPPNPTELLFDLRLEQMLSTLKTEYDCIFIDCPP
VEIVADASIINKLSDMTLFIIRSGLLDRSMLYEIEGFYTDQRYKNMAVILNGTSEAYGHYGYRYGYRYGYNYGYGKGYSE
EN
>gnl|bykdb|I2GTA4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fibrisoma limi BUZ 3] (length=772 residues).
MNNQFNHSYVPYKMMEPEELRVSDLLPKFTRNWPWILFSVCVFLVAAYTYLAYKQPIYKTQASLLIQDEKKGNERDQPLK
ELDAYVPKKVVENETEILRSYTLMNRVVDKLHLDVRYFEKTAFGKREIYKASPVEVFIEFGKPELYEAPMLLTFIDSSSV
EINEQVYPLNQRIKTPQGRFLIKTRRAVGDTTNQVLVQAMKRPAAVNGYLKTLQAEPTSKASTVVVLTLEDAVPEKGEAV
LNQLIEEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTAVEKEVERYKATQGITDLSTQSASFLQAIQQNDGLLNQVNI
QLTTLSDLQRYINNRSLDRSATPALVGLNDPVLFSLIEKLTQLDLQRSQLVRTTSEQNPLIQTIDTQINSLKGNMEDNIR
TMKTMLMSSQQQYRAKNAQLESSIRTIPQKERTLLTISRQQAIKNNLYTYLLQKREETAVSHASAISDSRTIDVAQSTDA
PIKPVPLMIYGLFGFLGFIIPIGIIGSRELINTRVTRRVDVEKITQAPIIGELTRKQEPDYLVVTMTNQSLIAEQFRTLR
ASLPDIQSDKSQVLLLTSSISGEGKSFISLNLGASLALVGKPTVILDMDLRRPRLHKEFNWSNTTGISSYLTGKCTVYDI
LKPVPGYDNLFIIPSGPPPTNPSELLSGQPLKQLIAQLREHFDNIIIDTAPIGLVSDARLVAPLADMSFFVVRHDVTPKN
YLRHIESLFREQRFKKLNIILNAIDKDESYYYAKMYSYTSNLLGKKKWLSFS
>gnl|bykdb|I3YQ50 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes finegoldii] (length=819 residues).
MTEQNINPHLLNEESENTNGITLHDLIQMVLANWYWFALSAIICLGTAYYYLASTPKIYSRTATILVKDSRKGGDTDLGA
FSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVREGLRTADLYGRSPIEVDFINDNSKQKLSLEVTPLRNGK
IELTDFEDKFVTRQETKRVILAEYGDTVATPVGQVVVHKTLFMDSTYLKKPITVIKNSLAATTNAYRAAVKSDVANKQAS
IVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKKSNKMIDITSEATR
TITESTRYKAESLTIENQISVADFIREYLNDPSHAGDLIPMVASMTNNGIVAQISEYNEAILRREKLLENSSERSPVIQD
LDNGLAAVRRSIIASLNSHISTLEIQLETMRKEEAQVNRRISTMPSQEKVMLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDMAYGSARPVSPRSTIILGISLLAGLAIPFGILYLIGMLDTTIRGRKDVEENLSAPFLGDIPFLEGDNKGG
VVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSAPHAGKTFVAMNLAMTLAMAGKRVVLIDLDLRLHALTTH
LGRSNSKNGMSGYLAGTITDIDQLVTNMGFHENLDVICAGIQPPNPTEMLLSNRLDKLVEQLKERYDFVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFHNMCIVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYGDDHQEV
SYRKRIKLFFSKLARKVKK
>gnl|bykdb|I4AFR0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bernardetia litoralis] (length=832 residues).
MSDFDENPFINTVPTAETSNEENMLADFDVSKLIRVVKKNIIYVILLLIICVAASWVVLRYTHRIYNSSSTLKLEMKGTS
ELLGKGIFASDENAINFLSGEIELILSRSVYEEAVKKLDLSVSYFVKGRWWFNYFERFQDSPFEVTDYEVYDNSFYNHPL
NIQIIDEEEFVLTYETPTGDNFSKIYKFNTRIKNQYFTLIISLNNTFDKLQSPSSNYFFTLNSHEYQINYIASSIKANVV
NPKAYTIQISFTDNNPYKAAIITNTIVDIYFEKTLENKNKVYKQTIDYLDAQTTIVQDSLEQVEKRMDDYKLENGITSQN
PQEYQSLVQNILNDIRDLQAKRLDIDNELKLYKEISTLLENDSTLLIALTYSTILKEPSLKIRLEEVYEEEKEKKFMLDR
VTKQTGAYQQKAKRIDLLKKEVDKFITLHQRLIYEQLSEITINIYKLQSSIPSSASEIDLELKKMMRYQNSYQQNYNILL
GKFIETNITMSGTVTNYQRLATAVPGKAPIYPEPQLFYIYGLGAWLVLSVLLIGFTYIRQNKIDSLTELEKLSSVPILGM
IPKYTKPMDYSQLIIHKSPKAPISEAFRSLRTNLDFMGNISNDSIISVTSTTSGEGKTFIAVNLGGIIALSQTKVVLLDL
DLRKPKVHLAFGVENTRGISTLLVGKTSIDEAINHSEIPNFDFITAGVQPPNPSELIMSDEFKDLLKELKLRYDVIVFDM
PPVGLVTDGIIAMRLADLPIYVVRTGYSQRSYIKGINRLHQVQNFKKMSIILNAATKDTGNGYGYGYGYGYGYGYGYGYG
YGYYDEDDSEKMALSKKAKKWWYKTKRKLSKK
>gnl|bykdb|I8VXH0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus CL02T12C19] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKIEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDVFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKTIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTVPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|I8Y597 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salyersiae CL02T12C01] (length=824 residues).
MSIESQNSELREKESEISIVDIFHLVIANWYWFVLSILICAGIAFFYLKSSSKVYSRKASVLIRDDSKGGSISESTAFAD
ISFLGGKRNVDNEVLVFQSRHLMEKVARRLHLDMSYKVKNGLREDELYTHSPITVLFPESEERQVIEMTVTPVDSATVRL
SDFSLSIAGEEIRSAEVVDARLNDTISTPVGTMVVTPTLYYTDTYYGKPVYITKSNMEKVVEGYLRRINISLASKTATII
NLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKRENQLTDITSETGMYL
QNTSRYKQEGLSLENQLSIVKYIKEYLVDPQKGSDLIPANTGISDNSVESQIKEYNDMLLKRDKLVAGSSNKNPIVIDLN
NSLGAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPTQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDPASGSSVPVAPKSMMILLAAIVLGGTIPMGVLWLLNVTDTKVRTRKELDNVLTVPFLGDIPRHGTRKGEDTD
AIVVHESGRDSVSEAFRIIRTNMEFMRVKSDNLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSGI
FSNPSGRMGLTHYLSGHTDNLDDIIGVSEEYDKLDIVFSGPVPPNPAELLLSERFDYFISELRKRYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGVMDRRQLPELEKMYREEQLRNMSVILNGVSSERRGYGYGYGYGYGYGYGYGYGYGYGYGNE
HHENKQRENIRRIMNKLTGFLKRS
>gnl|bykdb|I8YFS5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salyersiae CL02T12C01] (length=816 residues).
MSIESQNSELREKESEISIVDIFHLVIANWYWFVLSILICAGIAFFYLKSSSKVYSRKASVLIRDDSKGGSISESTAFAD
ISFLGGKRNVDNEVLVFQSRHLMEKVARRLHLDMSYKVKNGLREDELYTHSPITVLFPESEERQVIEMTVTPVDSATVRL
SDFSLSIAGEEIRSAEVVDARLNDTISTPVGTMVVTPTLYYTDTYYGNPVFVTKANMEKVVEGYQSKMKISLASKTATII
NLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYKQEGLSLENQLSIVKYIKEYLVDPQKSSDLIPANTGISDTSVEAQIKEYNDMLLKRDKLVSGSSNKNPIVIDLN
NSLGAMKQTIIRSVDNLIVGLNIQLKNIRDQEEQTTKRIEAVPTQQKYVLTVERQQKIKEELYLYLLNKREENGLTLAIT
ESNARIIDPASGSSEPVAPKSIMILFAAVVLGAVIPMGVLWLLNVTDTKVRTRRELDDVLSVPFLGDIPRHSTYKDENAD
AIVVHENGRDSVSEAFRIIRTNMEFMRVKSENLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSGI
FSNSSGRMGLTHYLSGRTDDLNDIIGTSEEYGKLDIIFSGPVPPNPAELLLSERFDHLIAELRKQYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGVMDRRQLPELEKMYREEQLRNMSVILNGVSYERKGYGYGYGYGYGYGYGYGYGNDTHRHKR
GKLESIKRTVFRFLKR
>gnl|bykdb|I8YFZ3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salyersiae CL02T12C01] (length=815 residues).
MSAEYKNNDIRKQESEINITDIFHLILVNWYWFVLSVLVCGGVAFFYLKSSSKVYSRKASVLIRDDSKGGGMSESAAFSD
LSLFGGKRNVDNEVLVFQSRHLMEEVAHRLHLDMSYKVKNGLRNDELYTHAPVTVSFPEAEERQVIRVVVTPVDSIMVRL
SGFSLAVGGGEVHSEEVLDVRLNDTVSTPIGPMVITPTLYYTDVFYGRSVNVVKFNMESVVESYRNKLKVSLASKTATII
NLVLDDVSIARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIENFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIVRYIKEYLTDPQKNSDLIPANTGISDNSVESQIKEYNDILLKRDKLVVGSSSKNPIVMDLN
NSLSAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTSKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDSASGSSAPVAPKTMTIFLASIVLGLAIPMGVFWLLNVTDTKVRTRKELDEVLTIPFLGNIPRHGSNKGEDSD
GIVVRENSRDSVSEAFRIIRTNMDFMRVKSEKLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLLDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKLDDIVGRSEEYDKLDVIFSGPVPPNPAELLLSERFDRLIAELRKRYDYVIVDNVPAGMVA
DASIVNRVADLTIFVIRSGVMDRRQLPELETMYRQEQLRNLSVILNGVPSERRGYGYGYGYGYGYGYGYGYGNESHSHNR
KRKSLKNLFSRLLKQ
>gnl|bykdb|I9GXM2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides nordii CL02T12C05] (length=819 residues).
MNTEYKNNDVRKQESEINISDIFYLVLANWYWFILSVLVCGGVAFFYLKSSSKVYSRKASVLIRDDSKGGGMSESAAFSD
LSLFGGKRNVDNEVLVFQSRHLMEEVARRLHLDMSYKVKNGLRNDELYTHAPVTVSFPEAEERQIIKVVVTPVDSVTVRL
SDFSLAVGGGEISSEEVLDVHLNDTVSTPIGPMVITPTLYYTDVFYGKPVNVVKSNLESVIEGYRGRLKVSLAGKTTTII
NLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIAKYIKEYLTDPQKSSDLIPANTGISDNSVEFQIKEYNDILLKRDKLVVGSSSKNPIVMDLN
NSLSAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDAASGSSAPVAPKTMTIFLASIVLGLGIPMGVFWLLNVMDTKVRTRKELDGVLTIPFLGNIPRHGNKKGGDSD
GIVVRENSRDSVSEAFRIIRTNMDFMRVKSDKLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKRVVLIDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKVDDIVGTSEEYEKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGVMDRRQLPELENMYRQEQLRNMSVILNGVPSDHKGYGYGYGYGYGYGYGYGYGYGDENHDH
KHGKCKSLKNLFSCFLKRS
>gnl|bykdb|I9Q4U4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus CL02T12C19] (length=788 residues).
MIENRTSVGKSAEDFIRLQDLWGMFFQKWYWFALSLFVALATASLYLLSTPNVYTRTAAILVKDDSKNNSSASAMNEFAD
MGIFKSNTNINNELLTLKSPTLMTEVVKRLGLNEIYTVRRGLKRIELYKSSPILVTYLFDDKKSVSFDIEVGAQNKFYLS
NFIVAGEETEERLEGIIGDSIQTSAGTLAISLTSQYENSFTGSTIRYSKESADMMADSYTQKLRAELGNEDATIINLSID
DASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISNYKSEHLLPDVQAASSLYMSQSAE
NKKEIQTLTNQLATAQFIRRELGGKEMNQPLPTNSGIANVNIESQIGEYNKMVLDRNRLIANSSEKNPLVKDLGNSMQSM
KRTILQSVDNLIVSLNTQIRSIRQQEATTTQQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRM
ITAPRGSALPTAPNKKNILLVALALGLLVPAVIIFMQENMNTKVRGKKDLENLSVPYLGEIPLYFRNKKKKNKFSEYAIV
VEEGNRNIINEAFRVLRSNVGFMKSKNTEQKVFIETSFNPGSGKSFLSMNIAMSFAIKGKKVLVIDGDLRHGTVSAYVGS
PKKGLSDYLGNKEVVWNELLVIDKKYPNLHIIPVGTIPPNPTELLEDGSLATLMQDLRDEYDYIFIDCPPIDIVADTQII
EQYADRTLFVVRAGLLDRSLLPELESIYQEKRFKNLSVILNGTESTGGRYGYRYGYHNGYDSYYGNTK
>gnl|bykdb|I9RPU6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides nordii CL02T12C05] (length=813 residues).
MNTEYKNNDVRKQEPEINITDILHLIWVNWYWFVLSVLVCGGIAFFYLKSSSKVYSRKASVLIRDDSKGGGMSESAAFSD
LSLFGGKRNVDNEVLVFQSRHLMEEVARRLHLDMSYKVKNGLRNDELYTHAPVTVSFPEAEERQVITVVVTPVDSVTVRL
SGFSLAVGGGGVHSEEALDVHLNDTVSTPIGPMVITPTLYYTDAFYGKPVNVVKSNLESVIEGYRGRLKVSLASKTATII
NLVLDDVSTARAEDVLNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIARYIKEYLTDPQKNSDLIPANTGISDNSVEAQIKEYNDILLKRDKLVVGSSSKNPIVIDLN
NSLGAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTSKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDSASGSSAPIAPKTMTIFLASIVLGLAIPVGVFWLLNVMDTKVRTRKELDEVLTIPFLGNVPRHGNNNKGKDS
DGIVVRENGRDSVSEAFRIIRTNMDFMRVKSEKLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSG
IFSNSSNRMGLTHYLSGSTDKVDDIVGMSEEFEKLDVIFSGPVPPNPAELLLSERFDRLIAELRKRYDYIIVDNVPAGIV
ADASIVNRVVDLTIFVVRSGVMDRRQLPELENMYRQEQLHNLSVILNGVPLEHRGYGYGYGYGYGYGYGYGDEGHKHKKM
KRLKKFFSHFLKR
>gnl|bykdb|I9RSN9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides nordii CL02T12C05] (length=821 residues).
