BYKdb

Dataset for cluster orphancd of phylum calditrichaeota

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bykdb|A0A3M1A6F3 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=256 residues).
MKLSKLQKLPSLDKIIKNNNHEKIYRGYYKDSAFNAESERVLSKIDTFRRGRTKQSVMVTSAILGEGKSTISSHIALASA
RNRKSPTLLIDLDLRRPRIHEIFGQNKTPGLAEILSRKLTLHSCIRDSEIENLKIITSGSLQGNPLNIINAETIHAFFNE
IYKYFDFIVVDAPPVIPVSDPLILGKVVDHVVMVVRVGKTPKPIAKRAIEMLQSVEVNILGIVLNDVDSLLPAYYNNRYY
KYPYYSEVEESNNNLE
>gnl|bykdb|A0A3M1AUM6 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=235 residues).
MQSFVGNIVDYFEEESPEATEFRRLYSKLQNLYSGQNIKNLLITSATMNEGKSTTAALLACTIARYRETKTILVDCDLRR
PRVHQLFNLAKEDGVADVLMSKRRLDACFKQSPLENLKILTSGGIVDNPTELFNSSKMKDLFSEIKFYFDAVIVDSPPIN
PVTDALILSSEMDGALMVVKAGKTPKDVVRRAVDLMRNTGLNILGVIVNNMKGVLPYYYDYKYYGYKYYTKDLKA
>gnl|bykdb|A0A3M1NH38 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=599 residues).
MVQKVIENLKNIISYKLDQTSRTVMTVLVKHRSPEMAALIANTLAKRFVELNREVARYKSDKIMEILENQLKIAKQELDE
ATQKLRAFQERYPWVRLSADAQMQIATITELEETEQKLQNKIRDVQGLLQKLEMSGNTLDLEEMLSLCNEMITLLSSSGE
LAREQFEYPLASVFSAEYEKLTAERRDLLASYAPTHPVVKENEQKIWALLEKVKKGARDYVNKLEQELVGLSQNLQVERK
KLRRLPATSLQYAELQREHDLKERVYSTVLVRYNQNKLESEVDISDVFIIDPAIPPPEQDVLFALIMKSLMGLLISVGIG
FIVAVIVEVFNKTAENVEELQEMLDIPVVGEIPMIKVEQGDGEGIQELRGKRDPKLITLDYSPTLASESYRDLRTKVLFM
NQNEDLSSLMVTSLRPNEGKSLTTANLAITVAQQKISTLLIDGDLRRGVLHNTFGNKKTPGLSDFLISSATVDFDNLSKL
IQPTFIPNLFLITCGSPIPNPTEMLGGDRFVAFLKLLRSRFGMVIMDTPPIQASSDAAILARYFDGVLTVIKAGSTDIGQ
LRQKLNEYPNLRKKVIGAVLNMVQMNIKKNQYQYSYYNY
>gnl|bykdb|A0A3M2FHF6 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=777 residues).
MNNNVPAASGDLAFKLKKIIRLLKRKKITLLSVFSVTFVVVFLAALKFGPQQQYKASALLQIDDKRALTSVGGARGRQQN
DSKLGLIMSRSFLKRVVDKTNFQFQVSGQPRYNVIDSVVLDDQLKYGKYLIKKDENNLKVFYTDPTKTIDEELVLETSVP
TDHKLSYGGFTVYFKKNFWENNKKIVFHLLKSSKAVEALRASIKPMFKNRARTMMEVGISGVDRFYITEVLNVLVDEFVQ
QNIDVKKYHTREVLTVLTTQLEQAKKDLDAASEELKRFRERNPYVGLAGEATAAVTRISSSENQKNEVLRKKKELSELIT
RLNTAAGDERYSILNELLAWLAANGSPTVPALASEYTTLNEERIRLANNYAPEHPTVLENKKKIRDLEKKVLYTANNFLA
QYDESLANIESMMRQEQGKIRSLPAKELQYAELQRKKNVADGVYSDLLIRHNKAKVADAVEVGDIIIIDHAVPPPRVSAL
GVFLKYGFVALALGLIISIGFVLVADFFDKTVRTADELEKAVPIRVVAKIPVVGTTKEITMEDFAKNKRIDPKLVTADYS
PTPMGEAYRSLRTQLLFNNEDKRNRSLFVTSLNPNEGKSLNASNLAITFAQQKIPTLLVDADLRRGVLHSSFACNKKPGL
ADFLYSSADINDENINKVIQQTHIPNLYLMSSGMAVPNPSEILGTQRAADLFKFLAERFGFLIVDTPPIMVTSDSVVLSR
YVEQGLFVIRAGQTNVESVKEKLAEYKNFEKRLFGIILNCAELDMKSDHYKYSYYNY
>gnl|bykdb|A0A3N5KHL3 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=772 residues).
