BYKdb

Dataset for cluster tadcd of phylum candidate-division-ws5

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A419DFD6 [Bacteria] Bacterial tyrosine kinase [candidate division WS5][candidate division WS5 bacterium] (length=714 residues).
MSRIEDSLEKAVKLRTVPPPVIRKEPLPPDFSRSYYEPAEKQAHLRDYLEILIRRKWIILAFLIAVVITGTVATFIMKPL
YKATTTIQLRSGKTEIVTFKDVYKELNDLETQYNILSSTNLAERVATKLNLTNITEEGRKYSVGKISQGLEVEPIKKTEL
VTVSFISNNPEVAAIVANTVADEYINFRQESKLKPAQLGGQRLRKEVEDARERLESSEKELNEYVAKSEFVFTKNDLDYE
NLLAQKYASLDKELNQVTAERISKEAIYQEVKKSGIDYNVVLEKPIIQALMKDYIKLESEYSNLLIIHKPEYPKMLQLKD
QIESIKKRIEIEEQTIINTLQSDYQLALKKEKLLSSAIVKLRQDVTELQKDMIQFQILKREVETNRVMYDSLLQRLKEVD
ISTTLTESDVQVLDKAQIPRSPFKPQKAYNIGLSLLFGLFGGIFLAFFVEYFDNTIKTDADIEKISHIPVIGNVPISKTS
VKKLINDSSNDGNAFSEAFKSIRTSIQFSNTSRFPKPLLITSPVSQEGKSTISASIAKSLASLQKKGIIVDADLRRPNIH
LLFELDNSTGLSTYLEGSTEFNGLIKKSQYPGLDIVTAGPIHQNPSELLNSSRIKELIDVLSAAYDYIIIDSAPILGMSD
SLILSTISEGVILVIKANATPADALIQSNKALANVTANTVGIILNQVDFKSGYAYSSYYGSPYLNNDGRGKKTV
© 1998-2019