MSTEQKINKESKASKSSEKEEEINIADILQLIWSNRYWFILSIFLCVGIAFFYLQSSSKIYSRKASVLIRDDSKGGGISE
SSAFADLGLFGGKRNVDNEVLIFQSRHLMEEVARRLHLDISYKIKEGLRNKELYTHSPIILSFPEAEERQSILVTVTPID
SARVRLSDLKMSVGDGEVTSNEVLEVNLHDTIQTPVGAMVVMPTLYYSDNFYEKPISVTKSNMERVVDAYQSSMEVSLAS
KTATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKRENQLTDITS
ETGMYLANTSLYRQEGLSLENQLSIAKYIKDYLVDPQKNADLIPANTGISDNSVESQISEYNEMLLKRDKLVSGSSSKNP
IVIDLNNSLAAMKQTIIRSVDNLIVGLNIKLKNNREHEEQTQKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENA
LTQAITESNARIIDPASGSGKPVAPRTMVILFAAILIGGAIPMIFFWLQKTLDTKVRTRKDLEDALSVPILGDIPQCSEK
DRKESPIIVHENSRSPISEAFRIIRTNMDFMRVKTENLQVVMLTSSNPGAGKTFISCNLAMSIAQMNKKVILVDVDIRKG
TLSNIFTDIPARMGLTNYLSGKTDKIEDIIITNDKYKNLDIIFAGPVPPNPAELLLSERFDRIVTELKKHYDYVILDNVP
VDIVADASIINRVVDLTIYVVRAGIMDHRQLPNLERMYELDKLRNMAIVLNGVNYDRKGYGYGYGYGYGYGYGYGNDEGR
KSKNKSLTKRLKKRISNLFNK
>gnl|bykdb|I9SIK1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salyersiae CL02T12C01] (length=816 residues).
MNTEYKNNDVRKQESEINISDIFHLILANWYWFVLSVLVCGGVAFFYLKSSSKIYSRKASVLIRDDSKGGGMSESAAFSD
LSLLGGKRNVDNEVLVFQSRHLMEEVARRLHLDMSYQVKNGLRNDELYTHAPVTVSFPEAEERQVIKVVVTPVDSATVRL
SGFSLAVGGGGVRSEEVLDVHLNDTVSTPIGPMVITPTLYYTDVFYGKPVNVVKSNLEGVIEGYRGRLKVSLAGKTTTII
NLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIAKYIKEYLTDPQKSSDLIPANTGISDNSVESQIKEYNDVLLKRDKLVVGSSSKNPIVMDLN
NSLSAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDSASGSSAPVAPKTMAIFLASIVLGLAIPIGVFWLLNVTDTKVRTRKELDEVLTIPFLGNIPRHGNNKGEGLN
GIVVRENSRDSVSEAFRIIRTNMDFMRVKSEKLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLFDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKLDDIVGRSEEYDKLDVIFSGPVPPNPAELLLSERFDRLMTELRKRYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGMMDRRQLPELEAMYRQEQLRNMSVILNGVSPDHKGYGYGYGYGYGYGYGNGYGNEGYSHKH
GMKKGLKKFLGWILKR
>gnl|bykdb|I9T3G6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides ovatus CL02T12C04] (length=804 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLAITVGAATVHLLRTPAVYTRTASVLVKEDSKGKSFSSDLESFS
EFGLFQSGTNVNNELITFQSPSLMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGNLLDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMVAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKAVVVKEGNRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAMSLAIKGKKVLVIDGDLRHAS
ASSYIDSPDKGLSDYLGGRIDNLDEIIVPDPKHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYDYVLIDCPPVEL
VADTQIIEKLADRTIFVVRAGLLERSMLSELEKIYDEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKHN
>gnl|bykdb|I9TP59 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides salyersiae CL02T12C01] (length=812 residues).
MNTEYKNNDARKQESEINISDIFHLVLANWYWFVLSVLVCGGVAFFYLKSSSKVYSRMASVLIRDDSKGGGMSESAAFSD
LSLLGGKRNVDNEVLVFQSRHLMEEVARRLHLDMSYQVKNGLRNDELYTHAPVTVSFPEAEERQVIKVVVTPVDSATVRL
SGFSLAVGEGEIHSEEVLDVHLNDTVSTPIGPMVITPTLYYTDVFYGKPVNVVKSNLEGVIEGYRGKLKVSLAGKTTTII
NLVLEDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIAKYIKEYLTDPQKSSDLIPANTGISDNSVESQIKEYNDILLKRDKLVVGSSSKNPIVMDLN
NSLGAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTTKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDAASGSSVPVAPKTMTIFLASIVLGLAIPIGVFWLLNVTDTKVRTRKELDGVLTIPFLGNIPRHGNNKGEDSD
GIVVRENSRDSVSEAFRIIRTNMDFMRVKSETLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLIDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKLDDIVGRSEEYDKLDVIFSGPVPPNPAELLLSERFDRLIAELRKRYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGVMDRRQLPELENMYRQEQLRNMSVILNGVPSDHKGYGYGYGYGYGYGYGYGYGNESHSHNK
KRKSLKNLFSRF
>gnl|bykdb|K0X1U5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella intestinihominis YIT 11860] (length=780 residues).
MEEKYTSERKNDNIDIVALWRAACRKWYLFAGSVVVCVALVVCYLKIAKPVYEVSADILVNEDEKKGGGGLSSLMGGISG
GGFSLDGMIGGGSVNDEILVISSHSLIREMVQRLDLNISYTSKKNFFKKKEYYRNSPFTVDIPESMVDTLSSGFVVKVQT
GGSDDKIKVLLKKGFFTTLAEMEATSFPIKVDYGEGIVIDKTEFYKPGKKLKFVAHVNGYDGEAEILEKRLDIDLSDKKA
NGISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHEAERIVERYKRENDLSDIDAEAK
IILEANSQYRKLLLEAETQYSIISMVDSFLNKPENKYSLVPVTTGLPDRGAAEAINEYNKLLLERMRLLRTAKDSNLALR
TLTAQIDVMRENILNTVSKAKESSDIARTDLKKQEADFRSRLRGFPEQEREYMDIKRNQLIKNELYTFLMKRREENAMTL
AATSPKCRIVNPAYSKNKPVAPQSLILLLIACGIGLVLPVVYLYGKTVFSVKFNNKNDLRRLTDLPIAGEICHSSTSGYV
VLRENSVSPAAEMFRLLRSNLQFMLPGGGKSILLVTSSEPGEGKSFVSLNLAYSIALMRKRTVLIDLDLRNPKIADYLGL
SVTTGLTNYLVSNKEGGENDLIHHVAQEGFLDVITAGPVPPNPSELLLSEKLDSLMARLREKYDYVIVDTAPVERVSDTF
SLTRFVDATLYVCRADYTHKNSVFNVEDFVAEGSLKNVMFVLNDTEIKKTYGYSVKHTRG
>gnl|bykdb|K0X3P3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella intestinihominis YIT 11860] (length=805 residues).
MAVNQKNTKPGQPDDFLRIQDLLYLCLARWKWFVLSLAITTGVAAVYLLCTPAVYTRTASVLIKEDSKGKSVSPDLESFS
EFGLFQSSTNVNNELITFQSPALMTEVVKRFRLDMNYFVPGKFHRQVAYGLTLPVDVTISDFPENESAGFTLEVQPDSTL
LLSDFTRNGTELDGKDIKGRLLDSITTPLGKIIIHATPNYVKGETYTLYVGKSSLYDAVNSCSSNLSVSLNNEKASVIDL
SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSQTNAQILALNNQLYMTRYIRNYLSNDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSTENPLVVDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVAPPHGSMLPMSPVRKNILMVACALGLLIPVVIIFICENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKGIFRKKP
QEVRAIVVKEGSRDIINEAFRVLRTNLEFMTGKDKASNVIIVTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPTKGLSDYLGGRIDNLNEIIVTNPKQKYLDILPVGTIPPNPTELLFDDRLKQVIDTVREQYEYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLELSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSEYHYGSD
EKYIE
>gnl|bykdb|K0XJ09 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella intestinihominis YIT 11860] (length=803 residues).
MELIQETKNDKKNEGGVTLRDIVELVFDNWYWIVLSVVICMSVAWFYLAMQTPLYKRSAVMLVKSENKSGNDMSAVLELN
GGISGSGVENEIYILQSHQLMREVVGRLHLDVTYQVKNWLHYDQLYAESPIRVNFLDAYTAPVSMEIKPLNGNRFLLNQL
KIGTKKSDNEGQEFLFGDTIISAAGRFIVEDIPDKISAYYNVPVEVSRIDLNTAANIYHSFISTSLAGERTTLVQINCVD
SNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQKNRIVSIDAAATQFMSESSKM
RDELVQLETEYAIARAVERYLTDNENGKQLIPNVSGVGDSGLQNQITTYNEILLQRERLAANSGENNPLVKDLDNNLAAV
RVNLTASMDSYLSTLKLKLRKAREVESQTLDRIESVPQQEKKALGIIRQQSIKESLYTFLLNKREENALQLAITEANIRV
IESPFGSSAPVAPARRMLLMGAFIVGLIIPLAIQLLRLLWNTGVRGRKDIEDYTSMPILGEIPLMKDRDGEHAIVVEENK
TSSVAESFRLLRSNMDFVAPQARVVMFTSTMPGEGKSFVSRNFAVTLAMTNKKVVLLDMDLRKRTLSKTLDLTTKNGVST
WLSGKNNSVSELVQSSNIHAMFDIISAGIVPPNPSELLMSDRLPVLVEELKKQYDYIILDCVPALVVADSSIIGRVADLT
VYVIRNGMLDRRYLPELEKLYRENKFKNLTVVINGVEMESKKYGYGYGYGYGYGYGYGVEHGRKKKRNVIYKIAHRIGRI
FRG
>gnl|bykdb|K5BUT9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides finegoldii CL09T03C10] (length=789 residues).
MEYIQENERTLKKDEGGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMSAMLEV
SGGITGTSVDNEIYILRSHQLLREVVNRLHLDVDYAKDGILRDTPLYAESPVDVHFIDPYNQPVSFNITPLNTTKFRISD
WKVMGEKGEIQEQELAYNDTIRTEAGRIVVQLRPENLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCS
DTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQRNQIVDMSANATQYLAESSK
VKEESAQLETELSIARSIKSYLADVTRKDQLIPNVTGVGDVSMQSQITAYNELMLQRNRLKESSGEKNPVVQAADKNLEG
MRATISGSMDNYMKTLHLRLDKAKVVENRLASSIQAVPKQEKMALSIMRQQSIKETLYTFLLNKREENALQLAITEANIR
VVEEPFGSYLPVSPARSSILAAAFIVGLLIPLGVQVIILLLNTSVRGRKDIEEYTTIPIVGEIPARKDSEGDDAIVVSDS
RNDRISEAFRMLRVDLNFIAKEARVLMFTSTLPGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLS
TYLSGLNSNIDTLITVGAFHPQVDTIFAGIVPPNPAELLMNERFDLLIEELKKRYDYIILDNVPALVVADASIVSRVTDL
TIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGYGQGYGYGYGYGRVDGYYSEKE
>gnl|bykdb|K5Y1A4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii CL02T12C29] (length=789 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLQAVPVSGKEVMLS
GFTLGDQEVSDGKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVALRFQSGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKNSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKAMMILLASVVLGCAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKNEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKEKNMQVVMFTSFNPGAGKTFVSINLAMSFALTHKKVVLVDLDIRKGTLSSHVQVSDM
GVTNYLSGRIDNVDEIIQKGELYDKLDIIHAGPVPPNPAELLLSDRLEALIAELRERYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYREGKLRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGQRKKK
>gnl|bykdb|K5YB65 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii CL02T12C30] (length=784 residues).
MNSEQETINLRREENELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILL
SGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDV
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
KEGLGLENQVTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLIGNSSNKNPVVMDLNNSLSAMK
QTIIRAIDNLIVGLNIKIKNIREREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRSPVAPKSMMILLAAVVLGLAIPAGIIWLQMVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGSTNMGIT
NYLSGKVDDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLEALIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
TIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGNEKKK
>gnl|bykdb|K5ZBN2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii CL02T12C30] (length=799 residues).
MNPEQETNMLREEENELNLIDMYRVVRANWYWFLLSVAVCCAVAALYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEANENLEFGLTVVPVSDKEVS
LSGFFSEELEEEGQVQEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTA
TILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKRENQLTDIHSEAG
MYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDVSLESQISEYNTLLLKRDKLIGNSSNRNPVVM
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREVQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMVVPSGILWVQLTMNTTVRSRKDIEDNLSVPFLGEIPSRNRKDKS
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSAR
ISHAGAGLTHYLSGRVDDVDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVADA
TIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKLEKFRNMAVILNGINMKRAGYGYGYGYGYGYGYGYGYGNEKSQKHKK
>gnl|bykdb|K5ZG55 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae CL03T12C32] (length=798 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGSRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPKIGLSNYLGGQIDKLSDIIVTDEQHPSFSFIPVGTIPPNPTELLFDDRLQKAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGSGGRYGYRYGYQYGYGSGSYYGNNDRSK
>gnl|bykdb|K5ZSH4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. D25] (length=807 residues).
