BYKdb

Dataset for cluster orphancd of phylum candidate-division-ta06

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A0S7WF31 [Bacteria] Bacterial tyrosine kinase [candidate division TA06][candidate division TA06 bacterium DG_26] (length=228 residues).
MKSVLQRYEVESPEATEFRRLFSRLRRTGEPEPVKSILITSAVRGEGKSTTAAYLAITAARYRKTKTLLVDGDLRKPKVH
TLFQLRNQPGLSDVLSGASSLKACFKSTSLEELKILTAGKARLSPSESFDSDRMKDVFEEMRFYFDVIIVDAAPVIAVSD
PIILGSEVGGVLLVVMAGKTPREVVKRAKNILADSSVNILGVVLNNADEVLPYYYDYRYYGYPGTDEK
>gnl|bykdb|A0A0S7WGH6 [Bacteria] Bacterial tyrosine kinase [candidate division TA06][candidate division TA06 bacterium DG_26] (length=229 residues).
MGLSVLKQYEIESPVATEFRRLYSRLRRAGEGSSLKSVLVTSSVRGEGKSTTAAYLAITVARYRNTRTLLVDGDLRKPKL
HELFQLRIRPGLSEVLAGVASLKSCFQSTSLESLKILAAGSASLFPSESFDSDRMKGVFEEVKFYFDVIIVDGAPVIAVS
DPIILGSEVDGVLFVIMAGKTPREVVKRAKDLLSDSNVNVVGAVLNNVDEVLPYYYDYRYYGYAYRGTG
© 1998-2019