BYKdb

Dataset for cluster tadcd of phylum candidate-division-ta06

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A101I342 [Bacteria] Bacterial tyrosine kinase [candidate division TA06][candidate division TA06 bacterium 34_109] (length=722 residues).
MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKPTYQSTALILIETSDKGLSFLPITDMNPRKTVIN
NHIEMIQSRTLFERVENAISNSGYMDSLFIGKYKEKEGRISYLRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKIIVDQ
YYNINLEMTRGELSEVRKFLEEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKLVEMISNFEGQKKQYFVEREMLLS
KLTYLKENLSQSNKMIAEGFLNELDPFLERSKRELDSLQSNYAYFLSIGYDTTHPKMKEIKTRVENLKNNIIQNSKTSFQ
KKYFASNPLDYSKNLMDEIITVQLDVKVKESMIEAFNNVLKIFEEKMKKIPFQELMLARLERNKKVSEELYLMLKGKFEE
AKVAEAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLALILGVGIVFLKEYIDDSVKDIDEIERELKINIIGNIPSIK
IKNGKQVSAEKGKLLTELPENSPIVESYKILRTNLLYHSDGKEPPKVVVVTSATKGEGKSTTASNLGIVMAQLDKKVLLI
DGDLRRPVLDKMFKINFDKGFTNLLKGEISVEDVIYSSGIDNLWIIPFGERTSHSTELLEGRITKKIFEQLRNMFDFIVI
DTSPVLSVADPTIISRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPVIGFVFNNINTESFYGKYYYYHYYYHYHTKEG
ER
>gnl|bykdb|A0A117M5Y1 [Bacteria] Bacterial tyrosine kinase [candidate division TA06][candidate division TA06 bacterium 34_109] (length=723 residues).
MLEDLQDQEKLSLNDYLAIVSKYKFLILIVALLIFSLSVLFTFLEKPKYTAKTVLMFERVNTGSTFFPVTDPLGMEALLN
NQTQILKSRSLMERVNLSLKEDTILKQKGYKKVSASRQNLSINKIKDTYIIEVVYKSIDPFLAAYITNKIAREYYKMNLD
AMRMTVSQVRIFLEEQLKKIEKELNSSELLLRDYKKSNKISSLEDETRVLIDQVSQFETDYKGIMLNIDTYTKQKEYLLK
ELDQTQKEMIENISSYRTDVMENIFAEISKLETDKAYFISQGYSNDHPKILQINSKIESLKKQLKDETEKSLKENRVQQN
PLKYSGEIIQQIAEINNNVSLLQAKAEGLKKVIDVYNSKLENVPDKSIQLVRLERNAKVNEDIYLMLKRRYEEAKLQEVA
EVGNLSIIDTAVVSKIPVSPKKEKNFLLGIILGIFFGVTLAFILFFLDESIRTAEEVEHYTGEQILGIITYIGGNGKKDK
VKGEKKVTEDEIVEKIRKKLIINMEPHAPIAEAYRSIRTQIKYRSKEGEKLVYVFTSSIPGEGKSTTISNLCITMANLGK
KVILIDADMRKPVIHKIFNVKNGIGLAHYINRKATYEEIKRDTEVENLKVITYGTRPVNPSELLENPKMKELLEICKNEF
DYVFLDAPPVNVVTDPIVLANYADKLLWVVSPGKVKRKDLRHARKLLVPVKRKILGVILNSSKTEFSSYYSVYYKKYYGE
GEL
© 1998-2019