BYKdb

Dataset for cluster tadcd of phylum calditrichaeota

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bykdb|A0A1F4MQ28 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix sp. RBG_13_44_9] (length=805 residues).
MEHTSAQGLDIRLIFQVIERKKNYLIGVVLFFLVLVLLYNFLATPVYQSSVLIKKEQIYDYRDPDPLNRIMSRQTTDEID
TEIEINKSRSVLEKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYEQWLGIESPWKEQLPRFENIQLKPDEVSHDYHLKL
FGDNQYLILDAEKDNVIMSGSDLNNSAFNLPNLIFTMQWSAASAGSEVYFNVQNLEIVVEQLAERISIRKIGKTKIFQLS
VKSDSPFEAQLLAATVVDKFREVRLEQKQQTVKYSYDFADQQLQQIDQKLKAAEDTLSKFKSKHKITSIDDNSAEVVDFL
SKLETEKVNTDLELTEYENKIQEMRREVKNRGYFDQTYLTPESNNESYSPFSVLLRQLSDLELKRLELLQKRKDTHPDVV
TINEQISQIKAQLTDYNQNTIIAYQIIINSLREKQNRLLSLIQKYSGRIESLPAEESQLAELIRQKEVYAKMFSLLLDKR
EEMRMAELSKLQDIIVVDPAQKPLKPISPRKSLNVILALLAGVMLGLTAIFVLEHFEKRLTNLDDVERLFSVTLMGILPV
YDAQLREQIRNSKSIEERAVVLIKEQYAFKEMYRLLRTKIGNIPGGKMMMFTSCEENTGKTTVISNLALSFAKMGKKVLV
LDCDLRKGKIGKFFDLPENARGMIDYLSNNQNRPEVYNNFSFLTQQTLAVVPNGGYTDDSSELLSAMAVKSMLEDFQKAY
DYILIDTPPITKVSDVLILGDFVKDIILIVRPFLTYKEAIRGALEEMRQAGLNLQGVVVNGFNVGKSAYYYRYGHGYNYQ
TISES
>gnl|bykdb|A0A1F4N1P8 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix sp. RBG_13_44_9] (length=758 residues).
MNEFEDLQQPEEEQVSLQDYLRILYRGRWIIIISFLVVMIATVYLTFTTPKVYEAVGTLIVESQGSMERNLFDFAYSGNQ
TTLITNQVEILKSRKLAEKVVRTLEEDVYRDSLKIFQPADDGSYMTSRSQVNWIMEHLEVNPKKDTDVIEVKFQAGSPFE
AKNIANEVIQNFRMLNIELNKQELVDLRDFLEEQLQIKREELRNSEEALKNYREKEKLISLDKETSEAISRYAESQAQLE
QALVEMDAYLEQKKSLEDQLENRRSSFSTEISVVSSPILEQLQSEYAKLVSEKVTYETLIAQDRVDPAEYNLQLQSLENR
LKAQEKRLQDEAKKIAATSMVQDPLLIAQNLTVKILEAETQIKGLRAKITALQNIMKDYDIQLSKLPNQSLELARLTREL
EVDQETYNLMTKKLEETRITEAGQEENIQILDLAILPDSPIKPKKRLNLMLGALIGLGLGIGLTFLLEYFDDSIKNPEEL
EKMGFPILATIPEISSKEVIENVISANGESEEMGEARQIETRLVTHFDPKSPVSEAYRTLRTNIQFKNKKTKQHVILVTS
SAPKEGKSTTVANLAITMAQMGNKTVLIDGDLRRPVIHSIFNMKKENGLTNYLIGNATLKEIVRPTFVEHLAVIPSGPLP
PNPSELLGSDEMKKLLEDLKNQFEVILFDSPPVIAVTDAAIMSTLVDGIVLVIKAHQTHREAIKRAKSLLDTAEARIFGS
LLNGVNIQKTYGTNYYYYYYQYYQYYGHDLKRRKRSIA
>gnl|bykdb|A0A1J1CCX0 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix abyssi DSM 13497] (length=783 residues).