MAINQKNIKPGQQDDFLRIQDLLYLCLARWKWFVLSLVATIGVATVYLLRTPAVYTRTASVLIKEDSKGKSVSSDLESFS
EFGLFQSGTNVNNELITFQSPALMTEVVKRLRLDMNYFVPGKFHRQVAYGLTLPVDVTINDLPENESAGFTLEVQPDGTL
FLSDFIRNGTDLDEKDIKGSLFDSIPTPLGKIIINTTPNYVKGKAYTLYVGKSNLYNAVNSCSSNLSVSLNNEKASVIDL
SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISSYKSEHLLPDVQAASSMYMAQ
SSATNAQILALNNQLYMTRYIRNYLANDANRTQLLPANSGIESANIESQIAEYNKQLLQRNSLVANSSAENPLVMDMDQA
LASMRGAIIRSIDNQIVTLNSQIKSLRQTEQQTTSRIAANPTQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTAY
NTRIVTPPHGSMLPTSPVRKNIFMAAFALGLLIPIVIIFMRENMNTRVRGRKDLESVTVPFIGEIPLFTRKKKRIFGKKP
QEVKTVVVKEGSRDIINEAFRVLRTNLEFMTGKDKTSNVIIMTSFNPGSGKSFLTMNIAVSFAIKGKKVLVIDGDLRHGS
ASSYIDSPAKGLSDYLGGRIDNLDEIIVPDPRHKSMDILPVGTIPPNPTELLFDERLKQVIDTVRGQYDYVLIDCPPIEL
VADTQIIEKLADRTIFVVRAGLLERSMLAELEKIYGEKKYKNMSLILNGTEGSGGRYGYRYGYRYGYHYGYGSGYHYGSD
EKRVGVG
>gnl|bykdb|K5ZVW7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides johnsonii CL02T12C29] (length=800 residues).
MSTEYNPENNIRTEEESTLNLWDLFQIFKANWYWFVLSVILCVGAGYLYLLQAPRVYTRTASVLVKEEQRKSRAATTYGF
TDLDMFGLQRNVDNEVIVFKAYRLMEMVARRLHLDVSYQVKRGLRTVELYTHSPVVLSFPETEESQSFALKVTPLSKEKV
RLSDFITADSNGQRVEIKKAQDVALNDTVQTPVGRVVVVPSLYYADNYYNVPIQVTKSRLKSVAKRYQSALQSTLADKMS
TIINLSLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIETFKRENQLTDIKSETG
MYLQNTSQYKQEGLSLENQVAVAKYIRDYLSDPQKALELIPANTITDMKVEQQISTYNEMLLKRDNFIANSSDKNPVVMD
LNNSLSAMKQSIIRSVDNLIKGLEINIKNIQMQEAQTARRIAAVPSQQKYVLTVERQQKIKEELYLYLLNKREENALSQA
ITESNTRILDSAMGSSSPVSPKSQMILMASLAIGCCIPAGILWLLMAMDTKVHTRKEIQDATTIPFLGEVPMQSKKDKEK
LVVRSGSRDAVSEAFRIIRTNMDFMRVKEKNTQVIVFTSLNAGAGKTYVSSNLAASLVLMHKKVVLVDLDIRKGTLSGRT
AHTGKGVTHFLSGKVDSISEIIQKDGLIEGLDMVNAGPVPPNPAELLLSDRLDLLIDELRAQYDYVIIDNVPAGVVADAS
IVNRVADLTICVVRAGVMDRRQLPELERLYRTKQFHNMSIVLNCIGTKRLGGYGYGYGYGYGYGYGYGYGYGADDKKKKR
>gnl|bykdb|K5ZX55 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides merdae CL03T12C32] (length=791 residues).
MNTEQETNTRVEESELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVYTRTASVLIKDDAKGGAMSESAAFEDL
GLFGTKRNVDNEVLVFKSRRLMTEVARNLHLDVSYTVKDGLRTVELYTQSPVQLSFPDAEEAQAFSLKAVPVSGKEVVLS
GFTLGGQEVADGKPVKVALNDTVTTPVGRVVVVPSLYYGDKYFNTVVQVTKSPLQDVALRFQGGLQATLASKTATIINLT
LQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTS
SQYRQEGLSLENQLSLAKYIKNYLTDPGKSSDLIPANTGISDVNIESQIGEFNEMLLKRDKLISNSSSKNPVVQDLNNSL
IAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELYLYLLNKREENELTQRMTESN
ARIIDPAAGSNAPVAPKSMMILLASIVLGCAIPAGVLWLLAVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKSEVVVHE
NGRDSVSEAFRIVRTNMDFMRVKDKKMQVVMFTSFNPGAGKTFVSMNLAMSFALTHKKVVLVDLDIRKGTLSSLVRVSDK
GVTNYLSGRIDNVDEIIRQNELCDKLDIIHAGPVPPNPAELLLGDRLETLIAELRKRYDYIILDNVPAGVVADAVIVNRV
ADLTIYVVRAGRMDRRALPEVEKLYQEGKLRNMSLILNGTVYKHGAYGYRYGYGYGYSYGYGYGYGQRKNK
>gnl|bykdb|K6AP24 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides sp. D25] (length=796 residues).
MATIQNKSTVQNTQDFITIQDLFYLCLNKWHWFAISLALCLGVATFYLLRTPSVYVRTASILIKDDSKGKSSSTDMESFS
DLGLFTTNTNVYNEMGTLKSPDIMREVVSRLHLEMNYQTDGRFHKQTVYGNQLPVQVVIPNLSENESATFELHLAKDGAV
ELSSFTRNGTEIENDGFVKGNLNDSIQSPLGPIVVIPSAAYSDKTVSTIYVTRQSLSAASAGCSARLNISQNDEKSNIIT
LSFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISSFKSEHLLPDVQAAANMYMT
QANEANAAIRELNNQAYMARYIKNYLTNENNKHQLLPANSGIENASLATQLNEYNTKLLERNSLVSHSSVKNPLVREMDK
SLDDMRSALITSIDNQMVALRAQIRSLEAIGGQATSQIASNPKQSKYLLSVERQQKVKESLYLYLLQKREENELSQAFTA
YNTRIITKPGGSMIPTAPVKKNIFLVAFALGILIPVVIVFMRENMNTRVRGRKDLEGLSVPFIGEIPLSIRGKKRVKSHE
AHTIVVKEGNRDIMNEAFRVLRTNLEFMIGKDQSSNVIVVTSFNPGSGKSFLTMNIAMSLAIKNKKVLVIDGDLRHASAS
AYIHSPEVGLSNYLGGQVDKLSDIIVTDKQHPSFSFIPVGTIPPNPTELLFDDRLQDAIHTLKQQYDVVLIDCPPVELVA
DTQIIEKLADRTVFVVRAGLLERSMLPELENIYREKKYKNMSVILNGTEGAGGRYGYRYGYRYGYGSGSYYGSSSK
>gnl|bykdb|K9DXS6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides oleiciplenus YIT 12058] (length=790 residues).
MVEKKKPADDFIRIQDLWGMFVPKWHWFAGSLLITLAIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMSDFSDLGIF
KSNTNINNELLTLKSPTLMTEVVNRLGLNDIFTVRRGLKNVDLYQSTPVTVTFFDKVETPLSFTIEFSSKDMFTISEFEI
SEESTGETFSARPGDSIHTSVGTMIISLTQEFTDALTDTPVRYARRSVRDVADAYTRELVAELGNEDATIINLSISDASI
RKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISSYKSEHLLPDVQAASSLYMTQSAENNKE
LSALNNQLSTAQYIRRELNAKLLDQPLPANSGIVNANIETLIGEYNNLVLDRNRLIANSSEKNPLVKNMANSLQSMQRTI
IQSVDNLIVSLNTQIRSIRRQEEATTSRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRLITAP
RGSMFPTAPRKMNILLVAFAIGLLVPAVVIFMKENMNTKVRGRKDLENLSVPFIGEIPQCSGTKRKWELKKRQKMNFIVV
NEGNRNIINEAFRVLRSNMDFMASKDSSQNVFVLTSFNPGSGKSFLTMNIAMSFAIKKKRILVIDGDLRHGTISSDINSP
EKGLSDYLNNRVENWRDIIVSHKEYANLQFLPIGTVPPNPTELLEDRKLADLITALRPEYDYIFIDCPPVDIVADAQIIE
KLADRTIFVIRSGLLDRTMLSELETMYTAKRFKNLSMILNGTESTGGRYGYGYRYGYHYGYAFYYGGKDK
>gnl|bykdb|L8JI02 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fulvivirga imtechensis AK7] (length=774 residues).
MNDKINIKGIVLYLLSKWHYFVFAAIFLLPGAYLYTKYATKVYLVKASILLKSERKNDLGGKEFLRGMGLFTSDTELEDE
IGILKSYGMVSNAIRSLDFGISYFSKESFRAEEKYGDFPFIVELDSTISQMIDVPVYIEPLPGGSYRIEAVGRDVDVYNF
LTNRTEDTFDEINLREVVEAGKPFRTHSLAFTIRPNELYAPKENTRYYFVIHDLSEVIETYQTELEVYPISRESNIVELS
MRGSVPHKTARFLDQLLHIYLQNELHKKNQLGVKTIQFIDSQLSGVSDSLKRVEGWLENFRAKSNIQDISYTAENLSKNL
DRLESEKADLQVKLKYYTYISESLAEGRFGDVVAPSTFGLEDPLLSSLLIELSKLNQERAGLNYNAKEQNPVTEVVDRRI
RNTKNTLQENVQNIINVTTIALNDLDQRILRIRREFSRLPANERELVNIQRKFDFSDNVYNYLLEKRAEAGIAIASNTVE
KTIVDRAKVIGNRPVLPNNKLVYLIALFLTLALPIGFVVLKDFWNDHLVSREDIVKATEIPFIGTIIHGSKQEKEQVVSE
KRTPLTESFQSLRVNLQYLTLGKEKNVIGFTSSLESEGKTFCAVNLASTIAQSGKKTILIDADMRRSGMSPYFNIKNTRG
LSNYLVKSCSLEEIIHATQIKGFHIINSGPTPPNPLNLIGLPQMDQLIEDLRQLYDTVIIDAPPIGYVAEYIILMRHTDA
NIYVVRSSYTSRYHLSKINNLYKEQKIRNVSILLNDVRTGLNGYSYTYGAAYQS
>gnl|bykdb|L8JW09 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Fulvivirga imtechensis AK7] (length=782 residues).
MENKNIYSDTEKPTEGIDLDKALTVLRKSIPWILLIFIVTNLSAYLYIRWTKPLYESESELKLDVKSDASELGLLGLSEN
KNLNIISGEIELIKSKLFFSKVIETVDLDLSYYTAGQVLNDEKFKTSPFIVDYNLKNPQLLDRRIFVNIVDEKTYTINFS
GDEQEKAMKYNFGEHANLPDIEFIIYLTNYFDPKGDKNFFFIINSKAAQIKYLGSNLTVEPLNLNANTIRIAFKDYNPLK
ARDLVNAIDTLYLKYSEEEKNLENKQKIEWLNSELRQIETQLEGYEHYFENFTIKNRTSDLNEDLKRTIETINALDSQRF
QLTKRIQAFDQLLADLENNKTEFLGISQETYPKHIADAYNELSVQISERDKLRLSYNETTFALTRKEEEIKNSKTALKAQ
LEKLKTRDESEVRDLLVRRRRLEDNFVELPGKGTEYNKNQRFFKLYEEFYLSLMQSKAQFQIAEAGTTTEFKILSSATLP
QRPISPNVIIIYGIGLVAGFIFSFIFVSVRYLLHNKISALKEIERLTTAPILGTVPTALEKIEATQLIIDKKPKSAVSEA
LRSIRTNIEFMVTGGKNQVISVTSTIGGEGKTFVAVNLGAIMALSKKKVLLLDLDMRKPRVHMAFQDASHAKGVSTILIN
KHGVDECIQKTVIENLDYIPAGPTPPNPSELLLNGEFDSLLRRLRLDYDVILLDTPPVGLVTDGILAMKKADLAIYIVRA
HYSRKIFMNTLNRLIHINHFKKLAVVLNATSNTGADSYGYGYYEEKPEKSGNFIKRMINKGV
>gnl|bykdb|M7N6D4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Cesiribacter andamanensis AMV16] (length=790 residues).
MKEETTYVEYTEGQDTKGWLPIHNIDFDKLYNVMKKSLPIIIVIFLVCNLSAYLYLRYTKPLYRSDSELQLGVNKQADFL
GYRSLDSDPNQNMNGMSEEIELIKSKLFLTRVLKAVDLDVSYFEKGKILDDEKYRSSPFEVSYLVKDESFFNRRFFVRIH
NSEEYTLSYQLGDQEISGRHRFGQTVETDPLTFSLSLRNGINKDIPESRYYFIINSDNALINYFRQNLSVSILNPSAKTI
KISLSDHNPFKAKVLVDVLSNMYLGYTEEEKIKSNSKRIAFLDEQVEETEAKLEDFESYFENFTIDYKTTNLAGDINRTI
IMMEAIDSQRVQLRKQLSSITSLASRIEAEDSYFAQSLVNRQDGNFPAELKGLVEELNTLTSEKEILLASQNENTQAVQL
RNKKISAVKEELANAIQGYESGIRKELNNLQNRQKQLQSTFVRLPSKGTEFNKSQRNYQQLLGFLLNLQSKKIELEIENA
GTTTDFKILSSASLPSAPISPDKWVIHGLGFMVSMMLTVLFVGSLYTLDNKVNGVIVVEEMAHAPLLGALPQTNNKYPTA
RMIVTDNPRSAFSESLRSIRTNMEFVGARQNTRLISITSTVSGEGKTFVAVNLAAVIALSKKKVIILDLDMRKPKVHLAL
DGENASEGISTILIGKHSLESSIKKTAIPNLDYIPAGPTPPNPSELVMNSDFDAILSKLKERYDVIVMDTPPVGLVTDGI
LIMQKVDLALYVFRANYSRKAYFNTLNRLVNVNQFTNLSVIVNGVSRRKGYGYGYGYGYGGGYGHGYFEQ
>gnl|bykdb|Q7MWZ2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis] (length=822 residues).
MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFFLSLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMIGNSEVENEILMLKSKRLTAIVVDKLDLDVSIYKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IQINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLNTTLFFADSWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKRNNITD
ISTDVGTYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYDRLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNKEMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSSEPISPRKPVIFFAAFLLGLVLPSTFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSHDLKAVMFTSANPESGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSV
PAMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQG
KKLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|Q8A3U2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides thetaiotaomicron] (length=787 residues).
