BYKdb

Dataset for cluster tadcd of phylum candidate-division-wor-3

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A0S8GJS7 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR_3 bacterium SM23_60] (length=768 residues).
MKQQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPKTYEAEVTFKLDLSESKPLFYSPIYSQKQIDPVESQLEII
QSRTLAQTVVKELGLNFVVKDSYRTYFDSVFVADDCPPGTYYVRFHNSEFTIVGSRGEVIGTGTVGEHYDSGALRFRINE
KRADNMKLTIMTLNKRARELQKQVRVDQIRNSQLVRLKARSRNPQVAAAIANTLANEYINYSLRTVREVARGSKEFIESQ
ILIFGEELNHAEEDLRQYKEKAGIFLLNASAHEIISSLAQFETERERAIVALHESESAIENLEAELSRDAASYGAYKQMA
SFPTLSSSPIIVSLKDKLQTLELQKQEMAQTDVGSNDVPRIEAQIQKTEEELQKATRQIVLAGPSIDDPVFRSIITQIID
QETRAISLQSRIAALNQIIGRQNARLKQLPEAEVELAQLERQKMANENIYTMLLGKLEESKIAEAMQISEARIIDVANVP
ERPTHPRPVLNAVLGVLLGLMIGVGGVILKERLDTSVKTAKELEELTGSSVLASIPLMKGKERALIATVEEPHSEIAEAY
RILRTNIAFATTARPIQTLLVTSTIPQEGKTTTCINLAITLSQQGHKVIVVDCDFRRPMLHNYFAQYVTDNRHGLSDVLI
GRLKLESAIVRNSVHNLSFITSGTIPSNPAELLGSEKMVQMIEKLKASFEFVIIDAPPTLGVADARVLGRICDAVLVVVK
AQMTNREAVIDVKNEIERSGEKVIGFVLNGIDITSSYYRRRYHYYRSA
>gnl|bykdb|A0A1F4UBB9 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium RBG_13_43_14] (length=771 residues).
MKSEPTLQDYIGVIIERRWLVISCVIGVTFCALVISLFLPKIYEARVRFKLDLSESKPMFFSEIYTPQRVDVVESQLEII
RSRTLARTVVQDLGLNFVVNNHKIYFLDSIRVANDFPPGKYSVRFRSENFGIYDKGDREIGTGKVGDLFDNGKLRFLIRE
RPNEDMRITIKNINKSAEELQDIVNASQIKNTVLVMLKAKSNSPELAAKIANTLAYEYINYSLSSIREAARSSKEFIESQ
ISIFGEELNNAEEDLRHFKEKTGIFLLSETATEIISSLAEFEVSREQAVVELNEMESSIVNLEDELSKDEATFGVYKKMA
SFPTISNSPIITNLKDKLKSLELKKQELVQINAKAGEIAEIDRKIQAAEIELKKATEQIVLSGPSIKDPIYQSLISQIIN
NGTKAIALQSRIDALNQIISRQNRRLKQLPEAEVNLAQLERQKMANEEIYTMLLGKLEESKIAEAMQISEARIIDEAIVP
DEPYSPKPKQNTILGFILGLFIGVGAAFLLEYLDTSLKTSKEIEELTGLSVLAAIPLVKNKERTHIPTIDEPHSQIAEAY
RILRTNIGFAATAKPIKTLLVTSTMPQEGKTTTCLNLGTTLAQQGHKTIVIDCDFRRPMLHRYFSAFIKDNTHGLSDVLV
EHLQLKEAIVKSTTPNLFFITSGTIPSNPAELLGSQKMQQVLNTLKETFEFILVDAPPALGVADARVLGKIVDAIAVVVM
AKKSSRDAVLEIKEELERSGEKIIGFVLNGIDLSRHYYRNRYYYYYHTTAE
>gnl|bykdb|A0A1V4QH99 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium 4484_100] (length=771 residues).
