BYKdb

Dataset for cluster tadcd of phylum balneolaeota

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bykdb|A0A1B6Y5X7 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp. EhC07] (length=777 residues).
MHYNGNSHNSSNSILSSHTNQQNSDDDQEIDLLKVFNVLFLYKWTLISITGLVTILSAIYASMQIPIYESKGTIIISESK
NRYSYAGAGIENLLTSTYGIGVGSTIANELQIMQSRQLSLNLAKRINDIEFDEHGRKFPILWKNYPEDSTSIDIESIASR
FRSNISFEKKDPNADIVEISYTSPLPTEAATIINLTMNTYSALSTDQNRNMAVSALDFLSDERSRLKEELISTEDSLQLF
MNRTMLVALDPQSEKLVSSIASIEVEKQNLEVELVAVNSGIEQYKNQLNEIKPGLANQYSEAIGPIIERYQYALAELETN
KLLLLTKNPDISENNPEIVRIDRQIEQVKKQIKDRTNALLTSESDLYLSFIGSGEETVTQRIAEITKTLLELEVKRTQLQ
TQGDVINDRYQKTNTRFEKLPDEIIQLARLKRNVRVTEEMYLQVSAQFAEMSLWEKTQFGLGRPLDYAIPTKAPIKPKKK
IIILAGFLLGGVLATGCVLVLEMMNDRITSTDVLRDFNKPVLGAIPDFSVVGEFNPNERQYIGDKSISNQLVTFFDHISP
ISEAYRRLRINVVYANPDKEYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDA
LFDASIDVRLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKAEYDHIILDTAPYGIISDSASLLRLIDGLIVVSR
FNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSEYYKYR
>gnl|bykdb|A0A2D9FS21 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp] (length=794 residues).
MDSSSNEHHYPHKNGNNNGFYTGPNFNSGNNFQQNAEDDEIDLFKLFSTLLQNKWTLLVFLGVFTVIAAVLAISQTPIYK
SEGTIFITESENRYSYAGSDLSNLLTTTYGIGAGSTIANELQIIKSRTLSEDLADSVLAKKFTESGHKYPVIWRAYPDDS
TTIGRDTVAMRIRNNLTAERVDQQTDIVSIGFESPLPEETAYISNLTMDTYSRLSTAQNRTMASSALSFLRQERSSIEEQ
LRETENELQAFMDSSNLLAVDAQTEQLINNISTLETKKQEIEVQLVSVNSAISTYENQLEEVKPGLADKISESLGPQLTN
FQFRLAELQTEKLMLMQRNPELRENPEHPELVKIENQIEATQDQIKSIANRLINSSSSLALSFLGSESGGIAEKIIQINE
KLIQLRVEKSQYEAQIEALTKRAAMFNRQFDGLPREIIELARLKRDVKINEELYLLVSNQFAEMNLWERTQFGMGRPLDY
AVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALRSYKVPFLGNIPDFNIIDSFDPGQKQYVQGKPV
SNQLLTFLDHISPISEAYRRLRINTIYANPDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAEKSVLIIDLDLRRPTMHK
IFGENKEPGIVEMLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDKYDHIILDTAPYGIISDS
ASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLNAFDPKKSSDYYTNYYYYKRAYSDYYEEDKA
>gnl|bykdb|A0A2N0VGH6 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Rhodohalobacter barkolensis] (length=780 residues).
MSDIIRSDREGRGPNNGSKFEFVPTTPMSNQAQENSLNPKYLVSLILKYKWLILLFVILGGTGAWFYADTVTPTYESTGT
ILINAGTSGDDELSKIISQTTGVGTSSTLANEVQVLRSRDFARQIARSLIEEEPGDYRDFPVLWNEDENGNISRASEEAV
TGRIRRNLSIVRPERDSELLEVSFESPSPIETSHISNKAMEIYVESSTQENRRAAELTAEFLEREKRDIEQKLQESERRL
QEFMDNTGIVQMDEQASGIVTRQTSIEMELQQVNLELESVNQAIQNHEQRMESLKPGLSEQFSEAVGPRIRNSQEQLARY
ESERTLILTKNPNVRERETTPPRLKYLDEEIERVKNEIRELSAQLFTEDEEYTGMDSEERAQMIATIQTRLTELRIQQNQ
LQSRSQALAQSKEEIDQDLNSLPEGMMQLARLQRDVALNEELFVNVSENYAEMSVLKQSQFGFGRIVDSALTPTIPVSPN
KKILLIIGIMLGGIVSGGFIFIREFMDNSVNNLEMLKTSYLPLLAAVPVLDKVSKKSKKSFKNGSGKIPDELVLLRDRSN
LASEAIRRLKNNLIYQNGDYPPKTIAITSAEKGDGKSTVVSNLAVSFAEDGYKTLLIDTDFRRPKLHSYFGHDNESGLTD
YLSGRIKLVKLMKDTDINMLKLITSGGRHEAPDTVVNSKKFNDFLNQMEEVFDIIILDTPPFGIVSDSTALLKRAKSTVL
VTKYRKTNRGVFQKTVEDLERINANISGIVVNGFDHKKETSGYYGSGYYKSMYESYESYV
>gnl|bykdb|A0A2N0VKD0 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Rhodohalobacter barkolensis] (length=788 residues).
