BYKdb

Dataset for cluster tadcd of phylum candidate-division-ksb3

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A2G6E7M8 [Bacteria] Bacterial tyrosine kinase [candidate division KSB3][candidate division KSB3 bacterium] (length=743 residues).
MFQEEVHLKDYLRILKKRQWVIITFFVVVVVSVTISSFLQKPVYKATARVLIEKDTPNVLSFKEVLSLDGADIDYYRTQY
TILKSRTLAKKVLEESGLLQQALQARPAGFSIRGMLSGALSLLGIKEPLSEDAQLRIKEQQAIDHFLNQTIKIEPIKGSR
LVDVSAFSTHPELAANIANTLVSSYIKQNLEAKLLASQDAVGWLEHQLKDAEGKVADSEASLLAYKEEHGIISFEDRQNI
VMQKLSELNTAVNNARIKRIAVEMQYKQIQDYLNSSGDAPAAKTLKDLESISQVINNPLIQKLKIELSALESQLSELRKK
FRDKHPNVIAVKSQLTSIRERIHAEVKQIITSFRNDYELAQAQEQEMTAALEAQKREALELNQKAISYNVLEREAESNKR
VYNALLQRSKETTVTEQLETSNIRIVDPATIPNYPVAPRKKLNIFLAMVVGLTLGAALSFFFEYIDNSIKTPDDIKHYLN
IPFLGFIPKVSYNGHAPSHRREGHPADTVVALDPKSTVSEAYRSLRTNVMFSSLERGPVMLVTSAGPAEGKSITVANLAI
TMAQSGSHTLIIDCDLRKPRIHHIFNIPGNHGGFTEMIAALGETRRRVTVTRTKIPNLDIIPCGKIPPNPSELLSSERTK
VLIDALGKKYDKILIDSPPINVVTDPVILSQIVGGVILVIKAGETGRDLIRRARDQILNVNANLIGSVLNSVDMQKDSHY
YYSYYHNYYYQDDDEQEEVSSNS
>gnl|bykdb|A0A2G6K9T6 [Bacteria] Bacterial tyrosine kinase [candidate division KSB3][candidate division KSB3 bacterium] (length=775 residues).
MLQEDIHLKDYIRIIKKRQWVILTFFIVIVVSVTITSFLSDSIYKSTSRILIEKDNPNVLSFKEVLALDSADTDYYQTQY
TILKSRSLAKEVLEQLGLMGEALQGQSSGFSIRGMLSGTLTLLGLRKPLTEEAKIRIKEQQAIDRFLDTTIDIEPIKGSR
LVDVSAFSTDQELAMKIANAVVDTYIKQSLGAKLSASQNAIGWLEAQLKDSQQKVAESEAALLAYKEEHGIISVEDRQNI
VMQKLSELNTAVSNARIKRIAVETQYRQIKGYLAQDGTDASSESIQSLESMSLVINNPLIQKLKVDLSSLESELSELLKK
FRSKHPNVIAIRSQIQSVHKRIQAEIGQIIASIKNEYELALAQEQEMMVALELQKQEALDLNQKAITYGVLERDAESNKR
VYNALLQRTKETTVTEQLETSNIRIIDRATIPNYPVAPRKKLNIFLAMTVGLMMGTAFAFFFEYIDNSIKTPDDIKQYLK
IPFLGFIPKVAYGSGGPPAHRTVHHPVDTVVAVDPKSTVSEAYRSLRTNVMFSSLERGPIILVTSAGPTEGKSITVANLA
ITMAQSGSRTLIIDCDLRKPRIHRIFNIPGNTGGFSDMIATLGSNGARVTVKRTKIPNLDIIPCGKIPPNPSELLSSPRA
KILIEALGKKYDKILVDSPPVNVVTDPVILSQVAGGVIMIIRAGETGRDVVRRARDQLLDVNAKILGGVLNSVDMQKDHY
YYYSYYHNYYYQEDEKSDNRNGSRSNGNRANGKFDYAGARAQTKKRFTRESGHRT
© 1998-2019