MNMGEGYPGNGKPLAQSYTGFENEEEVMKLQDYLQIILRRKWIVLVSFLVVFLTAVVYTINSQPVYQAQATVLVNTQSKG
QGGLLLFDPTGLGFAQNLNNELEILKSRSVANAVARELLAKKYYDNSQEILHCIRAPEEDELGREILSEEELTGVLIRTV
EFEPVRDSEVIKIIAKSGDPRDAALIANQFARAYYERNLRMSRTRSKAAREFLEKQLIAKQEQLAKAEEALQRYMEQTGI
VSVDDESQKVIEQLATVQAQYENVSIELESVKESLNFYRKQIARQEPNVARIMSDASDPYIRLLQEEIARLEVEKDITIS
QNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVLPGQLTDPAKYLVEVKQKIFDTQIQVQALEAKKKALAVVL
LDYQKQFDRIPKRSIEFARLQRARLSAEKLYLLVEEKYQEATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNLMLGALLG
LGLGVGLVFLLEYLDVSIRTPEDLKRRGWQPLSVIPSMDSQMIAELAQNKENPAIDDHLIALLSPRSSVAEGYRRLRTNL
QYARLDKPLKSFLVTSPNPKEGKTTTASNLAITFSQAGLNTLLVDTDLRRPAIHRLFGLPKEPGLTNHLFGQNTLDEITH
KEVIPHLSVMTSGLVPPNPSEILAAPQTHELIDRLKSMYDLVIFDTAPVLAVTDASILATQVEGTLLIILAGTTIFDELE
HSIEQLERVNAHILGVAMNNFDIKRAYGSYYGQYKSRYYGYYGYYTYGHTGGKKAKKKRTETS
>gnl|bykdb|A0A3M1AH62 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=783 residues).
MEEQLEREITLKDMMRILYRGRWVITSCFLAVMALTVYYTFTVTPEYEASAKVMIRTDATSGIPSLFDMGGVLKQETVIN
NQVEILKSRTLAETVLHRLQQSDLADKLEILGNGEHGHRSPGMIASFTGFIKGIFGIESEESNEYTFEDMVQELLDERLS
VTPIRDTEMIEIKVRAVSPEEAAFITNTLTAAYREKNRLMSQEEVRQVKNFLEEQLQVVKKQLAESENKLKQFKETQKVV
ALSHETEELIKKLAEFETLYNEAKTELNSFKERLSYIDKQLGKSKQNFDIESISATTYFEELKKEMATLQTKRASYVANM
INQGVYNKNDIQLQKYDEQISILTDKMKSELAKLASQEILNPVAVNEELFARKVEVEANIEALKPKVTSLKKIVDDYEAQ
LETLPDKSLKLARLERSARVDEKIFIMMKEKYEESRINEVGQLGDVRIIDPAKPPSEPIKPKKKLNMILGMLVGIGLGIG
VTFLLEAMDNSVRTIEDLEKLGLPVLGSIPVIKEEDAMKRIKVLPQSAQNGNVDPVHIRRMAARLITHFAPKSPISEAYR
TFRTNIQYTQVDKPIKSLLVTSPGPGEGKSTSVANLAITMAQMGSRVILVDADLRRPVLHSVFDTDRRIGLTNVLVGRVS
LDDAVKETEINNLYLLPSGTLPPNPSELLGSTAMKQLLDELKQRFDMVLFDSPPIIAVTDAAVLSSKLDAVIVVVKSAQT
DREAAFRATALLKNVKTHVLGALLNGVRIESMYGSYYYYYHYYYYGKEGDRKRKKKKKRRSKT
>gnl|bykdb|A0A3M1AHA0 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=778 residues).
