BYKdb

Dataset for cluster orphancd of phylum candidate-division-ksb1

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bykdb|A0A1F4QQE0 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium RBG_16_48_16] (length=772 residues).
MPYQDQSYFDSDQQDVPQIDFKKYLRGIWKRKWLPLILILVFAFPFYRSTQNQIPIYSAAVLIKTNAFAATEDKILSVER
QLELLSRTFLERVAARMGLAIEVESSSATMYRESIFSEVYTTEEPTAGDYEIEINEFGQYFLSMIKSGKKVGLDSANVWD
AVEKPRSVNGVTFRLNSEFVQNASRVKFKILPFGYAVSYLKSKVNLEISRSGATMKLSMTGTNPDVLPAELNRIAETYVE
ETKKLKRRDLDNQKKLLMQRMAAAEEQVKKAEEDLKDFNTRYPLSLNAEKQAILGKLHSTQTYLRDLPLQRQKLTDLLDE
VDKEKEGVDTDKYRRLIIRTIANFAVFNDEPQMAILRQTLEEQETRYNDLVKNFSENWEPVIDLKRQIKDTEEKIIKFAS
KYRNTLAQQETDYRKMYADIQAQLKNLPRDEYQLMELQRNKDVADGFYNSLYSQLTKTNISEIAETDEIAILDRAVRPGK
PINPSTKRSVLLGSSLGFLLGIILSVIWELTDKTMRTVEDVERSLRLPVIGAIPVMDFKDVPEFHDFEKVRQIDKQLVTD
DYSATPVGEAYRALRTHLMFSKNTGKFQSLLITSISPEDGKSFTSSNLAIIVAQQKTNTLLVDADLRRGVLHNTFGLPKD
PGFTNYLTNKITLLEAIQPTHIPNLSLISCGSMIPNPSELLGSLQLRRFLEDARRKFDVIIFDTPPLDAATDAVVLGTQV
DAMAVVVRSGKTSRTLAKEKLEIFETVPVKLIGIILNGSETALVHNYSYYHY
>gnl|bykdb|A0A1W9SG21 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium 4572_119] (length=726 residues).
WAYYLKKQPPVYESSCRIRFRNLASGAEYIIDDSRIIELTSRSFAERVVAQLGLTLQIEEDEYVTRQRFFEEFTTTITPV
KGDYVFKWDRDGTYKIYRIIESERELVDEGQLIDAISSLHETANGFSFKLSSEITSMPKEIFFRINKLRNTVKSFQSNIN
VRRTGGGGILLLSMTDANPVLVAQKINRLAEIFVNESKLLKRNSIENYKRTVKEQLQFSEKELEITDQRLKDFKSRHKVS
LGAETQEVVSDLDQVEEGLERYIKDKSDLAELLKQVSGQTAEESGELKYVYQQITELQTFQFNPKMGILQKQLKDLESNY
NSVVSNFSETHADATQLEEQIKNVQNSIRIEARNHLDDLTAKIAEMKTEKSTLEYKLGRLPEEQYQLTELERELDAKEKI
HRELLAKSQLAQLTEAVETEYVDILDPAIVPDEPMSRDKKKKALMGVFFAFFLGVGLAFTLEFLDKAIKSVEDIKRYLKL
QVLGTIPNIDFNEVSDYQDSEKIKQIDQQLVTYDYSPTPIGEAYRSLRTNLVYSKTTGRMQSFVVTSAAPGDGKSFTSAN
IAISMAQHKSNTLIIDADLRRGVLHNTFGVPKEPGLTNYLTGMVSFQHLVNDTLIPNLSMVSCGSLLPNPSELLGSHQMQ
RFLDEAKRKFDIIIFDSPPLNAATDAVVIGTQVDALVLVVRSGVTDRDVAKHKLELFKNVPVRILGAVLNGTNSEFGHDG
YSYYHY
>gnl|bykdb|A0A3A0BWH6 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=381 residues).