MALTEEEKSINIVDLFIYLIAHWKWFVLSILLFGGYFWYSYCETPFVYSRTAIVMIKTPANSRSAMQLNNADFIGQVNVA
SEILQFKSKELMRKVIDRLHADVSYMVRDGLRPRELYTDSPVRVAFLEAGLDEVCSLSVIPKNKQQVELADFSLDELEQR
KTVNLNDTVDTPLGKLIVFTAENYSESYFDRPIKVTSKSREGMVAFWLSNLTIRQMSGDAALLSMTMNDLSPTRAADILD
MLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIEDLKRANNGVDINTVAGMYIQDSRQYESSIKELDTQL
QLVSFIKQYLQDSNKDDELIPSNIGLSDLSIESQISRYNETLLRRNRLVSGSSSNNPVVQELNRIMQTMKQNIYMAVDNL
SKSLRLKKQDYMRQESHVRQKVQAVPGKQREMLSIERQQKVKESLYIFLLNKREENALSQAMVDNNARILDPVSGSNLPI
SPNKYKKMILGVGCGIIVPSVILLLILMLDTRVHNRKEVEAVVSAPFLADIPQTAKASVDAHEVVVRARGLDPLSEAFRI
LRTNLGFMLSQAQDHKIITLTSFNIGAGKTFVSVNLAASLVQTKKKVLILDLDLRKGKMSEMAHSKHVKGVAHYLSNPSI
VVDDLILRDAFGEGLDLIPIGVIAPNPTELLLSRRLDELMDRLRELYDYIIVDNVPIGLVADASVVNRISDLTLFIVRVG
KIDRRQLPELERLYQEHKLTNMAVVLNGTKKGSSGYGYGYGYGQGYGYKNAEKKKGLFGRKKKKSRK
>gnl|bykdb|R5B0L5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:927] (length=794 residues).
MEEPTEHTPQQLSTTQVKISDVIFITLKRWPWILLSLAICVGCAVLYVLRTPSMYTRSASIVIKSSSQGASISDTFAEMG
LVQTNSNVNDEISKLQSPDIMLEVAKRLSLDETYNIDGRFHKDLLYGSSLPIDVDFSTLADGESGSVIVKINKKGVIVLS
DLVLNNIPVDLPNSGVAIPGDTIRTQSGNLVVSLTGRGNPSGMTIYVTKMPLQTAASIFSGRLTVALKEKLGNTINLSVM
DYSPERAVDLLNGVIAVYNEKWLADKNQVSVSTASFINERLAVIENELGHVDSDIASYQSEHLIPNVQQAASMYMTESQV
VSTQMLELNNQLQMTRYLRNYLGSESSRNQPLPVNVGSGSPAIESQIAQYNDAMLERNQLAANSSHTHPMVVDMDNRLAS
MRSTILSSLDNQITTLETQMRNLQSSKAGTTARIAANPTQANYLLSVERQQKVKESLYLFLLQKREENELSQAFTAYNTE
IIQRPTGSPSPTTLVRSRILMIAFVLGLALPFGVTFVMESLDTRVRGRKDIESLNIPFMGEIPNDKPAKGSKSNSRIVVK
PGKRNVINEAFRVLRTNLGFLSQKDKGNVLMVTSFNPGSGKTFISMNMAVSLAIKGKRVLVIDGDLRRSSTSAYIDSPET
GLSNYLNGEVNNIKDITVCDTLIKGLCVIPVGTIPPNPTELLETKRFAELIEKVKDEYDYILIDCPPVEMMADAQIIETS
VDRTIFVIRAGLFERSMLPELQNLYDEKKYRNMSIVLNATMAEGSRRGYKYGYGYGYGYGNYSHYTSNNSSLKI
>gnl|bykdb|R5B7P0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. CAG:514] (length=807 residues).
MENNINTDNNTRQQEETVQIGQLVRRCLSRWYWFALSLAVCLALGALYILRSTPTYNTSADIQIKSNTKGASMPGDIGEF
GNMGLFAVKSNVNNELHAFESPDIMSEVVARLRLYMSYTVDGTFHRNVLYGTSLPISADLLDVDENVGVGFTVSENGGRV
TLNDFIHKNEKVGGKPVVGHYGDTLQTPVGRIIVQKTKDYSGEAMKKPVNVRKSGQRGVTQSYLNRLQVNLADKNADVIS
LSIKDVSTQRAQDILNTLIAVYNENWVRDKNQIANSTSVFINDRLRVIEGELAGVDSDISAYKSENMIPDVGAAATMYMQ
QSTVLNQQLQDVSNQLYMARYIKDYIGKEDNRNQPLPANMGLSSQTIENGISEYNSKILQRNNLVANSGEENVLVKDLDQ
ALASMRGSISRSIDNEILALNTKYENLKGTARQNTARIAANPNQAKQLLSVERQQTVKQALYLFLLQKREENELSQAFTA
YNTRIIKHPISGIFPVSPQSMKIMMMAFLLGLMIPAGIIYLLMATDTKVRSRRDLKGVSVPFAGEIPLSAETATKAFGKR
KTLSGADSIVVRHGNRNVVNEAFRVLRTNFEFTMREPGSKVIAVTSFSPGAGKSFVSSNLAVCFAIKGKRVLVIDGDLRH
ATLSELVGSPKPGLSDYLAGIVADVHDVIVRSKDAMTVPDILPAGSIPPNPVELLADRRLADAIAVLRNEYDVIIIDCPP
VEIVTDARVINDYVDRTLFVVRAGQFDKAMLPDLDVLYRDGEYRGLCCVLNGTASSDGYYGNYGTYGHYGYYGHNGGSYY
SSDNKAR
>gnl|bykdb|R5EUZ0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:20] (length=803 residues).
MELIQETKNDKKNEGGVTLRDIVELVFDNWYWIVLSVVICMSVAWFYLAMQTPLYKRSAVMLVKSENKSGNDMSAVLELN
GGISGSGVENEIYILQSHQLMREVVGRLHLDVTYQVKNWLHYDQLYAESPIRVNFLDAYTAPVSMEIKPLNGNRFLLNQL
KIGTKKSDNEGQEFLFGDTIISAAGRFIVEDIPDKISAYYNVPVEVSRIDLNTAANIYHSFISTSLAGERTTLVQINCVD
SNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTDFKQKNRIVSIDAAATQFMSESSKM
RDELVQLETEYAIARAVERYLTDNEHSKQLIPNVSGVGDSGLQNQITTYNEILLQRERLAANSGENNPLVKDLDNNLAAV
RVNLTASMDSYLSTLKLKLKKAREVESQTLDHIESVPQQEKKALGIIRQQSIKESLYTFLLNKREENALQLAITEANIRV
IESPFGSSAPVAPARRMLLMGAFIVGLIIPLAIQLLRLLWNTGVRGRKDIEDYTSMPILGEIPLMKDRDGEQAIVVEENK
TSSVAESFRLLRSNMDFVAPQARVVMFTSTMPGEGKSFVSRNFAVTLAMTNKKVVLLDMDLRKRTLSKTLDLTTKNGVST
WLSRKNNSVSELVQSSNIHAMFDIISAGIVPPNPSELLMSDRLPVLVEELKKQYDYIILDCVPALVVADSSIIGRVADLT
IYVIRNGILDRRYLPELEKLYRENKFKNLTVVINGVEMESKKYGYGYGYGYGYGYGYGVEHGRKKKRNVIYKIAHRIGRI
FRG
>gnl|bykdb|R5EXK3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:20] (length=780 residues).
MEEKYTSERRNDNIDIVALWRAACRKWYLFVGSIVVCVALVVCYLKIAKPVYEVSADILVNEDEKKGGGGLSSLMGDIAG
GGFSLDGMIGGGSVNDEILVISSHSLIREMVQRLDLNISYTSKKNFFKKKEYYRNSPLTVEIPESMVDTLSSGFVVKVQT
GDSDDKIKVLLKKGFFTTLVEMEATSFPIKVDYGEGIIIDKTQFYEPGKKLKFVAHVNGYDGEAEILEKRLDIDLSDKKA
NCISLKIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVERYKRENDLSDIDAEAK
IILEANSQYRKLLLEAETQYSIISMVDSFLNKPENKYSLVPVTTGLPDRGAAEAINEYNKLLLERMRLLRTAKDSNLALR
TLTAQIDVMRENILNTVSKAKESSDIARTDLKKQEEDFRSRLRGFPEQEREYMDIKRNQLIKNELYTFLMKRREESAMTL
AATSPKCRIVNPAYSKNKPVAPQSLILLLIACGIGLVLPVVYLYGKTVFSVKFNNKNDLRRLTDLPIAGEICHSSTSGYV
VLRENSVSPAAEMFRLLRSNLQFMLPGGGKGILLVTSSEPGEGKSFVSLNLAYSIALMRKRTVLIDLDLRNPKIADYLGL
SVTTGLTNYLVSNKEGGENDLIHHVAQEGFLDVITAGPVPPNPSELLLSEKLDSLMARLREKYDYVIVDTAPVERVSDTF
SLTRFVDATLYVCRADYTHKNSVFNVEDFVAEGSLKNVMFVLNDTEIKKTYGYSVKHTRG
>gnl|bykdb|R5FHS9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:924] (length=806 residues).
MPNNQIQSQQPQQNQQSDDSVVITDFLYLCLRKWWWFAIALIIAFGVAIAYILRTPPVYTRTESVVISNSDDSRSVSIDD
IFSSASSGGISTNSNYVNNELIALQSPSIMLEVVKRLGLNVSYLTDSTFYKGVLYGQNMPYTVSMPDVQDEDVVKFTVKM
EGTRFVLSKFIRNKEELDGEDVTAKLNQTVHTPIGRVTIKPSHYYNSWPGGLYANLYVTHVPMMSAMSSYQKGLSVSLAD
NKAAVINLEMQDVNIQRAEDILNTIIAVYKDRWVRDKNQVAVATSAFIDDRLKKIELELGNVDNSISSFKSKNLITDVDA
VATSYLDQSTAANAKLLDLNTQRAMAQYVLSYITNPKQRNHVLPANFGLTDQNIEQQIESYNKDLIERNQLLANSSEANP
LVKDLDQSLRLQRSSIITSVENSIRSLDNQIGAYGSQESTNNAKMAASPTQAKYLLSVERQQKVKEQLYVFLLQKREENE
LSKAFTAYNTRIITPPMGDDLPTSPVRGRIYLLAFAIGLIVPGGILFLKESTNTKLRGRKDLERISIPFAGEIPECQPER
GGKLWKKPKLSSPLVVAEGNRDIVNEAFRVFRTNLEFMIGKGDHSQVIIVTSFNPGSGKSFISGNLAISLAIKNKKVLLI
DGDLRHGSTSHMFGTFHHGLCDFLAGKTDDIDQYIYNYQGQANLKVLPIGHIPPNPTELVEGGRFPELIKRFREEYDYVL
IDCPPIEIVADTQIIEKWADRTVFVVRAGLLERSMLPELENLYTEKRFKNMSLVLNGTVSVGSHYGYRYGYHYGYGSNSY
YGNGNE
>gnl|bykdb|R5GSU5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:755] (length=824 residues).
MANQNYINPPAVQQETEDIDWLSIVRACTGTLRRQWRWFVFSIIVCGCLAFLYERKQPRVYQRQAVIEIEGADGSSGSRR
MPSNMNALLELNGITAGDQLQNEIFILQSHRLIERVVTRLKLDVDYSVKNGLGQSTLYKKRPFEATFLRPAEIDEDITFK
VDLIDNQKFRIFDVRYKDEDCRIDKVVAYGQRIATPAGNVYLTRKMNLEGLEPTTVTVSRLPVFTATEMYRSKLSCGEID
KESSLIVLTFQDTNKKRAEDFLNVLLDVYKEDIIDGKNRIAESTAIFIDSRIKIIGDELNDVEGSLARFKERNQIVDFEK
SAQSALEEQRTLRLSMLQAEVQLSVAEYLEDFLKNNSKADQVIPVLNDMVDQGIQQQITEYNKLVLERNRLAPNTGENSP
VMNDLNQKLIATNEAIRASVHSLVNTLRLRAESARRNENTFNTILSGVPNIEKSAGDIKRQQEIKSALYSYLLNKREEVA
LQLAINEANIRTVEYPLGFERPVAPHSMIIMAIGLFIGILIPTAVFTIRSYMDTAVRGRKDIEDATDLNVIGEIPRWEDA
NKLGDSETLIATDETNNTVTEAFRMLRYGLSFIRKHNQVVMCTSATPGQGKTFVSRNLAAILARADKRVILIDADIRKRT
QSKQLGNRFGLTSYLNGDITRVEEIIISRGGTNLQDVDFIPAGLLPPNPAELLMDARFDELIDELRSRYDYIIIDTTPAL
QVADAGIVSRVADQTLFIIRVGVQDRHFLPTLQRLSDDKQLGNISVVLNDCVNNVLGYGYGYGYGYGYGHTAGRQNHAKH
GNKSSGLSKKLSAGVLHRLNNRKQ
>gnl|bykdb|R5IP14 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tannerella sp. CAG:118] (length=802 residues).
MAKEQQEIYGQQVEESTDNGLSLRDILEIGLANWKWFALSVIVCLSIAYVYVQTLPYIYTRSASVIIKDNKSGGFSESAM
FKDLGSMDMINVRSSAETEMLIFQSYRLMQDVVSQLDLDVGYVMQGGLRDRSLYKDSPLAVSFITKDNNSQFSFDIVPIS
DQEVLLSDFTSNEDWSKKVQLGDTVSTPVGVLVVNNTGIPLTKFKKKVITVNKRRLKDATTRYRRAVSVSLESKNGGALN
ITMNDTDIKRAEDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIETFKKENELTDITSEAGMSLT
MKSGYMSEGVSLENQISLVNFIKDYLSDPVKINDLIPANTGIESAEISGAISEYNQLLLKRDRLMSNSSDRNPMVIDLNQ
TLSTMRNSIIQSIDNLLVTLNIRMKSIQEQEQIARHKIASVPSQEKQVLSIARQQKIKEELYLYLLNKREENALNMAITE
SNARVIDAANGSDTPVSPKTMMILLAALAIGCVIPAAVIALIMLLNTTVRGRKDIEDNTTVPFLAEIPFKRNKAEGDIVI
VREGGRDSVSEAFRILRTNLDFMVGGENNAKVIMLTSANPGSGKTFVSFNLAMTLALAGKKVLLLDVDLRKRSLSKRMHA
EGIGLTNYLSGRVNNIDELIMKDEFHECLDVIHAGPTPPNPAELLLSKRLDILVDEIRNRYDYIIIDSVPSMMVADASIT
ARVTDITIYVIREGLMDRRQLADVERIYRGNAFKKLCILLNGVGMKQKRYGYGYGYGYGYGYGEEEQNMESQLHEKRWWQ
IF
>gnl|bykdb|R5KD55 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:1124] (length=808 residues).
