BYKdb

Dataset for cluster tadcd of phylum candidate-division-nc10

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A2T4TV17 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][Candidatus Methylomirabilis limnetica] (length=799 residues).
MDPDNALVKVKGGSGGLAKPQLWPVQAFPEQKKDPHLRDYWQVLLKHRWIVLTCFLVTVVTVATATFVQRPVYKATATIK
IDRAELKILKFDDVSPSANKETDDYYQTQYKLLTSYSLAERVVKRFNLDANPEFLGSGMQGPASPTWTWLTNLVDLIRPQ
PSTQQASGEASITESPVVQSFLKKLEIEPVKNTRLVKIAFLSPSPELSAQIANAMAENFIEQSIEQRLGAMKYAGDFLAK
QIQEVRIKLESSDELLQRFAKQKQYLVLDEKQEQTTKQLSLLTDALMKARSERLAKEALHRQTQGQDFQSIPSVLENPLI
SSLKTEYFRLQAEYRKLSETFLSDYPRMVALKSNIDEVKIKLDGEVQRVVDGLRSSYEAGLKSEHLLQSAVDKQKTVTLK
TNEDSIQYNILKREVDINRELYSGLLQRMKETAVSAGLDSTNIMITDLAKIPLWPDRPKKLLNLTLGIVLGLGLGIGLAF
FSDYLDNTVNKIEEVESTFALPILGAVPALASVERRRRLKGTTNNGQDAKSFELVMLQDQSSLVGEAIRNIRTSLLFSLP
ENPPKLLLVTSAEPGDGKTGVSINLSVALSQLGGDVLLIDADMRYPDCHRILGQDRTPGLSNFLVGDAELSAVIKPTATS
NLSLLPAGQSPLNPAELLGSERMRDALELLCQQFKYVIIDAPPVLGFTDSVLLSTFAEGTVFVIRAGKTVRDAAQRAVRT
LNAVNAKILGVVLNNIDLHSHGYSYYQDYHDYYHRKSERHGIVARGHHDRSNTPGAPHAHEHESPDSPADIPSPLAGEG
>gnl|bykdb|A0A2U1RKY9 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][candidate division NC10 bacterium] (length=804 residues).
MDALVKSEGKPPTPRELLLQRYYLQQDEETHLRDYWRIILKHRWMVLTFFAIIVTTATIYTFSLTPTYRATATLKIDYER
PQILSFQEIGSPGHQNYGPEFMGTQQKLLQSRSLAKRVIETLTANGHSIALDPGPTDSGELAGVWLAWITDMLSGSRTSK
SLPTADPVSQPEPPVGPTEEQVMVRKIDVLLRMLTIEPVRTTNLVKISFTTPSPALSSLLANAWAKGFIDHSLDLKYNAT
AQAGEWLSKQLQDVQDKLEQSEAALHEFVKQKQILTVGEKKDIVTTKLADLSEALTKAQGERIAKEALYRQSQKLRFDSI
PAVLENSMISNLKTEYYKLDSEYRRLGETYKPGYPKMVRLRESMDQIKRQIEVEIARIVDAIKQEYEAAVKKEQLLQAAV
NEQKHLAIGLNQELIRYDILKRDVDTNRQIYSGILERQKQAGVSQGLAASNVQIVDTAEAPTTPFSPNKTRNIVLGIVLG
LTVAVGMAFFFDYLDNTVKQPDALERTLGIPSLALIPSLASALPKQRRGRLSRNGNNGNHNGAPAFATVAHSDLRSALAE
AFRTLRTSLLFSSPGSPPKSILFTSAQPSEGKTGLSINTAITLAQLGGGVLLIDGDMRRPSCHSHLEIPLKAGLSDYLTG
NADLVSVIKRTTVSNLYCIPAGTIPVNPAELLASPRMRETIDLLSQRFDYIVVDSPPIFSVADALILSTVVKGVILVVHG
GRTPRDMIQRSFKNLIELNAPVLGAVLNNIDIRGNGYPYYYRYHYSHYYQYAAPDTVPDPASTVQAHAPVESQPTNAGNG
DRPV
>gnl|bykdb|D5MIF0 [Bacteria] Bacterial tyrosine kinase [candidate division NC10][Candidatus Methylomirabilis oxyfera] (length=769 residues).
MDPDNALVKAKDNSESLAKPQLWPVQAFPEQKKDPHLRDYWQVLHKHRWIVLTCFLVTVITVATATFVQQSVYKATATIQ
IDKAAPNVLKFEEVSPAANKETDDYYQTQYKLLMSYSLAERVVRLLRLDVNPEFTGTDAPGSASPTWTRFTNLVNLVRPR
SSMQAASGETSTTESPIVQSFLKKLEIEPVKNTRLVKIAFLSTSPELSAQVANAMAENFIEQSIEQKVGATKYAGDFLAK
QIQDVRIKLESSDELLQKFARQKQYLVLDEKQEQTTKQLSLLTDALMKARSDRLAKEALHRQTQGQDFQSIPSVLENALI
VDLKKEYFRLQAEYRKLSETFLPDYPRMVALKSNIEEVKSRLDGEVQKIIDGLRSSYEAAVKSEHLLQSSVDKQKQVTLK
TNEDSIQYNILKREVDINRELYAGLLQRMKETAVSAGLDSTNIQIADRAKVPLFPDRPKKLLNLALGIVLGLSLGIGLAF
FADYLDNTVNKIEEVESTFALPILGAVPALASAERRKRLKGATNGQGAKSFELMMHQDQSSLVSEAIRNIRTSLLFSLPD
NPPKLLLVTSAEPGDGKTGVSINLSVALSQLGSDILLIDADMRYPDCHRLLEQDRTPGLSNFLVGDAELSAAIKPTTIPN
LYLLPAGQSPLNPAELLGSERMRDALELLCRQFKHVIIDSPPILGFTDSVLLSTFADGTLLVIRAGKTVRDAALRAVRTL
NAVNAKLLGVVLNSLELHGNGYSYYQDYHDYYHRKSERRDSVMSHRDSH
© 1998-2019