LPEKSLRLARLERAATVDEKIYLMMQEKYEETRITEVGQLGQVRIIDTAQAPKEPVKPRKKLYLVLGALIGFGLGLGLTF
LFEYIDNSVRSIEDVEHIGLTVLGSIPVIKEDEALKRLKVLPGMNGNLDTLESKKMAARLITHFAPKSPISEAYRTFRTN
LQYTKLDRELKAILVTSPGPGEGKSTSVSNLAITMAQMGSKVLLIDSDLRRPVLHTIFKVDRRIGLSNILVGKVSVSEAV
QKTEIDNLYVLPCGTLPPNPSELLASSAMTRALEEMKDLFDIILFDSPPIIAVTDAAVLCPRLDGVILVLKSGQTDRDAA
FRAYTLLKNVNARLLGSLLNGVQIESMYGSYYYYYHYYYYGKGDGKKSKTRRSRHSSTNAA
>gnl|bykdb|A0A3A0DU25 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=237 residues).
MQKSLTNSIVSVFSDETPEANEFRRLYSKLKNLYAADEMKNFLVTSAKMNEGKSTIAALLACTIARYRNTKTILVDCDLR
RPRVHQLFGMPKEEGVADVLMGTRKLDTCFKQTPIENLRLLTSGGVVTSPTELINSARMRDLFSEIKFYFDTIIVDSPPV
IPVTDALILSPEMDGALLVLKAGETHKAVVQRAVDLIRNAGLNILGVIINNQKAVLPYYYDHKYYGYSYYNTEEKVK
>gnl|bykdb|A0A3A0DZV2 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=247 residues).
MKTSVAKFKKSAKPLGYYLETPELNEFKRLFNRLHTEKQKHGTKIFMITSAMMSEGKSTVAAYLAVTSALYQSTETVLVD
CDLRRPVIHRHYELPLQQGIAEVLSRELDLSAAIKPSALPHLKIITAGKPNQTPAELFSLTHLQSVVDEMREKFSIIIFD
APPIIPVSDTLLLSNFVDGILIVVKAGKSQKRVTQRALDMLQTNSDKILGVVVNNLRSALPYYYDHRYYGYKYYRQIENA
NAKRSDH
>gnl|bykdb|A0A3N9N7Z2 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=773 residues).
MGMEEIESFDQPFEKEPANQLDISKFLKGIWKRKWIILFLCGISAVPFYFIAKNQIPIYKCKVVIQSKKLGENENPIFDG
ETQAEIRSQSFTERVASVLGLAFANSDSVYTNFEDVFLEYQTTTNPVESRYKIVIDNLGNYYLYQKYGTQKTMVDSANVW
DAVDTPRNVNGISFRLNPGFCATAGEFHFRIRPFIKGFKFLEYDIQKKFSNSGKFMVLELRGEDPDLIPKQLNRVAEVYL
QEIKKLKNIDSEDYRTMLQRTLSAAEENMKNSEEALRRFYTQYPLSLETEKNTMTSRLSANEQILRDLPYQRRQLSELLM
KVDNPEDGYEMDYRRVVVHKIADFEVMADEPELTIYKQNLENLERRYDELYSKYSAEHEDVLECANRIKETQDKIIEFAS
NYRNILAAKETKHEKIKTELEAQLRALPDEEGRLLELERNKRFDEELFNSLYVEMKKLQVSDASLDPGIRILDHASRPTK
PINPSRKSQVMMGSAFGLMLGLLLSIGIDIADRSLHTLKDVERHLNVPVLGTIPTVRFKDIPDFRDDQKALQIDRQLVTH
DYSPTPVGEAYRALRTQLLFARGAEQIRTLLITSISPEEGKSFTASNLAIIMAQQRTNTLLVDADLRRGVLHNTFSTTKE
PGLTNYLSNNATLASLIQPTHVPNLSVLSCGSLIPNPSELLGSMQMRRFIAEVKRKYDFIIFDAPPLDAATDSVVISTLV
DAVVVVVRSGKTNRNNAKERMDIFSTVPARLAGVVINGTEEANMKNSYSYYHY
>gnl|bykdb|A0A3N9NJI9 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=763 residues).
