BYKdb

Dataset for cluster tadcd of phylum candidatus-aegiribacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A1V4MTL3 [Bacteria] Bacterial tyrosine kinase [Candidatus Aegiribacteria][Candidatus Aegiribacteria bacterium MLS_C] (length=746 residues).
MNERAFQDERESIDISEYLWLLYHNKWLILAFLVVSVAASIWITARTRPVYRSSATFIFDLGSSMSQTLNMSNVLWFEMD
PMRNNQIQIIHSRSMAEAVADSILRSPNTDSLLTILYADLGVPSENLRGSLVGLVRGSISVSNMKDTDFFVLSATGYSPS
AAATMANLVVQTYYRKNLTDTRGENTMVKFFLAEQLDIIARELAMAEDSLTGFKEEHGIVSLSTETAQVVQSLSSFETAA
AQSRTEQGALEAQRVYYQGQLEAGRSELAEDIASTSSALINQLESDMATMEATRASLIYDGTGEDEDVILDLDRQIQARR
EALTRALREVAYSRYPYNPAQSVQNTVSELAGIEARLRAERIRESVLGSVIASLEDSIATLPELELRLARLQRNWNVSED
IYLLLRTKYEEVRIAEAGQIGNVTIVDTALPGGLIKPNRNRNLILGIFAGLAAGIGFVFLKEQLDSSIKNPEDIEKLDIP
VIGVIPKVSRSEVITEEGRQGLIMITAPRQAASESYRDLRTSLRFAATDGMMKSILVTSACPREGKSTTVGNLAVAFAQT
GSSVLIVDTDMRRPVMHKVFNVPREPGFSEAMAGISPVEEAIRNTGVDNLSVLTCGYIPHNPSELLGSSRFREFLARLEE
MFDIVILDSPPVAVVTDPIVMSPEVDATLVVAGVKKIDRKVLRSAWEKLQRGSGRTVGAVLNGFDPANVYTSYSYYSYKY
HYYYQDDVRKKRKIRDLTRRKPGRSD
© 1998-2019