METNPVTQQTEETTEEISIRDILISCASHWRWYVATVVVALAVAVLYIKKTQPVYKRDASIMVLERNDKPTVLNQLLNDY
VDFGFFADNTNVNNVIAAIKSPDVMSEVVDRLGLDVSYTTRGTFYDKTLYGKTLPVKVVFRDIPKDETASLHIRLKKDGS
IKMSEFVKNGKPQNSYDLTCHVGQTVNTPLGRLTIERQPHYPSAVADNDEIDVRKSDNASATGRFLGGLSVEIGDKKSTI
LDLSYNDVSGKRAEDILSAVIDIYNKVWMKNRNEVSAGATKFLDERLAIIERELDNVDNDISRYKSKNLLPDVEKAYSLS
MERADKNSAILLDLNTKLSVAGYIRDYITNRANTNQLLPANMGLDDGKTDGLIDKYNALQLERNSLMANGGKNNPLVKDI
DKALNQLRRSVISSINNMIVSLSTRIGHIQNDEQKTNTDISTNPTQAKELLAVERQQKVKEALYLFLLQKREENQLSQSF
TADNTQIVKSPTGSNVPLKPKKGMIMLIALVIGLALPTGVIYLMETTNNKVRGRKDIEDNLTAPFVGEIPLVEEERKGLS
ALKPAQEKAYGIVVEHGNHNLINEAFRIVRTNIEFLTPQGNGASVQMLTSYNSGSGKTFLAMNIATSLAIKDKRVLVIDG
DLRTAGLSRYIGNPKLGLSNYLGRHTDDIDSIICHYETCTGLDIMPSGVVPPNPAELLASDRLPRLLAEMKKRYDYIFVD
CPPIDAVADTSIISHYAERTLFVVRAGKLERAMLADLEKLYKSGRLNNLSVILNGTRNAGTPYAYRYGYSYGYGTNPKSN
SLIDYFRR
>gnl|bykdb|R5RVP0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:545] (length=805 residues).
MPIDNNLDNRPSQVRNEEENDLLNLADLWSMIWDNKWWYVLSVAICLCFSVFYLYRTASSYTRTAKVMIDDTNENSALRD
LASFTGGVRYRSMNGSNVYNEIEAISSPDIMQTVVKRLGLETTYVEKQFLRSREKFTDSPIALVLAGDNNASAFSFEIVN
EKDSTFVIKDLAVVGETIKHTEKITGRLRDTISTPVGKIVIVPTEFIDKWKKPMRVSWVNSAKLAKAYCKGVTVALSGKE
STVIVLTMKDRFPSRADAVLRTLIDVYNEHWVENKNRSARNTTAFINDRLIVIEKELGGVEENLKDYKSSHKITDIRSLS
AAYLEESTEYKAKSFDVNNQLAIAKFIKEYLENPAHSGALIPANSGLTSTTVEAQIKEYNSLVLNRDRFANESSDNNPLV
SDLNTSIAALKIAINRSVENLISTLQLQADQLESEENLIMSHIANTSGQELQLLSIERQQKIKEELYIYLLKKREENEIA
SLVNVGNTRMVMAPNGNDLPDSPRKQMILLVALVLGCGIPFGVFFLLKQLDTRVKCKSDVASLKVPFLAEIPQIGKGAGL
INRLRKKMCDETNTRIVVEPSNRNSINEAFRVLRTNMDFMTSNHKGCHRMMVTSFNPNAGKTFVIMNMAATMALKGSKVL
LMDLDLRKATLGKALDHNKSGISAYLNGKVDSIVTEIQHLRDNLDLLSVGALPPNPAELLVSDRFAKMMEDLSARYDYIF
MDCAPVDIVADTTIIAKYADFTVFIIRAGLFDKRSLPAVDELYESGVYNHTALILNGVDVHTHAYRYGYGYGYGYGYGYG
NDSTK
>gnl|bykdb|R5S343 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides fragilis CAG:558] (length=781 residues).
MKNTEQDLFEFEEEKSGLTLRDMIGIVWMHKWWFTASLVVCIILASGYLMWMPNVYTRTASVLIKDSNKGGAAGEGRVFE
ELNLFNVKSNVDNEVQVFKSTRLMSSVVRKLSLEQIYTTKRGLCTVDLYGISPIRVRFLDRGEDEAATCAVTFMTCERVL
LSGFKEENREIEAVLNDTVDTPSGRAVVAPTGYYNKNDLNRTVMIEKNIVSDVVDAYRERMRIELADKSTTIIYLTLQDV
SVARAEDVINTLIEAYNEDAVNDKNQIAINTASFINERLKIIDRDLGLVDSSIASFKSEHRLTDAGLETGVFLQESSLYN
QTGLGLDNQLSLAKYIREYLTDTRTRGKLIPANTGLTDMNMEGRIGEYNELLLKRDRLIENSSDNNPVVADMNRSLLAMK
QTIVNTMDNLIETLDIKIKSVREKESETNRKISAVPTQQKYILSVERQQKIKEELYLYLLNKREENALTQAITESNARVI
DKATGPTKPIAPRKIRVLIIAMLAGCAIPALVIWLMNVLNTTVRGRKDVEDATTIPFLGEVPLRDKKDKSEIVVRENGRD
AISEAFRIIRTNMDFMQLDNVGKQVILFTSFNPDSGKTFVSTNLAMSFALTDKKVVLVDMDIRKGTLSGHVSKSNTAGVT
NFLSGRIENIEDIIVKGEVYNKLDIVHAGPVPPNPAELLLSSRLEIMIAELKKRYDYVILDNVPAGVVADATIVSRVAEM
TIYVIRAGKMDRRQLPELEKMYKQHKFRNMCLVLNATEYKRMGYGYGYGYGYGYGSEMEKE
>gnl|bykdb|R5UEY8 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes finegoldii CAG:68] (length=819 residues).
MTEQNINPHLLNEESENTNGITLHDLIQMVLANWYWFALSAIICLGTAYYYLASTPKIYSRTATILVKDSRKGGDTDLGA
FSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVREGLRTADLYGRSPIEVDFINDNSKQKLSLEVTPLRNGK
IELTDFEDKFVTRQETKRVILAEYGDTVATPVGQVVVHKTLFMDSTYLKKPITVIKNSLAATTNAYRAAVKSDVANKQAS
IVTISMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIEDIKKSNKMIDITSEATR
TITESTRYKAESLTIENQISVADFIREYLNDPSHAGDLIPMVASMTNNGIVAQISEYNEAILRREKLLENSSERSPVIQD
LDNGLAAVRRSIIASLNSHISTLEIQLETMRKEEAQVNRRISTMPSQEKVMLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDMAYGSARPVSPRSTIILGISLLAGLAIPFGILYLIGMLDTTIRGRKDVEENLSAPFLGDIPFLEGDNKGG
VVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLAMAGKRVVLIDLDLRRHALTTH
LGRSNSKNGMSGYLAGTITDIDQLVTNMGFHENLDVICAGIQPPNPTEMLLSNRLDKLVEQLKERYDFVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFHNMCIVLNGTRTRRHGYGYGYGYGYGYGYGYGYGYGDDHQEV
SYRKRIKLFFSKLARKVKK
>gnl|bykdb|R5X290 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. CAG:157] (length=815 residues).
MTENNKDIIDGRKEEENKSITLRDIFDFIVFNWYWFALSAIAFAGIGIVYALSRPDVYRSSAMVLIDEQYNRSSNSDLTG
FMPGRMMYRTNSGVEDELLIMGSRSIMERVVAELDANIVYATKSKLRYSYLTAESSPLKLTADTIRYTFNIHIKSIEDAD
GSFKALLEYRLPGQKTTEKTITGAFGETIRDTVGVFRLERAVATAGYNPKAANSLRIYVRPVRNAAEAYAKALHVAQAQK
FSNIVNVSISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEKFKSDNSAVDIISE
TKLSLETSRQYEDDLLKTEIQLEMLSAIGDILNGKEEIGILPVNIGIENQALSNAINKYNELVLERMRLGTETSDDNPVI
REMNAQIISMQHSLKKSIENVANSLQIQNESLRQQLAQVSDKVSNIPYLERETVSIERNQEIKAALYTYLLNKREETALS
MVATTPVAQVIDKALVNPIHVAPHRSMIVLLFFAIGLILPAIVIYLIEQLRVKVGSVSEVEDNIHVPIIGAIPSKTAGMH
NDKIVSPNSRDVVTEAFRMVRTNLDFTMPQGGKVIMVTSSMPGEGKSFVSINLSLTLGIAGKRVLLVDLDLRKASLSEKI
SGRRQTKGLVNYLVKKEENLDNLISHNAMHNVDVLYVGVIPPNPAELLMGDRITQTFEELKQMYDYVVVDTPPIGLVTDT
MLINRIADLTVFSVRVGKSFKRNLVGINILNDRKTLRNMNVIITDIGAARRYTRETSTYGYGYGYGYGYGYGNEKKMTLK
TRFRLFWKNLKKRKE
>gnl|bykdb|R6A0L2 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:5226] (length=802 residues).
METKSINPQEQQDEEMQLIPLLKLCYHQFINHWAWFALSAVVCGCIGWYYQQCQPRVYQRQAVMLIEDSNGSSTGGLRRT
SKNSGMNTLLELNGVSVGDNLKNEIFIISSKRLMSRVVDKLNLDVDYTTKEKLHSITLYGKELPFQVLFQKQYKGKRGQH
IDVVKKGSNTVTLKGMTDRMGNDVPDVDVQLGQMTQTPYGPLCVVRGPGFGRWTDETIEVDRLSKEKAAARFLKMLSASE
YDKETSLIVLNCNDTNIERADQVLATLYDTYKEDVVENKNRVALNTAKFIDDRIQIIGRELSSVENQLASFKKRNQLVDF
DKTPQAMIDESSTARQQSLQAETQLNVAKYLDEYLHTHSNSHDLIPALNVGDASFNTQIAAYNDQMNKRNTMVANSSENQ
AVVREMDRQLAQMRQAIASSLRSYVNSLEVRLQAARANENMLTGRMAGAPEQEKQGLDIQRQQSLKEALYTYLLNKREEV
ALQQAINEANVRLVEGPIGNQQVGPRSLVILLVSLIIGLCIPAFVLWLRYMLDVAIHGRKDVENATTIPVLGEVPRMKNA
NNNKSLITDLSSDDPVVEAFRIIRFSLGYMRHSTQVMMTTSTTPGQGKSFVARNMAAILAMAGKRVLVIDGDIRKRTLSE
SFGHTFGLTTYLSDDHTQVADLIRTDAVVKGVDFLPSGPTPPNPTELLMSDRLHQLMQQLRQMYDHIIIDSTPMFSVADA
SIVNRESDITIFVLRAGVQNRDFLPDFERMYQEHRFNNLTVVVNDVNVDKRYGYGYGYGYGYGYGQNKKKSRVKRIINRL
HK
>gnl|bykdb|R6AK43 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris CAG:120] (length=808 residues).
MGKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|R6CQ93 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:530] (length=780 residues).
MQNNNLSGKNEQSINLVDLFVYLLSKWKWFVLSILFFGGLAWYYYAQSPLVFFRSVTVIIKDQSNKTSTAGLDRYDNYIN
KVNVANEILQFRSKRLMREVVQRLHADVDYRVEKGLRMNELYNLSPVQVSFFNVLPERYFSFVVTPKDETSVELSEIEGI
PGAQETYKVQLNDTLSIGGEKILVTSTDHWSKSWVGRDIHVSKIPLNAAAGRFLGSMGIRQEEDESSILVLSLKDDSPLR
AEDVLNTLVNVYNEEAVNDKNLVAVNTSKFINERLIIIQRELGGVETELESFKQSNQLMDIGSLAGRYMGEAQTYSADAM
EQETQLKLAQFIKEYLTDPTKSRDLIPSGTGISDASVEGQINQYNSLKLKRDKLIADSSENNPVVKELDNSIHALKQSII
RAVDNMIVSINMKRSDARSRQEQAQKRFTTVPTKERQMLSIERQQKIKESLYMFLLNRREENALSQAMVDNNARTIDSVD
GPTGPISPVRKRILLLGILVGLAVPCAVFLMILFFDTRVRSRKDLKGVVSIPFLGEVPQDKDASKASVAVDKENGMLSES
FRILRTNMAFMAKKDKPMQVITFTSFSEGAGKTFISRNLAMSLAITNKRVILVDLDIRKGTLSRHYHKHPAGVTNYLADE
NIRLDDIIHSDDKFENLDIISSGTIAPNQAELLMDERLDTMMAELRKRYDYVIVDNVPVGIVADATISNRISDLTIFVVR
AGKLDRRQLPDLEELYRDNKLNNMSLILNGVDPHRRGYGYGYGYGYGYGYGYGKQHKKKK
>gnl|bykdb|R6DAG6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:754] (length=778 residues).
MEYTQENNEKTVKESGFNINLRDIVELIIAKWYWFALSVFICVSAAYLYTRTLVPVYQRQAVMLVKTGGKNANSDISAML
ELQGGITGSGVENEMFILRSHQLVREVVNRLHLDVSYEKEGFFRNTSLYAESPVEVNFIDPYHDYYRTKVTPLDVKNYTI
LGEKYAYGDTIQTEAGRIVVNLKPENLSVYIGKPVSVTRISPETAAAIYKGGISTSLAGKGTTMVQITCTGDNVSRADAI
LNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTDFKQRNRIIGSEGNGTQFLAESSRMKTENLQMET
ELSIAQSIKSYLLDATRNNQLIPNVSGVGDASVQSQITAYNELMLQRNHLLAESGAKNPVVQTADKNLAEMRTVISGSMD
NYIKNLRLRLEKTRAVERQINSEIQAVPKQEKMALSIIRQQSIKEALYTFLLNKREENALQLAVTEANIRVVESPFGSNA
PIAPHSTTFLLAALVVGLAIPLGIQILTMLWNTSVRGRKDIEDYTTIPLLGEIPSRKEDMADDAIVVDDKKNDLISESFR
LLRANINFVAKDARVLMFTSTMPGEGKSFVSRNLAVAIAIAGKKVVLVDTDMRKRTQSKLAGIKHKDGLSTYLSGQHNDV
DSILDKGLIHPSVDSLFVGPIPPNPSELLMNERLEKLIEELKKRYDYIILDNVPAQVVADAAIVNRVAELTLYVIRDGQL
DRRYLPELERLHKEGKFNHLCIILNDSHIEKKKYGYGYGYGYGYGYGYGYGYKYEEYK
>gnl|bykdb|R6KTP3 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides cellulosilyticus CAG:158] (length=795 residues).