MGQFERGNGFSANKNLYNGDYPNELDPDEIDLIKLFSIILRYKWIIAGITLMFTIASVIYSYSIIPVYESDGTILIKDDQ
NRYPGGGAELSNLLSATYGIGMGSTLSNELQVFRSRSMSFTLANRVIQEDVMKNGSRFPILWRAFPDDSTVVTRDSVATR
IRNNMDIVRQDQDTDMLRITFKSYSPLEAAWMVDQAIEGYTDLSQQQNRGAASSALDFLERERELIREELNENEQRLRVY
MNETGLIQVDEQTSAAIERISELEAQRQELQVRKVAVTSAISAYEQQLDEIKPGLADQFSDNVGTTLERYQYRLAELETE
KLLLLQRNPSLRDQPDQEPYLVEIEDQIQLLRREINRIASTLVDESADAYIGFLSNTDNGIAGRITELRTQLIELRIEES
QYLAQETAIDERMAAENEFFNNLPDNMIELARLKRDAEIQEELFLTISQQYAETALWEQTQFGQGRPLDYAFVPDKPTEP
KKRMIVIVGFLLGGIVSLGAVFTRELFNNTLDSVDHLKERGYPLLTVIPDMTNRMKEIFGDSKTVTIQGKSISTSLLSIT
DSISPVSESFRRLHNNIIYSHPDENFKRILITSSAKGEGKSTVSTNLAVILADSGKKVLIIDSDLRRPNLHKLLGENRIP
GLIDTLFNDDIELSQVIRETVVPNLDLLTTGQEPPNPSAVLQSEKLKGLIDQVEEHYDHIIIDTAPYGIITDAAPLIPIV
DGVVLIARFGETPINELNQSIENLERVHAKIIGTVLTAYNYEKSGDYYTRSNGHYDYQRAYKDYNRSI
>gnl|bykdb|A0A371QNR3 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Rhodohalobacter sp. SW132] (length=801 residues).
MSDNNVDPSSNYRSGSNNGNRGYYSNGSQQGRGDRGHSPDDEIDLKHLFAVLMRRKWAVIGITLLFTIGALAYAYNTIPV
YESNGTLLITESQSSRGQIGGDLSELLSATYGFGMGSTLGNELQIMRSRRMSNMLADKVMQQDLMENGQRFPVLWQEYPI
DSTVVSAGAVATRIRNNISYGRVDRDTEVVEIRFRSYSPMEAQWMVDEAINSYSELSTDQNRMAANSAMRFLEDERRQIE
ENLREKEEQLKQFMDRSGIVAVDGQTQQLITRISELESQKQQVRTRLVAINTAIENYERQIDEIRPGLAQQFAEGVGSSM
ERLQFQLAELETERMLLLNRNPGLRENPEREPQLVQINNNIAMLKEEINRVASRLVDESEEYLTFLRSSDGGIAGRLLDL
RTRLIELNVEKSQHEAQQEVLDERLTEENRFFENLPQNMVEFARLQRDVQINEQLFLTVSDQYAETAFWEQTQFGLGRPV
DYGMMPGRPVEPRTRMIGLIGLLLGGVVGMGYAFGREALIKVIDGTEKMRKLNYPVLSVIPDIKKVVKEKFKGDDTIPVA
DGRKVSSTILTLVDRISPVAESFRRLHNNIVYSQPDEKFQTILVTSSAQGEGKTTIVSNLAVALTEAGKKVLIVDLDLRR
PKLHILWKESQRPGLIEVLFEDVTLEEAIKPSAAPGIDLLMAGTKTPNPAAINQSEALRKLIIELKERYDHILIDTAPYG
IITDAAPMMRLADGIVVAARFNKTKETQLEHTLGNLERIHANILGTVLLGFDHHKSSDYYYGNDNYYYAYEAYDEYHKEK
A
>gnl|bykdb|A0A371QRZ8 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Rhodohalobacter sp. SW132] (length=782 residues).
