BYKdb

Dataset for cluster orphancd of phylum candidatus-aminicenantes

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A3D4NYA6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=240 residues).
MVEPKVKSIELIAHLSPKSNLAESYRTIRTSLLLSSADKKPKSIVVTSALPEEGKSATLCNLAVTLAQAGKTVLIVDSDF
RRPTQHKIFKIRNINGLTNYLTSEMELKALVKETGIPKLYLINVGPVPPNPAELLGSEKMGNLIESLKQWFDFILFDSPP
VLTVSDAMVLGPKIDGIILVVWGGKTAKDALKQAKERLDMLKVKCLGVVINNLNIQEHDYYHMHHHYHYYGEGKGGEKTT
>gnl|bykdb|A0A3D4P3H6 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=307 residues).
DNTVKTSEDVEKYAHLPALGIVPTFTVDGYRKGYGYGYGQRGHAKGIILKTTDGIHQTEDKGGAGAEARESGAKNQGTQV
KSIELISHRWPKSDYAESYRSIRTSLLLSTADPNLKVIVVTSALASEGKTATVSNLAVVLAQAGKHVLILDADLRKPRQH
RIFGIRNLNGLTNYLTANLELKALFKQTEIPLLYLINAGPVPPNPAELLGSDKMAGLIEYLKPHFHYILIDTPPMLAVSD
ALVLGPKLDGVVLIVQGEKTSREAMKRAKEKLDLLKIKSLGVVINNLNLQRHDYYYKRYYYHYYGEE
© 1998-2019