MEQFYLDDENSYQDEKIDLQKYIRVLIRRWKLVFSVTILVTVPWVIYTLKQPPVYEAKAVIRFKSYEGKDPTLTESRTTV
LTSRTFAEQVVAQMGLSMKIKSDAMKRLKRKEIFQHFSTTKDPVPGDYLLRLNNDATYSLFILLDDKRKRKIKEGLVNQI
LDSPLSANGFNLQISPNLLNVPQDIEFTILPFREAVKEFQSKTNVSWNRSGTLMTLTMTDEDPYLAAKMTNRLAEIFVEE
SASLKKKAVEKKRELLEEQVRLAKAKLDESERALKEFKEKYAINLDAEQQTQLNQMVAAEQEKENLVAYKKALKGLLARL
DSETLSSSGDGNTQAQLNRRYIFRQIAEHPVFDNNATMLVYRAKLLDLEDQWKQVVDVSSAENPKAKEIDAEISLTHLQI
KKLALQEIDDLNKQIARLESKINQLKFKLKQLPAQQQKLNELTRTNQVLEKQYTDLLAMYRDAQITEAVETEDIEILDPA
IEPEFPKNLNKKIQAGLGGIFGLILGIGLAFLLEFLDKSIKNADEVKKFLKLTVLGSIPQIDFSDVYDFQDSEKLKQIDQ
QLVTHDYSPTPIGEAYRSLRTNILFSRERGQLQSMVITSNEPGDGKSFTAANLSITFAQLKSNTLLIDGDLRRGVLHNTF
GVPKEPGFSNYLTSMIPIQHIIHETHIPNLSLITCGSLIPNPSELLASHQMKRFLDEMRRKFDLIIFDSPPLNAATDAVV
IGTQVDATILVIRAGKTDRDLARQKLELFSNVPANIIGVVLNGTTADLAHPGYSYYHY
>gnl|bykdb|A0A3M1NQ37 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=786 residues).
MNMTNGQPKNFQKTENVAEQEIKKYLRILKKRKWVILTVWFVLFLIWEVFISFFSKGPLYTAKTLLSYQDPRTMSALEGR
VVNYKSPMNLITSNKVLGEVIEELQLNLSIQTGFISKSRLFDFLDVDRNSVVGDYKLVRKGETFDLLYKYEPHGIKEYKL
LTFAVDDTVAVNKMKFKLNKPFVLGYSKDEIEFKIRPFEMVIESLRRLIQFRSEDRYGTIFTISVKHYNPNRAAKIANTL
AKKFIDLNIKLRHHKGAQKLKILENQLQLAKKELDEANAKLKAFRKRYPWVVLTPTAGSYVTSVSNYEEKKQQAEMTVAD
IQNYLKNLNNSQGLDEKINNTRELLTYLGGQGRPVIPEYLRRFNELETERNTLLSTYAPSHPLVLKNQEAIEDLIQKIIT
EAHIFLKIVQDQIGTYSAKIESEKQRLAGLPTKELQLAELVRNQSLKSNLYEAILGRYNAAKIDNEVVVSDIVVIDEAIP
PPWQPEIYVLIKQSLMGFFVALAIGIALAIVIDFFDKTVDNAEDLQQKLYYPVIGTIPVIQNDESVPENIEEIKGKRDPK
LITLDYSPTLESESYRDLRTKILFMNQNKNLSSFLVTSLRPGEGKSLTASNIAITIAQQKISTLLIDGDLRRGVLHNEFG
NKKRPGLSDFLISKATVDHDNVNKLIQKTFVPNLYLISTGSPIPNPTEMLGSERMVNLMNLLKSRFGMIILDTAPFQASS
DSAILSTLVEGTIVVVRAGYTNVDLLNKKIAEYPNIQEKLIGVVLNMVKINVKKDEYSYSYSYYNY
>gnl|bykdb|A0A3M1NWV5 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=758 residues).
MENFAEFQENEQQISLQDYLRILYRGRWIILTSFVVVVLATAYFTFTATPVYEATAKILIEDKNSMEKALFDINYLGNQS
TVIQNQLEILKSRTLAERVVLRLQSAVYRDSLEIFQPDENGDYMVLRDQVDWILDRLTVTPKQETEIIHVTFQARSPFEA
ARICNEVVVTYQQLSKEVNLSEFKDLRQFLELQLRKKSEELKQSEEALRLYREREKLVSLEESTKELISQLAESQAELEA
SMVELESLQEQKRNLEKQLEERRKALSSEVTQVSSPLLVELQQEYARMVNDKVKYEALIAQDHTIDPQEYQMELLSRANR
IKAIQKRLQEEAQRIANTSMVSDPLQIAQELITTKLQLETQIKGLRAKMDALRDVVQQYESQLEVLPSQGLELARLERQV
QVDQNTFILLTQKLEETKIAEAGQRETIRIVDPAIEPKFPVSPKKKLNLLLGAVIGIGLGIGLTILLEFFDDSIKNPDEL
ERMGLPILSIIPQISQDELSRPKVAVNGNGELNEGEVIESQLITHFDPKSPISEAYRTLRTNIQFQNLGTDNLSLLVTSS
APKEGKSTTLANLAITMAQMGSRVLIVDTDLRRPVVHSIFKLKKDKGITNYLMGKLPFEDIVKPSFVENLYIVTSGPLPP
NPSELLASEAMENFVQEARNNFDVVLFDSPPIIAVTDAALLSSKVEGVILVIRAHQTQKEAVKRAKTLLDNVHARIIGCL
LNSVDIERAYGSYYYYYYYHYYSYYGHDLKRRKRTKIT
>gnl|bykdb|A0A3M1P834 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=781 residues).