MVEKKTPVGKPADDFIRIQDLWSMFVPKWYWFAISLFITLTIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSAMNDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVNRLGLNETFTIRKGLKNVDLYKVSPVTITFCDKTEVPLSFTIKFSSKEAFAIS
ELEISGEDIGETLSAQMGDSIQTSAGIMIVSPTQEFTDAFIGTSIRYVRGSVRAAVDTYSNALVAELGNEDATIINLSIN
DTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISSYKSEHLLPDVQAASSLYMAQSAE
NNKELSTLNNQLSTAQYIRRELNTKQLDQTLPANSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRQEEATTNRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVGIFMKENMNTKVRGRKDLENLSIPFIGEIPQYSGTKKKWWEFKHRKRQ
DMKIIVVNEGNRNIINEAFRVLRSNMDFMASKDNNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKKILVIDGDLRHRTV
SSYVDSPNKGLSDYLNNQIEDWKEIIVSYKGYTNLHILPIGTIPPNPTELLEDSKLSMLIEALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFVVRSGLLDRSMLSELENMYTGKRFKNLSMILNGTESTGGRYGYRYGYHYGYASYYGSKDK
>gnl|bykdb|R6LHA4 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides clarus CAG:160] (length=808 residues).
MGKDRFEDLDFIDFNDSRQQESTVIADMLSAVYRNRKWFILSVVVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVETLHLNVSYKEWDGLRKKELYTSTPFTVNFLDADPAQKISLTVTMTDN
GKVTLTDMVLQNELEEEEFDESLTVQPGDTVSTPVGKIAVQPTLFTNESYIGKSVYVAKGNLKEVAEEYNKALNAGVTNK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIETDLATVDAEIENYKKKNKLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTDPIPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSEGNPL
VRDLNGTLMSIRLSIAKAVDNLIASLEIQAANMKNKERENSDKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKAQVILISLLAGIMLPALWIYIRSLLNTSVHTKKELKTGVSIPFLGEVPLKKSKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTAGKVVLVTSANPDSGKTFITLNLAMSMALANVRVVILDLDLRKGSL
SKCVGIGMKKIGISNYLSGKVDDVKELVQVCGEDSRLHIITSGALPPNPAELLKSGRLDRLIEELKKNYDYILLDNPPYG
IVADTQLCGRLADQTIYVVRSGLFDKRMLPELQELYDSGKMKNMSLLLNGIDYVKTGYGYGYGYGYGNYGNDEERKNKKP
LYKRIFGI
>gnl|bykdb|R6NN15 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:443] (length=806 residues).
MSETQQHTRPAAKADDFIRIQDLYYLCLAKWRWFVLSLVICLGIAFIYLLKTPPVYTRTASLLIKEESKGQSLSGDVGAS
FSDLGLFQPNTNVNNELVSLQSPAVMYDVVKRLHLEVDYSTEGSFYAQVRYGQNLPVTVSFAGLADNETAALTVEPAQSK
GIKLTSFVHNGEKVDGEVVGTLNDSLVTPIGKIVIRPAAAFVDWQKSSEPLTVSRSGLNSAVSRYSAGLSVALQSEKTTI
VDLTFKDVCIQRAEDILNTVIAVYNENWIKDKNQIAVSTSMFINDRLGVIESELGHVDENISTFKSENLLPDVQAASQLY
MTERSQAQSQILTLNTQLSMARYIRNYLTAASSRNQLLPANSGLESANIENQISEYNNLQLQRNNLVANSSEQNPLVVDM
DESLRSMRRSIVSSVDNLITTLNTQIHSLEKSDQRATERIAANPSQAKYLLSVERQQKVKESLYLFLLQKREENELSQAF
TAYNTRVITPPTGSMAPTAPMKKNILLVALALGVLIPVVFVFLQETLNTRVRGKKDLENLSIPFVGEIPLYGKVRRSGLF
HKKVTPLTETKVVVKEGSRDVVNEAFRVLRTNLEFVSGENGKGQVILMTSFNPGSGKTFLTVNIAATLAIKGKRVLVIDG
DLRRGSTSVYVGSPHHGLSNYLAGKVQRIEDVIVPASETVRFDVLPIGTIPPNPTELLAGERLQTLLADFRTRYDYILID
CPPIELVADTHIIGKYADRTIFVVRAGLLERSMLPELEALYIEHKFKNMTVLLNGTEGNGSYRYGYRYGYHYGYGSSYYY
GNEKQK
>gnl|bykdb|R6S9Y6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides finegoldii CAG:203] (length=797 residues).
MEYIQENERTPKKDEGGINLRDVVELIIANWYWFVLSVLVCVGSAYFYVLTIQPVYQRQAVMLVKDKEKSASDMSAMLEV
SGGITGTSVDNEIYILRSHQLLREVVNRLHLDVGYAKDGILRDAPLYAESPVEVHFIDPYNQPVSFNITPLNTTKFRISD
WKVAGEKGRMQEQDLTYNDTIRTEAGRIVVQLRPENLSAYLSQPISVSRISPEIATNIYQSKIATSLAGERTTLVQITCS
DTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTDFKQRNQIVDMSANATQYLAESSK
IKEESAQLETELSIARSIKTYLADVTRKDQLIPNVTGVGDVSMQSQITAYNELMLQRNRLKESSGEKNPVVQAADKNLEG
MRATISGSMDNYMKTLRLRLDKAKAVENRLASSIQAVPKQEKMALSIMRQQSIKETLYTFLLNKREENALQLAITEANIR
VVEEPFGSYSPVSPARSSILAAAFIVGLLIPLGVQVIILLLNTSVRGRKDIEEYTTIPIVGEIPARKDSEGDDAIVVSDS
RNDRISEAFRMLRVDLNFIAKEARVLMFTSTLSGEGKSFVSRNLAVALAISGKKVILLDTDLRKHTQSKLAGVNRKEGLS
TYLSGLNSNPDTLITVGAFHPQVDTIFAGIIPPNPAELLMNERFDQLIDELKKRYDYIILDNVPALVVADAAIVSRVTDL
TIYVIRDGVLDRRYLPELERLHQDGKFKNMCIVLNDSQVEKKKYGYGYGQGYGYGYGYGYGYGHISGYYSEENKDKK
>gnl|bykdb|R6WSB6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. CAG:268] (length=803 residues).
MEMTQNTSPAEPMDDSIQIKDLLYLCLAKWKWFILSLLVTLSLAFLYLLKTPSVYTRSATLLIKENTKGQSLASDVESFG
DLGLFQTTTNVNNELLVLQSPSIMLEVVKRLHLDMNYHIPGRFQDRVAYGASLPLTVSLPELTENESARFTLKVRPGGEV
ELSEFVRNGEEIPSEKVIKGNLTDTLTTPLGRVEITPTPYYDIDRGCQLKVSRTGLYGAVGSYSGNLTVTLSDKKASAID
LTFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENISTYKSENLLPDVQAASSLYMA
QSSETNAQIMALSNQLYMTRYVRNYLSDENNRTQLLPANSGIESTNIESQISEYNTKLLQRNSLVANSSTQNPLVVDMDQ
ALSEMRRAIITSIDNQILTLNTQIASLQQNEQKTTARIAANPSQAKYLLSVERQQKVKEALYLFLLQKREENELSQAFTA
YNTRVITPPSGSMVPTTPVRRNILAIAFVIGLLIPVGVIFLREVMNTRIRGRKDVEKLPLPFLGEIPQWGGNGRSLFGKK
KKREPAADSIVVREGKRDVINEAFRVLRTNLEFVVGKSEKSNVIILTSFNPGSGKSFLAMNIAMSLAIKGRRVLVIDGDL
RHGSTSAYVGSPRHGLSDYLGFRTDKVEEILVRDKEYENLNILPVGTIPPNPTELLEESRFGELIARLRADYNYILIDCP
PIEVVADTHIIEKVADRTLFVVRAGLLERSMLSVLENIYREKKFKNMALILNGTDGQSGYYGYGNRYGYHYGYGYHYDSG
SKK
>gnl|bykdb|R6XWY7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes sp. CAG:29] (length=820 residues).
MTEYNNQQQHLQNDENENGSGLTLHDLLQMVLANWYWFALSVLICLGMAYYYLASTPKIYSRTATILVKDSRKGGDMELG
AFSDLVGFQNRRNVDNEVYILQSHRLMSEVVKRLHLTVNYSVRDGLRTLDLYGRSPIEVDFIDDDNQRLSLEVTELEDGR
IKLADFDDKYLTKQEKRRVIRGQYGDTIPTPLGQMVVHKTPFMDSTYVDRPITVTKSSPMVTTNAYRATVKSDVANKQAS
IVTISMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEGIKKSNQMIDITSEATR
SITESSKFKVEGLSIENQISVANYIRDYLNNPTHAGELIPMVASLTNNGIVAQITEYNDAILRRQKLLENSSERSPVIQD
MDNVLAAVRRSIIASLNSHVSTLEIQLTNMRKEEALANHRISTMPSQEKVLLDIMRQQKIKEELFLYLLNKQEETQLNYA
VAESNSRTIDQAYGSPRPVSPRSMIILGISLLAGLAIPFGIIYLIGMLDTTIRGRKDIEENISAPFLGDIPFLEGENKGG
IVVRETGRDALSEAFRILRSNMTFMNVSSGKEIKCVLFTSSDPHAGKTFVAMNLAMTLAMAGKRIVLIDLDLRRHALSTT
LGRSNSKKGITSYLAGTITDIGELITPMEIHKNLDVICAGIQPPNPTEMLLSDRLDKLVAELRESYDYVFIDSTPAMSVA
DAVITDRLADLCIYIVREGVLDRRQLPDIERLYREKKFRNMCVVLNGTRTRRHGYGYRYGYGYGYGYGYGYGYDDYKETS
YRKRLKIFFSKIGRKIRNKK
>gnl|bykdb|R7A239 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. CAG:875] (length=802 residues).
MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHTLHVGDWLHIALANWKWFVLSLVVCMGASFWYIKRSPDIYSRSASVLIKD
ETRGAQLPNAASAFSEMDLLNIQSTVDNEVLIFKSKRLMIEVARKLKLDIFYSVKGKFRDWDLYTTSPVTLTFPEALETS
SFSFKVTPLNDKEVLLSDFPEMEGVKPVEQMKVHLNDTVATPVGKLVVTPTLYYTQDYYQVPVTVNKMNLEKVGMAYNAA
LQSMVASKTSSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKSQH
NLADISTQTGSFMERSNRYQQEGVTLENQRTLALYIRDYLADPAKSGELIPSNTGISDGTIERQIMEYNELMLQRDKLIG
NSSNKNPVVMDMNNSLASMKQTIVRTVDNLIAGLDMKIQNIRGEEERAMKRIAAVPSQQKYVLSVERQQKIKESLYIYLL
NKREENALTKSITESNARIIDPAMGSSVPVSPKTHLIMLAGFMLGLLLPACVLFVLRTSDTKVRGKKDLTDVLSVPFLGE
IPRREREKGEGNRSVVVTEEGKDAVSEAFRILRTNMAFMSGAADGKLQTLMVTSFHVGDGKTFVSSNLAMTLALAGYKVV
LVDLDIRKGTLSKHMGGSQQVGVTNFLAGTVDRVDDLLMPSGCHENLSLVCKGPVPPNPSELLLNARLNVLIRHLKERFD
YVILDNVPSHMVADALIVNRVADLTLYVIRAGGMDRRQLPEIELLHTEHKLKNMALVLNGVSRQRDSYGYYGYYQYGYKE
EK
>gnl|bykdb|R7DH52 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Tannerella sp. CAG:51] (length=802 residues).
MAAVQNNPKSKQSEEFMRIQDLLYLCASNWYWFALSLMITLGAAFLYIKVTPPVYTRSASILIKEDSKGKSLSADAGSFA
DLGLIQANTNVNNEIISLQSPAIMTDVVKRLHLNMDYHVDGGFYREVLYGRTLPINVSIDTPNDNESSALTVKILADSTV
ELSDFIRNGEELPGKLLKGQLRDTIMTPVGKVTICPTPYYTSQFSQPIYVSRSGLYSAVRRYAPNLSVVLNDEKSTVVDL
SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISSYKSEHLLPDVQAASSMYMAQ
VSETDAQLLALNNQLYMARYIRNYLGGESNKYQLLPANSGIENSNLGDQITEYNNKLLQRNSLVANSSDQNPLVIDLDHA
LAAMREAIIASIDNQVVTLNAQIKNLERSGQQTTTRIAESPAQAKYLLSVERQQKVKESLYLYLLQKREENELSQAFTAY
NTRIITPAGGSMLPTAPLKKNILLVAFVAGLLMPAIVIFIAENMNTKVRGRKDLENMTIPFVGEIPLAYHQDKQGSIFRK
KKLPETHTIVVKEKSRNLVNEAFRVVRTNLEFMLGKEGQSRVIMVTSANPGSGKTFITMNLAKSLAIKGKKILVIDLDMR
KASLSSYVDSPRIGISNYLSGQVENFSEIIVKGKVYPGLDVIPVGTIPPNPTELLFDLRLEQMLSTLKAEYDCIFIDCPP
VEIVADASIINKLSDMTLFIIRSGLLDRSMLYEIEEFYTDQRYKNMAIILNGTSEAYGHYGYRYGYRYGYNYGYGKGYSE
EN
>gnl|bykdb|R7DY01 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides intestinalis CAG:315] (length=795 residues).