MKSEPTLQDYFNIIMERRRLIIICVAVTTVVALIASFVLPKVYEARVKFKLDLSESKPMFFSEIYTPQTVDPVESQLEIV
RSRTIAKSVIKKLGLNFIPANENYSYFDSISVSEKFPPGKYYLKFNDNNFVFLDKDGNEIGQGQVGRLFKKGSIQFRVKT
KPKDILEVKIMDMEKRVDKLLSNISANQIKNTALVLLKARSRNPYLAALIANTLAREYINYCLQVVRESARGSKEFIESQ
IRIFGDELNRAEEELRKYKEKSGIFLLQESAKEIIKSLADFETQKEKALVELHEVESSIKNLETELSKDEAAYGAYKRMA
SFPTLSRSPIILSLKKKLKSLQLQKQELLSRGEKGEKLIRVEADIQATEQELSKATHQIALAGPSINDPIFQSIISNIIN
KETKKIALQSSIDALNQIISRQNRRLKQLPEAEVNLAQLERKKLANEEIYTMLMGKLEESKIAEAMQISEARIIDSATPP
KNPMAPKKKQNTILGFFLGLIIGIGGAFLLEYFDTSLKSTKEVEELTGLSVLATIPLVKNRNQHIPTIHEPYSQIAEAYR
ILRTNLAFTAATKPLKSLLITSTLPQEGKTTTCINLGITFAQQGHKVILLDCDFRRPMLHTYFGELAKDNHHGLSDVLIR
KLKLNEAIRKGTLGNLFFVTSGTIPSNPSELLGSPRMREVLQELKKQYEFILIDAPPSLGVADARVLGKICDGIIVVVMA
RRTSRDAVIEIKEELERAGDKIVGFVLNGVDFEGHYYRHRYYYYHYPSVKK
>gnl|bykdb|A0A235BXH5 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium JGI_Cruoil_03_44_89] (length=703 residues).
MEEEQVSFEDYLRIIYERKWIIIVAFFAVVISTAVFTYRQEPVYEATCTIMVESRKRQRDIFELVYPRWVNILNYSEILK
SVAIAKSTIEKIAGSDLPISKTGNPVGVLRGGLSVTRVRDTDILEISVKGKTPQEASVLANTIAEVLIESELATGRKEYT
EQRHFLEEQIPKVKERLEIIENNLKKFKEETGLIALSEETGQLTEKLFEFDRLRGQTESELEFQKTKLVSLEASLEETQR
TLVEKISQVSSPYILELRRRLVELETTHSMYLVQGLPENNPKLVSLRKSIDETKAKLIEETNKIKDKELPTLDPLSFSQK
LVDEIISLRTEITAGETRLNVIKNILKEYERRLQRVPGQELRLVGLEREREINASTYELLVQRYEEVKIAEAGKTSNVRV
IDPARPPGRPISPKKRMNLTLAVVIGLIVGVGGAFVVDYMDNSIKTSKDIERYTGLSILGSVPIVKKKNDTPLLLLKGFP
SRSALHEAYRGIRTSLQFINPDNPIRTFLVTSPLPREGKTTIALNLAVVLSQLGLKTMVLDADMRKPAVHKFLGIEGKSL
AEFLAHGGDIESFILPTEIENVSVIISKETPPNPAELLSSNKMKKLLLDLKERFDVIIIDTPPVLSCTDATVLAPLTDGV
LIAVQSHKTNRNALGRVRDVMESVRAKLIGVVLNAVPSGRGGYGYYHYYHYYHYYPEEEGKGN
>gnl|bykdb|A0A348MM93 [Bacteria] Bacterial tyrosine kinase [candidate division WOR-3][candidate division WOR-3 bacterium] (length=722 residues).
MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKPTYQSTALILIETSDKGLSFLPITDMNPRKTVIN
NHIEMIQSRTLFERVENAISNSGYMDSLFIGKYKEKEGRISYLRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKIIVDQ
YYNINLEMTRGELSEVRKFLEEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKLVEMISNFEGQKKQYFVEREMLLS
KLTYLKENLSQSNKMIAEGFLNELDPFLERSKRELDSLQSNYAYFLSIGYDTTHPKMKEIKTRVENLKNNIIQNSKTSFQ
KKYFASNPLDYSKNLMDEIITVQLDVKVKESMIEAFNNVLKIFEEKMKKIPFQELMLARLERNKKVSEELYLMLKGKFEE
AKVAEAGKLGSVKIIDKPVLNKSPVLPKKNRNYLFGFFLALILGVGIVFLKEYIDDSVKDIDEIERELKINIIGNIPSIK
IKNGKQVSAEKGKLLTELPENSPIVESYKILRTNLLYHSDGKEPPKVVVVTSATKGEGKSTTASNLGIVMAQLDKKVLLI
DGDLRRPVLDKMFKINFDKGFTNLLKGEISVEDVIYSSGIDNLWIIPFGERTSHSTELLEGRITKKIFEQLRNMFDFIVI
DTSPVLSVADPTIISRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPVIGFVFNNINTESFYGKYYYYHYYYHYHTKEG
ER
© 1998-2019