BYKdb

Dataset for cluster tadcd of phylum candidatus-aminicenantes

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A1F5AEV3 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium RBG_16_63_14] (length=756 residues).
MATEFPKEPQTGLLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTASGSVWIEDDPNILPFEDVQSFGAGS
NLQSHARLLRSRTLASDTIDKLKLYENSDFAGKPEKGQARPDPADPIYREVLTQIFLSNIGVSTAERSRLVDVRFSNRNP
KLAADILNALFDGYIEMMVRKRYAASEQATAFLNTQIAEIRTDIDKKERELNKYGSEKDILPLTTAEAPTVARIGEVNRA
LTDATLDRVNKFNAYNQLNAAPLGEIPDAPPGSLIQRLREQYINLSLDYRTRLATVRPEFPAMQRLKSELDAATEALQNE
TQNLIRNAYNDYQNALDKEQSYQKLLNDQKNMAYKASSNSVVYNSMRIELENRKALLEALSRRQSETDVSSRLKGLEALN
VWIVDKADYPLRPAFPNKRKNVLMGFLFGLAGGIGLALGLEYLNHTVKTSKDITHSIGVPTLGAIPAFEAEAKPKGPKAE
FARLISMLRGKGERKETKASRRVEDQRVRFLKPNGTDGDSVGGGMRGGKIDLIASREPQSIQAESYRSIRTTLFVSSPPG
KIKTILFTSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGNGPGLSRYLSSHIEPADVGKPTEIP
NLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDFVLFDTPPLLAVSDALAMGPMADAIILVARGGQTPIPALKQAKQK
LDAHKLKCLGVILNGVDLVEQDGYYARQYYHYSKPE
>gnl|bykdb|A0A1W9P661 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium 4484_214] (length=760 residues).
MRDNKGKKEIDLFDIWRVALKRKWIIITIVILFIVGAGIYSFTRTPIYQATATILIEEPGSSMFNIEEMFNYTPYYRYDF
LGVYFNTQLSLLTSRTLAERVARRMNLSERMELNTQSSSSPASFLGQIKSFFSISRWFNRTKEVTQPALQEFVPPADLSA
NYAFVVLSGLKIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQIAQLRNELAAKEKE
LQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRELSSLQIDALSPNIDNPVIQSLKAEYTRLKNEYD
EKIKIFKPEYPDMVRLKARLDSLRTELEKEISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDV
ENKRNLLNSLIAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVAFILEYLDNTIKSP
EDVEQLVDLPSLGLIPLVSASNGVKKASYTHQYSYGQQEGETLEEEVINNIELINYYYPNISIAEDYRTIRTSILFSSLE
DKPMAIGFTSSLPEEGKSTTLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNTNRIGLSNYLAGKSSIDEIIHPTKITK
LDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDFVLVDSPPTLAVVDASVVSTRMDGVVVVIRANKTTKKSLLYAVETL
RKAKAPILGVVLNEVPFSHNGYYSPDYHGYLKGYYSSSKQ
>gnl|bykdb|A0A2N7QEB5 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Aminicenantes bacterium] (length=734 residues).
MNDNNIEPQADEIGEIDLKKYLDILLRRRWTIISVTVIAVVISLLISLVTRPMYTAHGTVMIEKEPNILSFEDIFQIETF
RDDYFQTQYKLLQSRSLAERTIDKLKLWEKTDFSGNRPLTSEELKDPRIKQKMIDRFLSRLEVKPVRMTRLVEVTFSAHD
PALASECVNTLFDSFVDMNIETKSEATEQATEFLSQQINDLKKEISQKEQELQNYGQEKNIVILSDKETTILDKLNEVNK
ALTEAQIDRVRKEAYYNEIKNASPDFIPEALSNPLIQRLREDYLKLSREYAKMQEQFQPEYPEMQRLKAELDTARDLLKN
ETENLVKAAYSEYQAALKKENSLRDLFERQKEEAFRMNSNAILYNSLKIEIENRKNLLESLLKRQSETGVSARLKGLRTS
NIRVVDRADIPIRPSSPKKFRNLLLALFLGLFGGVGLALGMEYLDNSVKSVEDVERYSGLPTLGVVPAFGDNSGSYGHYY
AYHSSESRSKRNKSEKKDTKQQEEVTNIELTSHFAPESVFAESYRSLRTALLLSAPQGSLKMVMITSPLPGEGKSTTISN
LAISLAQMGKKILLIDADLRRPNQHHNFNIKNNNGLTNYLAMDLEIEKIIKPTMVPSLYLINSGPIPPNPAELLSSDKMS
QLLSKVREQFDFILIDTPPILAVTDAQILGRLVDGLVLVIRAETTPREALQQARELIDLLKLKTFGVVVNYLNLNHRGYY
YRHYYRHYYKEYRR
>gnl|bykdb|A0A3E2BKD4 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Saccharicenans subterraneum] (length=765 residues).