MALEEFEILDQPQQSSIPIDFGKFIAGIWRRKWLILFLSVGMTIPFYFHAKNQVPQYKSKVVIQSKQYGSEEKSFFDAET
QAEITSQSFTERMARVLGLAILSSDTLYRNVSDVFAEYHTTSEPVVSRYKIEVDDLGVYYLYQKNETSRVLVDSANVWDA
VDALRNANGLSFRLQPTFVHQAGEFHFRVQPFSKGVKVIQLGIKMDFSRSGKFMIMEMKGENPNYITSELNRIADAYLIE
VQKLKSVDSDTYREALRRRLAAAETNMKVSEENLRNFYSQYPLSLDAEKTELMGQLKLNEQALRDLPLQRKQLTSLLARL
QAENNADYSAQYRRVVVNQIANYAAMSNEPEMTIYRQNLEQLEARYRELSGLYSSDNEEVKGLEEKIGETQAHIIQFASN
YRNVLAERESTLRREKLELESKLKSLPNDEYRLMELERNKKIDEDLFKFLYTEVQKLQVSEASQDRGVRILDYAVPPTKP
INPSKKSQIMLGGGLGLLLGLLLSIVIDLADRSLQSVKDVERHLKLPVLGTIPEVLFKDIPEYRDDQKAEQIDKQLVTHD
YSPTPIGEAYRALRTHLLFSKDTEQLRSLLITSICPEEGKSFTAANLAIIMAQQRTNTLLVDADLRRGVQHNTFNVPREP
GLTNYLSNKGTLNTLIHSTHIPNLSVMSCGSLVPNPSELLGSIQMKRLLSDVKRKFDFIIFDAPPLDAATDSVVIGTVVD
AVTIVLRAGKTNRKIAKERLEIFQNVPAKIIGTIINGTDEAILKSTYSYYHY
>gnl|bykdb|H1XXC2 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix abyssi DSM 13497] (length=778 residues).
MNNQKKSTDLNLTDSKMDWQHYIKLFKRKKWLMLLLFIFGFLFSAAFLYKISPRPVYQTQALLQFQDTRSLNELDSRRRP
DFESKLGILMSRKFLGKIVDDLSLVVRFSGVDRYEAVDSVFLHPNYLKGRFVLKKQGNKLLLFYTSQDHSIEDKKVLEVD
YPEDRLIVYGGVGLKLKDRYWQQHDKLIYTVNSRPRAIESLLSSLGYQFKNRARTLLVLTLKGEDRYLITATLNKIVDYF
VQENLNLKKYQTREVLSVLEEQLQTAKVELDRAAQELKQFREKNPWVGLTPDATGAISSVSALESQKSQLVNLKNELQSL
INRLQAKSGEERYSILNEIISFLGAQDAPTAPALASEFTTLTTDRSRLLASYAPSHPYVKENTKKLNELEKKVLLTAQNM
INAWNKQINDLEQKIVENTNKIKRLPAKELKLAELERQRAVTDEIYSSLLVRYNQAKIADAVEVGDVVVLDRAVVPLRIS
QFKTYFKIMLIGLVVGLGLSVVVVIVIDFFDKTVRSAEELEKAIPIKVIGKIPVIKTEKEIVDVKFDDAVRIDPKLVTAD
YSPTPVGEAYRSLRTQLLFNSDKKLRSVFITSLNPDEGKSLNAGNLAITFAQQKLPTILLDADLRRGVLHNSFACKKKPG
FSDFLYSNADITDENVRKIIQTTHIPNLYLISSGVPIPNPSELLGSTRAQELIRFLSHRFGFVIIDTPPLAVASDAVIVS
RYVDGGLLVVRAGKSNIVQLKSKIEEYQDLRKNLVGIVLNFAKEDMDHKKYRYTYYNY
© 1998-2019