MDSYFLDEEESLDVETLDLRRYYRALIKKWWLVAIITLAVTVPWAIYLKSQPPIYEAAALIRFKNFAGGDDVSLIQTRNT
ELRSRSFAQRVVAQLGLCLVLEQKTEDGFLNRSDIFAEFSTTQTPVSGDYFLRLTADGRYSLSMIIPDTEREKQLKTGSV
ADITNGLCVVNGLSFRLVRNVPLPLEVPFRIMSFRSAVESFQSRINVRWEDRAGTLMRLTLTDTDPKVVAEMTNRLAEIY
IAQSSSVKKEMSQARVKILEEQLQKAREELEASERELVQFKKKYEVALDADQKGQLNQLALLEKKRDDLETTLKTLNDLL
QKKEEEERALAGPDADPYATDLRYVMNEIASHPAFDGSAAMLIKRSRLKDLETQWRAIVNSTTERNIKARQVLAQIRSLH
TEIEQIARREMIGIQQELEQTKREIAQQEYKLKQLPARESELSELTRRNSVLAKKYQDLLAKSQDATISAAVETGDIEIL
DPAIVPDAPTNKDKKQKAILGGLFGILLGMGVVVVTEFLNKTLRSVDDVRRYLKLPILGTIPQIDFSDVFDFQDSEKVKQ
IDQQLVTHDYSPTPIGEAYRSLRTNLMFTKETGRIRSLVITSNEPGDGKSFTAANLSITLAQLRSNTLLVDGDLRRGVLH
NTFGVAKEPGFSNYLQDVVPLQSILNPTQIPNLTLISCGSLIPNPSELLGSHQMQRFLDEVRRKFDLIVFDTPPLNAATD
AVVLGTQVDGTVIVIRAGKTHRDLAKSKLELFSNVPARVIGAILNGTTADMAHPGYSYYHY
>gnl|bykdb|A0A3M1XV95 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=761 residues).
MENQFEFQQDEQQITLQDYLRILYRGRWIIVASFLSVLLVTAYVTFTADPVYESTAKIMVESQGSMERALFDVTYLGNQT
TLITNQVEILRSRMLAERVVHYLESVPYRDSLQIFQPDESGVYMTFRDQVEWVMDNLEVTPKKDTDIIEIKFSSRTPFEA
AAICNVIAEAFRDLNREFNRSEFRELRQFLEKQLASKEKELRSSEEALKNYREEHRLVHLDEETSDLVSRVADIQSQLDA
AMVELEAAQENKRNLEKQIDERRQSLSIEVTQVSSPLLKELQEQYAELVAEKLKYETLVKQDLSIDPQEYQLQLSSMTSR
IKAIQKKLLEEAQRIATTSMVADPLQIIQDLLAKELTVDNEIKALRAKIEVLSDILSQYEAKLADLPEQSLELARLERQL
QVDQNTYVLMTEKLEETKISEAGQKENIRIIDLAVEPLNPVKPKKRLNLLLGALIGIGLGVGLTFLLEYFDDSIKNPEEL
ERMGFPILSIIPQIPLSELAQKILSRNGDKEAEIQEGKQIESRLVTHFDPKSPVSEAYRTLRTNIQFKNLKNTNPMILVT
SSAPKEGKSTTVANLAITLAQMGARVLLVDTDLRRPVIHSIFNLKKEKGVTNFLLGKMTFEEVIKPTIIDNLFVCTSGPL
PPNPSEILSREEMKEFITIAKQQFDYLLFDSPPIIAVTDAAILASMADGCLLVIKAHQTRKDVVQRAKTLLENVNAKIFG
CLLNGVNVERAYGSYYYYYYYYHYYNYYGHDLQRRKKSKIF
>gnl|bykdb|A0A3M1XW99 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=787 residues).
