BYKdb

Dataset for cluster orphancd of phylum candidate-division-nc10

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A1F4PXF3 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][candidate division NC10 bacterium RIFCSPLOWO2_02_FULL_66_22] (length=248 residues).
MASPAEKKKSPTPGFPSILSDAGSALTEAFRGLRTNLLFSGVDEPHRRILVTSAIPREGKTTTVANLGITMALAGSKTLL
IDADLRRPGLHRYFQLSGKVGLTSVLGDQAELREAIQRTKLAELSLLPCGPAVANPAELLGSRRMAELVNHLAAQYDLLV
FDSSPVITVADALVLAGVSDGVILVVRSGGAPHEVVSRAKKQLESVKANIVGAVLNAFDAKGEGYYSPYYYRYGYGYGDS
NSDGQKAK
>gnl|bykdb|A0A1F4QJ00 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][candidate division NC10 bacterium RIFCSPLOWO2_12_FULL_66_18] (length=317 residues).
MDPDVPENNSSALPAFLFDRILRARLPGEMSGNFQEQGPTDGSRRLAPPSVPGQAVEGPDALDDHLVSLLAPASFEAEQY
RTLRYGLEQMAKAGQFTPIVGITSPTVGDGKTTTAINLAGALGQAPEARVLLVDADLRRPCVGGQLGFGDSPAPGLADAI
LDPGVSLDDVVRGCPPFNLSILPAGRPPAAPYEVLKSPRLGELLEAARQRYDYILVDTPPVVPVPDCRLLAKWVDGFLVV
VAAHKTPRPLVAEALTVLDPAKALGLVFNGDDRPFAGYYHAYGYAPDATRGGGRARAVRAVAAFLGRRRSTWQRGAP
© 1998-2019