MSQSIQKNNNGNGEDRNGYDQISTFSIPKQDQNDGLDPKTIVFTIFRYKWLILLFLIAGGTAAWFYADTITPEYQTTGTL
LISSPDRGGQNELSRIINQTTGGTNATLANEMQIIQSRSFARQVARKLMEDDEVDINELPAFWRESDDGSVYQRELEGVA
NSIRSGIKLQLVNRDSDIIEVSYISESPVETATMVNAAMNVYVEQSTAQNRQAADSTTSFLERERAELKSRLAEAEQELE
NFMDRTGIVRVDNQATSAVNRREQIRAEIEEVQLDLEATELAIQNQEEELERIRPGLINDFSEAIAPRIQGYQETLREYE
RERYLILSNYPNVRQREEPPSRLKFLDEQIDDLKERIAELSSEIFSEEDEYMGMETAERTRMVTDIQNRLVELRLQKNQQ
ESRIQVLEERRREADDSFRTLPNEMIQLVQLQRNVEEQEQLYLDVSRQYAEMSTWRETRFGNGRIIDLATVPGGPISPNK
ILILMMGIVLAGMVAGAIILVREFFDNTISSIGTIKTQDLPMLAAIPSLKKISVKNGNGSGDYKVGKGKIPNEMVLFRDR
SHVISESIRRLKNNIIFQNSDNIPKTIAITSSEKGEGKSTIACNLAIAFADEGYKTLMIDTDFRRPRVHTLFGLPNEKGI
SNLVKGDSAASEIIQSSEIKFLKVISAGSNILRPESIVNDKKFNEFLEKMDKLFDVIILDTPPFGIISDSTSLLRKADAT
VMVAKYRKTNKEVYMHTLDELRRINANVCGMVLNDFEPKKDPASHYGSGYYKSLYDGYGAYA
>gnl|bykdb|A0A3M8G9D1 [Bacteria] Bacterial tyrosine kinase [Balneolaeota][Balneola sp] (length=777 residues).
MHLNGSNGTPKNPSHIENNFSSEEREVDLLKLANLLLLNKWKIIAITSVFTIGAMIFSLSLTPIYSSSGTIIISESKNRY
SYAGSDLSNLLTTTYGIGVGSTIANELQILRSVSLSYQLAEKILEIQKDETGNIYPIVMRSYPDNPVSTSVDTVAMRFRG
LISFSQIDPEADLVRISFESPSPYEASEIVNMTMDTYSSISTDQNRRMAVDALTFLRGEKSKIQEQLEVVEDSLKTFMDQ
SQLIAVDPQTEKLIVNISGAEVERKEVEIALVAVNSSLEEYQQQLNEIKPGLANQYSEAFGAIIERYQFALSELETEKLL
LEVKNPNITDEHSEIIRIQSQIDQFKLRIKSVTDDLLENDSALNLSFASRGDGSVMKRLAEISEKLIELEVEKTKYKTQL
NFLNEYYESLNLEFEKLPNDIIELAKLQRNVKINEELFLLVSSQYAEMSLWEKTQFGLGRPLDKALVPLEPIKPRKKIIT
IIGFFFGGFLAVGFVLIRNLIDDKITSTDSIKDFKLPLLGTIPDFSILDGLDSNERQFIDDKSVSNQLITFLDHISPISE
AYRRLRINVVYANPDKVHRVIMVTSATKGEGKSTLAANLAVTFSEAEKSVLLIDLDLRRPTQHKIFGENREPGLTDSLFE
TIKISDITRETIAPNVDLITVGKKTPEPATVLDSKRLKQLIDKLSERYDHIILDTAPYGIISDSASLLRLVDGIVVVSRF
NVTTKRELKYTLEGLNHLNADVLGVVLNAFDPKRSTDYYTNYSYYKRTYSEYYQEEV
© 1998-2019