MVEKKTPAGKPADDFIRIQDLWSMFVPKWYWFAVCLFITLAIAVLYLLSTPPIYTRTAAILVKDNSKSSSSTSSMSDFSD
LGIFKSNTNINNELLTLKSPTLMTEVVSRLGLNETFTVRRGLKKVDLYKAAPFTVTFRDQPEAPLSFTIEFSSKDTFTIS
DLKVSDESTGETFSAQMGDSIRTSAGTMILHPAQKNANAFIDTPIQYVRGSVSAAADTYANTLVAELGSDDATIINLSIS
DASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAGYKSEHLLPDVQAASSLYMAQSAE
NNKELSALNNQLSTAQYIRRELNTKQLNQTLPTNSGIVSANIETQISEYNNLVLDRNRLIANSSEKNPLVKNMASSLQSM
QRTIIQSVDNLIVSLNTQIRSLRRVEDATTTRLASNPNQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRL
ITAPRGSMFPTAPRKMNILLVAFAVGLLVPAVIIFMKENMNTKVRGRKDLQNLSIPFIGEIPQYSGTKKKWWELKHRRRQ
DLKTVVVNEGNRNIINEAFRVLRSNMDFMINKDSNQHVFVLTSFNPGSGKSFLAINIAMSFAIKKKKVLVIDGDLRHRTA
SSYVDSPDKGLSNYLNNQVENWKEIIVPYKEYANLHILPIGTVPPNPTELLENNKLATLIAALRPEYDYIFIDCPPVDIV
ADAQIIEKWADRTIFIVRSGLLDRSMLPELENMYTEKRFKNLSMILNGTEGAGGRYGYRYGYHYGYASYYGDKEK
>gnl|bykdb|R7HN19 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:279] (length=812 residues).
MKEDYNSIGAAETEDQKNEFQLSDMISWTLCHKKFFAISIVICVALGLIYAQRAQRIYQRSASVMLRSDNKGQAQISELA
AFADLGIGSTGIDVYNELQAFQSPLLMQDVVNQLRLNVTYKSKNWIGYVTDWYDKTPICVEYKNLPDHVGEQPLNSVTFV
AKKEGQSQLTVKDFKINGIKSDAPAQTVKLGQPFKTPVGTVVLKATKEYGKNFEQAVIVGYERPELTAKSCQARLTAELA
DKLATVINFSYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIERFKSSNRLLDMN
AETAQVTQESSKYSEQAFLANNQLAVARFIREYLVDNTRQYDLLPSNSGVGSQAIEEQIAEYNKKLLERQRLVANSSDSN
PLVSDINNQLRMMRSTILRSVDNHISALKIQADRLSAQENAIENRISAGPGKAKELLTIERQQKIKEELYLYLLQKREEN
ELQASIVVNNTRLLKPATGDSVPVSPKKGIILAAAFILGLAIPYGYMFASNMLNTKVRSRKDLEGMEVPVLGDVPLADGA
KKLSLMSRLLKKENESETPHIVVEDHNRNVINEAYRVVRTNLDFMIGANKSEAIMATSLYPGSGKTFTSVNLATAMALKN
KKVIVVDLDIRKGTFSKIVNSPSTGVCAYLNGQVSLDDIILPSKTTKLLFDSIPTGHLAPNPAELLLSDRLQAMIDELKQ
RYDYVFVDCPPITMVTDASLIAPHVDRTIFIARAGLIDRRTLPEIDEIYKENRYKNMCLLLNGSDESGTYTRYGYGYGYG
YGYGYGNDTKKQ
>gnl|bykdb|R7JGW9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Alistipes putredinis CAG:67] (length=816 residues).
MTPNNINPNSANSDTKQEEHITFSVHDLIQTVIANWYWFVISVFVCVGCGYIYILRTPKIYSRTANILVKDSRKGGDTDL
ATLSDLAGLSQRRNVDNEIYILQSRRLMTEVVKQLGLTVQYETKDGLRPQDLYGQSPIAVEFINDNDRQGFRFEVSLRPD
SIVKLNYFEIFGPDKQKFKQEISAVFGDTISTPVGQMIIRPTLYMSPDYYEKAPIRVTKGNLGVVTQFYQHEVKSFVANK
QASIITISMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEKFKKDNKIYDIVSE
AEQTITESAQYKTDGLSLENQIRMTEFLKEYLLDPTKTNELIPGTLSINSPAINSQIEGYNTELQRYMKLNSESSENNPI
IQNLGNGLASTRRSIIATLDSYISTLQIQLAALRKEEALTNQRISSVPTQEKQILDIVRQQKIKEELYLYLLNKREENAI
TMVITESNSRTIDSAYGSPRPVSPNTVLIAGIAFLFGLGIPFLIIYLIQILDTTIRGRKDIEDNLSAPFLGDIPQYSGEK
QRGSFVVRENGRDPVSEAFRMIRSNMNFMNLGKGEIKVIMVTSSNPHAGKTFVSTNLAMTFATTGKKVVIMDLDLRRRTF
SKQMGHGGDTNGVSSYLSGSTELQAIIRKSKLSEKLDIIYAGIQPPNLSEMLLSQRMEELIAELKLHYDYIIIDSTPAMA
VADAIITDRLADLSIYVVREGLLDRRQLPDIERLYREKKFHNMAIILNGASSTKRHGYGYGYGYGYGYGLDEEETTTKKG
FWGKLCEWTRNKFQKK
>gnl|bykdb|R7LG80 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:891] (length=806 residues).
MNNVPDTFKRDEEEMQIIPLLKLCINQLLRNWYWFLLSIVICLGLGWIYRQSQPSVFKQQSVILIEEADSDPRSRMVKGN
MSGLLELNGISVGDNLKNEIFILSSKRLMTRVVDKLDLDVDYLMPVSLHKVALYKNERPIEVLFHDSLPSENPIPKNMIV
SLKIKKLDQNTVEIKGFRNKKGKKTDEKIKANFGQTVKTPAGRLSVVRSKMFNKWEDEEITVNRNSVSATADALRKRMDV
AQIEKEASLIGLTFQDINPKRAVDVLNTLYNTYKEDVVENKNRVALNTARFIDERLKLIGTELSDVENNLASFKKRNSVL
DFETTAQSITQESSLARQKTLEAETQLNVAQYLYNYLDNQTNDRDLIPALSLKDASFNTTIDKYNQLQMQRNQMANNSSD
DHAVVRELDKQLHQMRQSIKASVANYISTCKLQLDDAKAAENMLTGRLAGAPEQEKLGIDIVRQQKLKETLYTYLLNKRE
EVAMKQAINEANVRLVEGPMGSDIPISPRTMVILLISLVIGVMIPAFIIWLRIAMDVSVRGRKDIEDNTTIPLLGEIPNI
KDSDGKTLITDLPSDDPIVEGFRIMRYNLGYMRHNTQVMICTSTTPGQGKSFISRNVASILAMAGKKVLLIDADIRKGTL
SRNFGQAFGLTTFLSDEHTQIDEIIQKDHLTKGVDFIPAGNIPPNPSELLMSKRFEEMITALRERYDHIIIDSTPLFSVA
DASITSRVADITLFVIRAQVQDRNFLPELERMYQDNRFKHLSIVLNDVNMKSDGTYGQGYGYGYGYGYGSHTKQKRSLNV
LRRLRR
>gnl|bykdb|R7PCR1 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Prevotella sp. CAG:617] (length=799 residues).
MANNTVSSTVNQAELKEESINFQQIIGICIVILQKHWMWFLTSVVLFVVLAFVYSRTQPQVYQRTAVLEIEDNNDSGSMG
RAGRGANMLLELNGVSVGNSLQDETFILQSYRLMERVVSRLGLDVSYDTKDGLRPISLFSIRPFNVVFQAPFSKALAFDV
KILDENSFELKNLQFEDFDSEFNYKGTFGRPFSTPVGKIVLNKNSQYISEFVGKKISITRISVKDAAKIYVKRISATPVD
KQSSLIQLVCQDVNKKRAEVLLSTLLDVYREDIIESKNRVAENTSKFIEERIGLIEQDLIKVEGSLARFKEKYNIVDFQK
SAEAFLQQQGTARNLALDYETQLSVARYLESYLHSKSKDDEFIPMLDLGDAGIQQEISAYNDILIEKKNLEQNSTNSPVI
RDMNEALKAKRASILAGVRSYVNSVSLKAQKARTNENVLNSAMSEVPQKERQANDIQRQQILKENLYNYLLNKREEVALQ
LAINEANIRVVEPPYGNKRPIAPRTMIFVLVGFVIGLALPSAYFGMLYSMDTALRSRKEVEDAMSLPIVGEIPRWEMSER
SMRDGIKNLIAMDQNNNSVAEAFRLLRYNLNFMVGKKDSKHVIMLTSSSPSQGKTFVSRNLSHILAQARKRVVLIDADIR
KGTQSSLLGHGQGLTAYLNNDTDSYEDLLIRDKTDFDFIPSGIIPPNPAELLMNSRLEELIGKLKEVYDYIVIDTTPAFQ
VADAAIVSRVADVTLFVMRIGVEDKRIMPEVEKLQTSGKIKNMCIVLNGCRMHNGYGYGYGYGYGYGYGYGYGRQSQKK
>gnl|bykdb|R9I0H0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sartorii] (length=806 residues).
METKKTTTSSPKENVITLRDIVELFLNNWYWFAASAVACVAMAWIYLSATPPLYQRTAVMLVKGDSQNSQNDISAMWEVS
GGLGGSGVENEVYILRSYQILNDVVQRLHLDVDYTIRDGLRRDNLFGDLPFEVRFLDIYPGFTELTVSIINEKGVRISQL
EIDGNAPSYEQVVAFNDTLSTPAGRILVLPHAESIPHYQGKEIRVTRSDLESATNAVMARIQTSALASQSTLVNIICQDV
NIARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTTFKQEHRIVDINSNANLYLQEGSKAK
EESIQLEAQLNVVEFVKNYVTDKTRSSDLIPNVSGVGDVGVQSQIESYNEMMLQRNRLVTNSGENNPVVQNMNRNLDAMR
KTIAGSIDNYVRTIRLRLQNARKVENKVNQNIENIPQQEKYALDVMRQQSIKETLYTYLLQKREETAMQLAVTEANIRVV
EAPFGSRLPVAPKRMMILLAALVTGLVIPFVYFRLREFWNTGVRGRKDVEDMTTLPVLGEIPARKEGMGDGQIVVSENKN
DRITEAFRLLRANLDFMNKGAKVLMFTSTMAGEGKTFVSRNLAVILAGTGKKVVLVDTDIRKRTQSKLSGAKCKEGVSTF
LSGIYTDISELIIPAQLHPNVDVLPAGSIPPNPAELLMSDRLELLIAELKKHYDYIILDNVPALVVADASIVNRVAEITM
YVIREGILDRRYLTELERLHREKKFNNMCVVLNDVKDKGKRYGYGYGYGYGYGYGYGYYTEDGGRKRKHVSSRSSLLKRL
FNKKRI
>gnl|bykdb|S0GLB0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii dnLKV18] (length=795 residues).
MNPEQETNMLREEENELNLIDMYRVVRANWYWFLLSVAVCCAVAVLYLGWAPKIYQRTATVLIKDDTKGGGAASEAAVFE
DLNMFNMKRSVDNELLVFKSKQLMKSVVKRLDLDISYSIREGLRTVELYSHSPVVVRFPEANENLEFGLTVVPVSDKEVS
LSGFFSEELEEEGQVQEDQTLTVALNDTVSTPIGKVVVTPSLYYTDLYYGSEITVSKSNQDRVALDYNESLQVVLASKTA
TILNLSLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEVFKRENQLTDIHSEAG
MYLQEGSQYSQEGLGLENQLTLAKYIREYLTDPHKGADLIPANTGISDVSLESQISEYNTLLLKRDKLIGNSSNRNPVVM
DLNNSLGAMKQTIIRAVDNLIVGLNIKIKNIREREVQTTRRIAAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQ
AITESNARIIDPAQGSEKPVAPKSMLVLLAACVLGMVVPSGILWVQLTMNTTVRSRKDIEDNLSVPFLGEIPSRNRKDKS
EILVHENGRDGVSEAFRIVRTNMEFMRVKAKDLKVVMFTSSNPGAGKTFVSMNLAMSFVLTNKKVILVDTDIRKGTLSAR
ISHAGAGLTHYLSGRVDDVDKIIAPSGINDRLDVIHAGPVPPNPSELLLSNRLEELVNTLRERYDYVILDNVPAGMVADA
TIVNRVADLTVYVIRAGLMDRRQLPEVEKLYKQEKFRNMAVILNGINMKRAGYGYGYGYGYGYGYGNEKSQKHKK
>gnl|bykdb|S0GSI7 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Parabacteroides goldsteinii dnLKV18] (length=786 residues).
MNSEQETINLRREENELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEE
LNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILL
SGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDV
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
KEGLGLENQVTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLIGNSSNKNPVVMDLNNSLSAMK
QTIIRAIDNLIVGLNIKIKNIREREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI
DAAQGSRSPVAPKSMMILLAAVVLGLAIPAGIIWLQMVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGSTNMGIT
NYLSGKVDDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLEALIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
TIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGYGNEKKK
>gnl|bykdb|S3Y344 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides stercoris CC31F] (length=808 residues).
MRKDRFEDLDFIDFNDSRRQEGTVIADMLSAVYRNRKWFILSVAVCVLIGFLYLKSSPKIFLRTATVLVKDEQKGGGVNG
AAAFQDLFSLGGSTVDNEVGIFKSKRLMRTVVEILHLDISYKEWDGLRKKELYTSTPFAVTFLDATPSQQISLTVTMSDN
GKVTLADMTLQNEEEEEEFDEILTVQPGDTVNTPVGKMVVASTLFTDENSIGKTVYVTKGNMKEVAESYNKALNVGVANK
QSSLIALSIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIENYKKKNRLTDIASE
SALYLQSSSMLDTEGLSVENQLNMAQYMKEYLQDNSKTTEPVPASIGIDDMGVQNLIMEYNTVLTRRNKLIANSSANNPL
VRDLNGTLMSMRLSIAKAVDNLIASLEIQVANMKNKERENSNKIAFVPTQLKYVVSIERQQKIKEELYLFLLNKKEENEL
QLSITESNCRIIDPAEGVDLPVAPKKVQVALIALLAGIMLPALWIYIRSLLNTSVHTKKELKAGVNIPFLGEVPLEKNKH
EKDIVVQEGSRESICEAFKIVRDNLDFMDTEKKTVGKVVLVTSANPDSGKTFITLNLGMSMALANVKVVILDLDLRKGSL
SKSVGIGMKKTGVSNYLSGKVDDVKELVQVCGDDNRLHIITSGALPPNPAELLKSGRLDRLLEELKKNYDYILLDNPPYG
VVVDTQLCGRLADQTVYVVRSGLFDKRMLPELQELYDSGKMKNMSILLNGIDYVKTGYGYGYGYGYGNYGNDENRKNKKP
LYKRIFGI
>gnl|bykdb|T0NN57 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis 502] (length=794 residues).