MDRTTPTTAGPRQTQQNLLEQILYYWNAMLRWKWTGLTVAILIVALTLVYVFISPHIYSAKGTIWIDETQSVLPFEELSR
LSGGINSQSHALLLKSRSLASDVIEKMKLHEHPEFMGPKLPVRLAKERIQPDNPVFKEKLIDEFIASLNVSPISGTKLIE
VSFDHKNPRLAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQITALRKDIEEAEKKLAELGTAQGILPLSSAEAPLIS
KITEVNTALTAATLDRVNKYTTYNQLKALRPEELPESPANPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEIEA
TYESLANEKENLIKTAYADYQGALAKEQNLQRLLDDLKAQAYKANSTAILYNSLKIETDNKKALLEALSKRQSETDLASR
LKDLQALNVWIVDKASVPVNPSFPNRRKTFLIGVLLALIGGAGTSLFINYLVATVKSSRDISQATGWATIGTIPAFEKEY
KPKGPRAEFRTLSSLLKGKPGILDKKKKKKHSQPKPKSVSLKADQASQAPAETPDRNNHQIELIIQREPRCIQSEAFRSI
RTSLLLSFDSPARKALIFSSPLSKDGKSSVISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVDYTWGLTHFLSAIVDAS
EIIRPTAYTNLFVVPSGVTPSDPLEIMFSEKMKAFINFLKQQFDFVLFDSPPILAVSDALVLGKQVDGLILVVRAGQTPL
NALKQARNKVEDHKINCLGVIINGVSLLEQEGYYARQYYHYSKPL
>gnl|bykdb|A0A3E2BQJ8 [Bacteria] Bacterial tyrosine kinase [Candidatus Aminicenantes][Candidatus Saccharicenans subterraneum] (length=737 residues).
MSNENYVEPQALDAGEIDLRKYIDIIFRRRWTVISITLIAAALSLIISFVTRPVYKARGTVMIEKEPNILSFEDIFQIET
FRDDYFQTQYKLLQSRSLAERTIERLKLWEKKEFSGSKSPTADDLKNPVFRQKMVDKFLGRLEVKPIRMTRLVEVAFKAH
DPTLASDCVNALFDSFVDMNIEAKYETTEQATEFLSEQIEELKKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELN
KALTEAQIDRVRKESYYNGIKNASPDFIPEAMNNPLIQRLREDYLKLSREYAKMQEKFQPEYPEMQRLKAELDSARELLK
NETQRLIKAAYADYQAALKKEVSLKELFEQQKEEAFRLNSSAILYNSLKIELENKKNLLESLLKRQSETGVSARLKGLRT
SNIRIVDRADLPLRPDSPRKFRNLLLALFLGLFGGLGLALVMEYLDNTVKSAEDVERYSGLPTLGVVPVFDEDATLNGHY
YAYRSGEEEEAGGKKKKKEQDKAEGENGSEPRSIELISHFAPDSTFAESYRSLRTALLLSGPLASLKSLIITSPLPNEGK
SVTISNLAVSLAQMEKKVLLMDADLRRPKQHRIFNLKNHDGLSNYLTMGLELNKLIKTTLVPSLYFINSGPVPPNPAELL
GSDRMKALLDRLKAAFDFILIDTPPILSVTDAQVLGKMVDGLVLVVQADRTPREALKQTREVIDLLQLKTYGVVINALNL
DNRGYYRRQYYRHYYQK
© 1998-2019