MNYPKLENGKAPSRRIVTGAEQEVFRYLRIIRKRKTVIAITAFVVLAIWLGFIVAFQATPVYESSVILTFQDTKNTSVAE
GGSKKDVNWSRASLVLTHSLLSKVVEKLQLNFSMITDNVDQDEVFRYLKVSKEAKTGYYRLVHEGGEFQIYYSKDDDDNP
GELLKRFAASDTIDVNQLVLAVNPGFFEQHNIHELRWQVRDVNEAVDKLRNKINYMLDKSRTILTITVSHKNPKRAAQIA
NTLAELFVDMNLHLRRRQSDEVVSILQNQLRVAKADLDAANERLRRFRERNPWVTLSKGDNAQINVVSSLQLTKNQIEQT
LNDLQALVERTAQAADPAVKFSTARELVTYLTDMKVALAPAFEKEYNDLVVKRNTLLQQYAPTHPFVVQVEKDFESFRSK
LLQAAQDQLNVLRQRLASTQQQIEESKKKLQRLPQKELELAELVRDQEVKNDIYLKILSRLNAAKIENQVEVSDVFIVDY
ATPPTPKDPLSDLIKKGLFGVLIALGAGLGMGVVVDFFDKTVKDVEDLNQKVQYPVLGQIPVIQVVEPDEKNLEESRGKI
DPKLITLDYSPTLESESYRDLRTKILFRNKNQNLHSFLVTSLQPNEGKSLLTSNLAITIAQQKISTLLIDGDLRRGVQHS
TFGNKKKPGLSDFLVSRATIDYDNVSKVIHPTFIPNLFLIPAGSPIPNPTEVIGSTRMQDLLQLLGTKFGMIVLDTPPIS
ASSDVAILANLVDGALIVVRAGYTNVEELVGRLHEYPSVEEKIMGLVLNMVKVDRKKNQYTYSYYNY
>gnl|bykdb|A0A3M2FFC7 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=758 residues).
MNHPSVEAGIENPGQQNVTLTDYLRIIYRGRWIVLFSFLVVFTGTVYYTFTTDPVYDATTTLIIDKSNAMENALFDFNSF
GNQSTHISNQIEIIKSRTIAERVIKRMELSNVRDSLSLFHPNDDGEYLTLREMAQIIRENMEVINKKETDIIEITYSAPS
AFEAAYTVNAIAQEYADASVEFNQGELKDLRKFLEEQLRKKGQELTSSEELLRDYQERERVASLDEETSELITRLSAVEA
ELEQSQVMLQASLEMKNSLEKQLDERRETVSSELSEISTPYIQTLQEELARIVAEKTKYETAVASQATGVNSDYFNAQIA
EYDSKIKSLKQRLEEEAKKLSTSSMVQDPFQLTQELVSRIINLDAEIKANTAKINTLQEVINTYNAQLESLPVKVLELAR
LKRRQMVDEQTYMLMTKRLEETKIQEAGQRKEVRVVDEAIEPLFPTKPKKKLNLALGVVLGIGLGIGITFLREYFDNSIK
TQEELEQLGFNILATIPKIEMSKVEEKLEARLAKMGPMEGKRIEARLITHLDPKSPVSEAYRSLRTNIQFSRVDQKIKAV
LVTSSGPKEGKSTTSANLAIAMAQSGKRVVLIDADLRRPVVHSIFGMDKDEGLTNYMMDDIDYDTMIKKSIMDNLYVIPS
GVLPPNPSEMLESEKMKKLLERLRNDFDFVLFDTPPIIAVTDAAILGTIVDGAILVVKAGQTNYDALVRAKSLLDAVNTR
ILGALLNGVEVGGMYGSYYYYYYHHYYSKPGGKKKRRY
>gnl|bykdb|A0A3M2I7J5 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=757 residues).