MNMASQKINMTKESKEQFINVLDLLKYLLHHWKWFALSILIFGGYFYYQYSKSPFVYSRSEVVMIKTASNTPTTARITRS
SVASSVSVKDEILQLKSKELLRQAIDRTGSDISYKVRYGLREYELYKKSPIYAKVLGKRAEDSYSFVITPIDSRSVIIKN
WSKNGNEKEIKVSINQSVKTPFGEVLIVPSKFYGTDFYGKDIQVTKYPREAMMENFKGKMKIAQMDEDASLLQITMEDQS
PERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLKIANKGVDVEAAGGMYLSESNQYKT
EKTKIETDIRLAEMMRSYLVNKNKRNDLIPNNTGLVDASVEGQIAEYNMALLKRNRLAEGGNTSNPVVMDLDEALGAMRN
NIGRAVDNSLRGLAIKQGNAQREENIAQGKVLQIPQKQREMLSVERQHKVKEELYLYLLNKREENALNEAMTDESIRIVD
PASGSESPIYPNRLKKIFTGVAVGTVLPAVILLAMLVLNTGVRGRQDLENVLSVPFLGEIPLARNRRQGNGDVLVSQSGR
DPLTEAFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGT
SHYLSNPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVAD
LTLFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEENKKSVFDWFKRS
>gnl|bykdb|T2NDT6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis JCVI SC001] (length=822 residues).
MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFFLSLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMIGNSEVENEILMLKSKRLTAIVVDKLDLDVSIYKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IQINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLNTTLFFADSWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKRNNITD
ISTDVGTYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYDRLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNKEMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSSEPISPRKPVIFFAAFLLGLVIPSSFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSHDLKAVMFTSANPGSGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSV
PAMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQG
KKLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|U6RF62 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides massiliensis B84634 = Timone 84634 = DSM 17679 = JCM 13223] (length=790 residues).
MIEKKAAAGKPADDFIRIQDLWGLFVPKWRWFVLSLFVTMSVAVLRLMSTPSIYTRSAAILVKDDSKSGSSGGAMSEFSD
MGIFRSNTNINNELFTLKSPALMTEVVRRLRLNETYTVRKGLKNVDLYKANPVAVTFGEVMEKPVSFTIRIDSKDAFTIS
GLKVAGVESENSFAGRMGDSIQTAAGTLFISPTKFYSDACIGTSIRYAIGKADGAADRYLNALRVELGSKEATIINLSIN
DTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISSFKSEHLLPDVQAASSLYMAQSAE
NKKELLTLNTQLSTARYILKELKEKSLSQPLPTNSGIANSNIENQISEYNNMVLNRNRLIANSSEKNPLVKDLANSLQSM
QRTIIQSVDNLIVSLNTQIRSIRQQEVTTTSQLASNPSQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
ITAPRGSMAPVSPQKMNILLMAFALGLAVPAGVIFLKENMNSKVRGRKDLEHLSLPLVGEIPLYGCEKKSIFGRKPLRNK
RVVVVEEGNRNVINEAFRVLRSNLDFMVSNTPEATAFAVTSFNPGSGKSYLSANMAISFALKGKKVLLIDGDLRHGSLSA
YINSPQLGLSDYLSGRIGNWEETLVSHDKYANLKMIPVGTVPPNPTELLENGKFAGLLAQLRTSYDYIFVDCPPIDIVAD
TQIIEKATDRTLFVVRAGLLERSMLSELENIYREKRFKNLAMILNGTERSHGRYSYRYGYHYGSYYHSGK
>gnl|bykdb|U6RJK5 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. HPS0048] (length=821 residues).
MSTEQKINKESKASKSSEKEEEINIADILQLIWSNRYWFILSIFLCVGIAFFYLQSSSKIYSRKASVLIRDDSKGGGISE
SSAFADLGLFGGKRNVDNEVLIFQSRHLMEEVARRLHLDISYKIKEGLRNKELYTHSPIILSFPEAEERQSILVTVTPID
SARVRLSDLKMSVGDGEVTSNEVLEVNLHDTIQTPVGAMVVMPTLYYSDNFYEKPISVTKSNMERVVDAYQSSMEVSLAS
KTATIINLTLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEAFKRENQLTDITS
ETGMYLANTSLYRQEGLSLENQLSIAKYIKDYLVDPQKNADLIPANTGISDNSVESQISEYNEMLLKRDKLVSGSSSKNP
IVIDLNNSLAAMKQTIIRSVDNLIVGLNIKLKNNREHEEQTQKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENA
LTQAITESNARIIDPASGSSKPVAPRTMVILFAAILIGGAIPMIFFWLQKTLDTKVRTRKDLEDALSVPILGDIPQCSEK
DRKESPIIVHENSRSPISEAFRIIRTNMDFMRVKTENLQVVMLTSSNPGAGKTFISCNLAMSIAQMNKKVILVDVDIRKG
TLSNIFTDIPARMGLTNYLSGKTDKIEDIIITNDKYKNLDIIFAGPVPPNPAELLLSERFDRIVTELKKHYDYVILDNVP
VDIVADASIINRVVDLTIYVVRAGIMDHRQLPNLERMYELDKLRNMAIVLNGVNYDRKGYGYGYGYGYGYGYGYGNDEGR
KSKNKSLTKRLKKRISNLFNK
>gnl|bykdb|U6RSB0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Bacteroides sp. HPS0048] (length=816 residues).
MNTEYKNNDVRKQEPEINITDILHLIWVNWYWFVLSVLVCGGIAFFYLKSSSKVYSRKASVLIRDDSKGGGMSESAAFSD
LSLFGGKRNVDNEVLVFQSRHLMEEVARRLHLDMSYKVKNGLRNDELYTHAPVTVSFPEAEERQVITVVVTPVDSVTVRL
SGFSLAVGGGGIHSEEVLDVHLNDTVSTPIGPMVVTPTLYYTDVFYGKPVNVIKSNLESVIEGYRARLKVSLASKTATII
NLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIESFKRENQLTDITSETGMYL
ANTSRYQQEGLSLENQLSIARYIKEYLTDPQKSSDLIPANTGISDNSVESQIKEYNDILLKRDKLVVGSSSKNPIVIDLN
NSLSAMKQTIIRSVDNLIVGLNIQLKNIREQEEQTSKRIEAVPAQQKYVLTVERQQKIKEELYLYLLNKREENALTQAIT
ESNARIIDAASGNSAPVAPKTMMIFLASIVLGLGIPMGVFWLLNVTDTKVRTRKELDGVLTIPFLGNIPRHGNNKGEDSD
GIVVRENSRDSVSEAFRIIRTNMDFMRVKAANLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKKVVLVDVDIRKGTLSGI
FSNSSNRMGLTHYLSGSTDKLDDIIGRSEEYDKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYDYIIVDNVPAGMVA
DASIVNRVADLTIFVVRSGVMDRRQLPELENMYRQEQLRNMSVILNGVPSDHKGYGYGYGYGYGYGYGYGYGYGNDTHKH
TKMSHVRKILSRFWKR
>gnl|bykdb|W0EQS0 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Barnesiella viscericola DSM 18177] (length=801 residues).
MELIQETKNEKKNEGGITLRDIVELIFDNWYWIVLSIAVCVSVAWLYLAMQTPLYKRTAVMLVKSENKSSNDMSAILEMN
GGVSVGSVDNEIYILQSHQLMREVVERLHLDVAYRVKDWLHYKSLYAESPIRVNFIDPYTAPVFMKIRPLDDTHYLLKQF
SVGGVKSEDREQEIAFGDTLVSEAGRIVVEAVPEYLPAYYNIPVEVSRISLDAASGMYHASASLAGERTTLVQINCVDSN
ISRADAILSTLIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTDFKQKNRIVSIDAAASQFMSENSQMRS
ELVQLEMEYAIAQAVQKAFSGKENNKQLIPNVSGVGDAGLQSQIEAYNAMILQRERLVANSGESNPLVRDLDSNLASVRE
NLSSSLNNYISTLKLKLGKARSVEEQTLSYIESVPQQEKKALGIIRQQNIKEALYTFLLNKREENAMQLAITEANIRVIE
APFGSSAPVAPARRMLLMGAFIVGLIIPLAIQLLRLLWNTGVRGRKDVEEYTTMPILGEIPLMKNDKDKDELAIVVGENK
TSSIAESFRLLRTNMDFVAPEARVIMFTSTMPSEGKSFVSRNFAVTLAMTHKKVVLLDMDLRKRTLSKTLDLTTKNGVST
WLSGKNHSIDELIQPSSVHDRFDMISAGIVPPNPSELLMSNRFPVLIEELKKQYDYIILDCVPALVVADASIIGRVADLT
IYVIRNGVLDRRYLPELEKLYRENKFKNLTVVLNGVEMESKKYGYGYGYGYGYGYGSEHGRKKKRNVIYKWAHKIVRIFR
G
>gnl|bykdb|W1R7P9 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Porphyromonas gingivalis SJD2] (length=822 residues).
MNLNEDSKNTFTRQGRSYISDTEDTAFFSLEEFFLSLLTSWKWIVASVLACLLIAYIYIQRQSPIYHAQATVLIKSAEKS
GATSGLQQFQELGLMIGNSEVENEILMLKSKRLTAIVVDKLDLDVSIYKQGFWRNESLYGNSPVSIQITDRDSTENYSFR
IQINDAHSFQLTHFEQKERNGIGDIKIDGSFGRPIATPVGELKLNTTLFFADLWKGEVLYVTKENTRKVVERYNQDLQVS
LADKKATIVNLSLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIETFKKRNNITD
ISTDVGTYLKSSADLQKDQLIVERNLSLAKYIQSFLRQTSTDNELMPANLGLTERGIDNSITLYNELKLKYDRLKQSSSE
NSPAVQEVGMQLVAMRKSINAAVDNYIKTLNLQLREVNKEMSRTKEQISAVPTQEKIMSTILRQQKIKEELYLYLLNKRE
ENALRLAITESNAKTVDSADGSSEPISPRKPVIFFAAFLLGLVIPSSFIYVKMQFDKSVRGRKDLEGLLIPFLGEIPTYS
GERSEEDLDVVVKPESRDSASEAFRILRSNMEFMRVKSHDLKAVMFTSANPGSGKSFMTVNLAISIALTGKKVIVVDLDI
RKGSLSKRLGLGNIGVTDFLYNNSISVDSLITKFPQNENLDLVLAGCIPPNPAELLLSDRLDYLIKELKSRYDYVFLDSV
PAMSVADAMITNRVADLTIYIIRQGVLDRRYLGEIERLYTENKFTNMCLVLNDVSYSGSRGTYGYGYGYGYGNKEYGKQG
KKLRRRSAKKTKKFKIGPMKKS
>gnl|bykdb|W8F1I6 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Hymenobacter swuensis DY53] (length=816 residues).
MAAKEDAELEELIRNAGAEPEEEEEGGSLDLTTLLMVARKSLPWMLLLIVLGVTASWLFLRYTPPLYKAASTLKIDEKSE
AGVLLGDIGQAAEQKQTLNKLSGEIELIKSDIIYRRLKDSLALDVNYYVQGTVLESELYNLSPIRVEYKAGKGALFNQKI
GFQLLENDRFRLQLPNGGTETGELSYGQPIEAAGFTLQVYKTPQHANADPEANYSFVINDDGTVNGYLNQNLAVEIVNPD
ASTISIAFTDHNPVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQDFVRRSRVFDVKSEA
SLVTNQLTAQELEQEQLQEQADMLAELARLIEQERLTDREDGDVFQTIPALSTIKDGQLTQRIIELSDLQLDLSQLLKSY
QETTTAVKLRRSEIANVKSIIRELLRKNQQLVRRQLAKMAEKKADLEAKLGGLPEKQTEQARLARPLGLYEKYNMLMMDK
KIEYGISMAGITADFQILSPATVPSVPISPVKLMVYAIGLAAGIVLGLGLIAVRYLMHNTVTNIRELERNTSASVLGVIP
TYDKEKMAVSKLVVDRNPKSAISESIRSIRTNLEFISTSKKKRLISITSTISGEGKTFVTVNLAGIIAASDQRVVILDLD
MRKPKVNLAFDAENVQGVSTILIEKHTWQECIQHTSIPTLDFISAGPTPPNPSELILSARFDELIKSLHEQYDVVIIDTP
PVGLVTDGILIMRKADVPIYIVRANYSKKSFLKNINKLIRANGFTKLTTILNDAQTTGGYGYGYGYGYGYGYGQGYYEDP
GVAPKGLLSRLRKRFS
>gnl|bykdb|X5K347 [Bacteria] Bacterial tyrosine kinase [Bacteroidetes][Elizabethkingia anophelis] (length=791 residues).
MASQKINMTKESKEQFINVLDLLKYLLHHWKWFALSILIFGGYFYYQYSKSPFVYSRSEVVMIKTASNTPTTARITRSSV
ASSVSVKDEILQLKSKELLRQAIDRTGSDISYKVRYGLREYELYKKSPIYAKVLGKRAEDSYSFVITPIDSRSVIIKNWS
KNGNEKEIKVSINQSVKTPFGEVLIVPSKFYGTDFYGKDIQVTKYPREAMMENFKGKMKIAQMDEDASLLQITMEDQSPE
RAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIENLKIANKGVDVEAAGGMYLSESNQYKTEK
TKIETDIRLAEMMRSYLVNKNKRNDLIPNNTGLVDASVEGQIAEYNMALLKRNRLAEGGNTSNPVVMDLDEALGAMRNNI
GRAVDNSLRGLAIKQGNAQREENIAQGKVLQIPQKQREMLSVERQHKVKEELYLYLLNKREENALNEAMTDESIRIVDPA
SGSESPIYPNRLKKIFTGVAVGTVLPAVILLAMLVLNTGVRGRQDLENVLSVPFLGEIPLARNRRQGNGDVLVSQSGRDP
LTEAFRILRTNINFMTKDEHPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKKVVVLDLDLRKGTLSSRTGLLHGKGTSH
YLSNPSIKISEILHKSEVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYDYVIIDGVPTGVVADASIIDRVADLT
LFIIRIGKMDRRQLPEIEKLYQEKKLSNLAIVLNGLKLNGYGYGYGGYGYGSYGYGYGEEKKKSVFDWFKR
© 1998-2019