MPPNTNAQHGKEWNLEDYLDLVLRRKVIILVVFIVVFVIVLAYALTRPDIYSSRVTFSTEQTQDGGLGSGMPYYYYYQMQ
KPIEYYQAVMNSGLFRDKVTKAALHDSILLANGGLSTEEIYGLLGRIGLSKEEYSDLMYMSITAFDPIVAYRIVDIASIA
YKDRSREIQEEQARATVEYVNRQVALAEENLENAERKLEEFKSKTKFTAVNVNDGIIQRLNEIENKITELSTQRELAQAN
LDVYNERLSQFKDQNAASLWDNESEEIVWMRQEIEQLQNQKNALEENNASSRQIQQLANEIDERKQQLRNAVLKRSAENP
SAQGAIGDEQELAVYQERKIEEELNLFTLKNQERYYTSLRDTYRKQHPNMLEHSIELAKLQRAKTVNATLYNFLIQKGEE
AKIKAATGTGGVKVISPPAIPERPIPKNTMRDIFVGVILGLGLGVGLAFGLDLMDQSIHTPEDVEKHLALSTIGTIPHID
YVTKKADRDKRIPVLQDRRNGKPAKDGVNERIFQLLPMLGSKNPLVESYRNLRTDLQFVNVDEPIKSIMFTSATPGEGKS
LNTANLAISFAELGKKVLIVDCDMRKPVQSKIFQVEKSPGVSDYLARELTVDEIIQKTAITNLSLVTAGTSPPNPAEMLD
SHKMTELISKLTDRFDLLIFDSPPLIAVSDPKILAPKVQNVLLVVRVGKVNYRLVKDAYSRLDKVDAKVIGAVLNGVGTK
RGYGYYSRYNYYHHAEYYTSIEKKSADKRRKKPYIKPQFFKSS
>gnl|bykdb|A0A3N9NL50 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=220 residues).
MIEAYRSLQLNLSFLNPDNKLKTILITSAAPGEGKTLTTLNIAQIYARSGIKTLVIDCDLRRPMVHKALKIRQEPGLTNL
LVDKTATLDSCVQLLDDEQLNGHLAVLTCGAIPPNPVELLSSKSMQDLLTKAQAIYELIFIDAPPVISVSDSVILGQKVD
GVLLVLRSGKINREAAQKAKKILENGKINIAGTLLNDVDYKNVYGYYKDYYYYSDKDKIK
>gnl|bykdb|A0A3N9P469 [Bacteria] Bacterial tyrosine kinase [candidate division KSB1][candidate division KSB1 bacterium] (length=773 residues).
MAMEDFETFEEPIDKELSSQIDFAKFFRGIWRRKWLIISLSLVFAIPFYFIAKNQVPRYRCRVVIQSKKVGTDEYNIFDG
DTQAEIRSQSFTERMAAVLGLAFVNLDSVYKDFDEVFLEYHTTTNPVEAQYKIVIDKLGTYYLYRKDSDMATPVDSADVW
EAVDTPRSINGISYRLNPNFSYKPGEFHFRIRPFIKGFKFLYYSVEKTFNRAGNFLVIELEDENPDLIPKLLNRIAEAYL
LEIKRLKLMDSDTYRDMLSRNLSAAEENMKNSEEGLHRFYSQYPLSLDAEKKSLMNRLAANESALRDLPHQRRMLSNLLM
KLENPEDGYEREYRRVVVHQLASFGAMTQEPELIIYRQNLENLEKEYDRLYSEFSAEHKDVINYAKRIQETQDKIIEFAS
NYRNILAEQESAQRKEKVELEAKLHTLPSDERRLMELERKKQVDEELFTTFYVEMKRLQVSGTGSDAGIRILDRAARPTT
PVNPSKKRQVMLGSGLGLLFGLFLSIGLDIADRSLYTLRDVERYLNLPVLGTIPVVSFKDIPDFRDDQKALQIDRQLVTH
DYSPTPVGEAYRALRTQLLFARGSERIRTLLITSISPEEGKSFTASNLAIIMAQQRTNTLLVDADLRRGVQHNTFSTSKD
PGLTNYLSNKATLVGLVQPTHVPNLSVLSCGSLIPNPSELLGSMQMRRFVAEVKRKYDFIIFDAPPLDAATDSVVISTLV
DAVVIVVKAGKTNRNNAKERLDIFNTVPANLVGVVMNGTEEANMKSSYSYYHY
© 1998-2019