MENYPELMEQEQQITLQDYLRILYRGRWLILGSFVVMLLGAFYLNYSTEPEYQASAKILVENPSANKLALFNVDYLNMPS
TFITNQVEILQSRTLAERVVAELESADFRDSLSIFQPTSRGDYLTLREQIDWILDHLTVTPKTESDIIEIVYVASTPFEA
ATVCNVIAESFQKLNRDFSRSELRELRRFLEFQLKKKSEELRQSEEALREYREREKLVSLDAVTSELISRLAEVQAELET
AAIELEAAQEKKHNLEKQLEERRETLAVEVSQISSPLLQELQKEYARMVSEKVKYETLIAQDRTIDPQEYQMQLQSMSSR
IKAVQDKLQEEAQRIANTSMVADPLQIAQKLIAEILDVETQMKALQAKVDALREVVDEYELELERLPGQGLELARLQRRV
EVDQNTYILLTQKLEETKIADAGQKDIIRILDRAIEPLSPIKPKKKLNLLLGALLGIGLGVGLTFLLEFFDDSIKNPEEL
ERMGFPILAIIPEISQEDVVSKKFSRNGQGQLSEEQLLESRLVTHLDPKSPISEAYRTLRTNIQFKNLRQKENTLLVTSS
APKEGKSTTIANLAITMAQMGSRTLLVDTDLRRPVLHSLFNLKKDKGISNYLVGKLTFDEIVKSTFIDNLFIVTSGPLPP
NPSEMLSLETMDEFIDRARREFDVVLFDSPPIIAVTDAAVLSTKVDGMLLVIRAHQTQRNAIKRAKNLLDNVNAPIVGCV
LNSVSIDRAYGSYYYYYYYHYYSYYGHDLKRRKKARA
>gnl|bykdb|A0A3N5JLC6 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=796 residues).
MNEYNTYPGDGNGKVQSLPARPPERKMTLNDYRRIFFRGRYVVLITFGIILLLTALYTFLQKPVYEANVRLMLQDNSSVG
QSLFDLTSAMKQETMLNNQVEILKSRTVAERVIRNLLKSPYSHRLRVLQRPDTLNASLQMLNWLSLDSKKDWSESEVFDE
QVKNLREELDVRHIRNTDMMQINFRAHSAFEAYFVANALADVYERISQEESQAEVRQVKEFLEEQLKLYEQELKHSEEQL
KSYQESAHVVALDNETIELVQKITDFETLYNSARTDLLAARQRLDYIDSELARQNTNFDIETISKTTALEEFTRKIAEKE
AQLAVYQSETIQKGESQFTRRQIETLQRQIDALKAQFKQNVKNIAANQFVDPAKVSSALFTSKIEVETEIRSLEPKVSAF
EKILEQYNAELEGLPTKKLQLARLARSAQVAEKLYVMLQEKYQESRITEVGQLGNVRVIDPAKEPYEPILPRKGLNMLLG
VLLGLGFGIALAFTMDYMDDSITSMEDMDSLGLPLIATIPMIKPDTTGSLFSRVARIDDPEVNAINERLVTHLKPKSPVS
ESYRSLRTNILFTAPENPKQVILVTSSGPREGKSTSVANLAIIFAQMGAKTLLIDADLRRPMLHKLFRVNQQPGLTNVLI
GQKQLEEAITAVPDVLNLSLLTCGINPPNPAELLGSERMNILLQKMRQEYNMVLIDTPPVNAVTDPSVLARAVDGVILVV
RSASTQRGSAFVAVEQLRRVEAPLLGIILNSVSRTSYYGSYYHEEYYYYYTADGEKKHKSKAKSSQEKSVNSQKSA
>gnl|bykdb|A0A3N9NLG8 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Calditrichaeota bacterium] (length=771 residues).
MIIFFTFDVIGEYTLFEENELELESGSQVSISDYLKIIYRRRWLIIITFLVVFGITCFVTFTTEPEYEASTTIMIKSTGA
MERTLFEFDYMGAQTTLISNQIEILKSRTLAERVIKSLNLSDVRDSLNLFKPNEKGEYLSMRGMIGVIRGNMDVSHRKDT
DIITLTYTSNSSFDAAFIANTIAEEFRSLNAEENSGELSELRNFVERQLEKKSEELKLSEDRLREFQEKEKLTSLDENTS
ELVNTLSGYEAKLEQAQIELRSNLELKKSLEQQLNERKETLSTDLSEISSGYLLSLQSQLAQAEAEKTKYMMAIQSEVQD
ASKQHFESRLKVYDERINALREKLNEEAKKISSSNMVSDPFQLSQQLLTQYLDVESKVKAGTATINALQEVVSEYGGRLN
FLPEKTLELARLERKRKVDEETYVMLTQKLEETKIQAAAQSRNVHVIDQAIEPMAAVRPKTNMNIMLGVLIGLGLGIGLV
FLMEYFDNSVKTSEELEAMGFNILASIPKIEMDKYEEKLESKLEKLGPIEGKRIEARLITHLDPKSPVAEAYRTLRTNLQ
FSKIDRQLKTILVTSSGPKEGKSTTAANLAIAMAQVGNKVVLVDADLRRPVIHSIFGIDKEDGVTNYLMGKNNFEETIKS
TFHENLFIFTSGILPPNPSELLASQKMEQLLHKLNENFDTIILDSPPVIAVTDAAVLSTKVDGTILVVSSGQTNKDALGK
AFNLLNSVNSKLLGVLLNGVDVKGLYGSYDYYYYHHYYTKPGKGMKRLKSS
>gnl|bykdb|H1XPL7 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix abyssi DSM 13497] (length=788 residues).
MSSEKMNMGEGYPGNGKPLAQSYTGFENEEEVMKLQDYLQIILRRKWIVLVSFLVVFLTAVVYTINSQPVYQAQATVLVN
TQSKGQGGLLLFDPTGLGFAQNLNNELEILKSRSVANAVARELLAKKYYDNSQEILHCIRAPEEDELGREILSEEELTGV
LIRTVEFEPVRDSEVIKIIAKSGDPRDAALIANQFARAYYERNLRMSRTRSKAAREFLEKQLIAKQEQLAKAEEALQRYM
EQTGIVSVDDESQKVIEQLATVQAQYENVSIELESVKESLNFYRKQIARQEPNVARIMSDASDPYIRLLQEEIARLEVEK
DITISQNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVLPGQLTDPAKYLVEVKQKIFDTQIQVQALEAKKKA
LAVVLLDYQKQFDRIPKRSIEFARLQRARLSAEKLYLLVEEKYQEATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNLML
GALLGLGLGVGLVFLLEYLDVSIRTPEDLKRRGWQPLSVIPSMDSQMIAELAQNKENPAIDDHLIALLSPRSSVAEGYRR
LRTNLQYARLDKPLKSFLVTSPNPKEGKTTTASNLAITFSQAGLNTLLVDTDLRRPAIHRLFGLPKEPGLTNHLFGQNTL
DEITHKEVIPHLSVMTSGLVPPNPSEILAAPQTHELIDRLKSMYDLVIFDTAPVLAVTDASILATQVEGTLLIILAGTTI
FDELEHSIEQLERVNAHILGVAMNNFDIKRAYGSYYGQYKSRYYGYYGYYTYGHTGGKKAKKKRTETS
>gnl|bykdb|H1XXK6 [Bacteria] Bacterial tyrosine kinase [Calditrichaeota][Caldithrix abyssi DSM 13497] (length=756 residues).
METRVPGNFETDTWEGDEQPLHLTDYIRILYRGRWLIILSFIAVFSATVLYTFTTDPTYEASAVLLVESNDSMDRALFNL
TTFGTQTNLLNNQIEILKSRNIAERVVKRLEKSAYRDSISFFKKLEDGSDLTFNQRVAIVMSSLEVEPRRDTDIITLTYR
AGSPFEAAFLANVISEEFAKLNAETNRMEVSEMRKFIEDRLAIKAKELKESEEALKEFQEREKIASLDAETQELVTRLSE
TESFLEQARIELNSKLQLKKNLEEKLNERKETLPANLSEISTPYIQTLQQELARVVAERTSYVTALETQVQSKREFFTPE
LVRYDERIKALKKKIREEAAKIANSEMISDPLRISQDLVNQLINLSGEITATEAKIAALEDVLKVYNQRLENLPDKVLQL
VRLERRKQVDEQTYMMLTQKLEEAKIQESAQARNVKIIDRAIKPNRPVKPNKRMNLMLGAMLGLGLGVGITFMIEYLDRS
VRKPEDMERMGYNVLATIPKIELDKVEKSKIKQNESAKIEARLITHIDPKSPVSEAYRTLRTNLQFSKIEKDLKTILVTS
AGPKEGKSTTAANLSIALAQAGNRVVIVDADLRRPILHSVFGTTKEEGLTNHLAGSISYEQVFKETVVENLSLVTSGVLP
PNPSELLASKKMEDFLNKLCEDFDIVVLDSPPVIAVTDASILSTKVDGTLLVVYAGQTERDAIKRAANMLNSVSARLLGI
VLNGFDVQGIYGSYYYYYYHHYYGGEGKSKPKRKFI
© 1998-2019