BYKdb

Dataset for cluster orphancd of phylum candidatus-cloacimonetes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2A5AMW6 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium] (length=704 residues).
MAMKNSELEMYQLKQFFIDVFYKEFFLIILLFFASISAGSYIIYVKTSINYKSSTILNLKSSFVGEKALFPWIKESSGFK
PNYIKKKLRDSDILKDVMLETKTKISVGMILKKLKIKNYSDDSNERQRVLGTVDIGKSSSSNIFTLEFSLGGTLKNDLPL
ILKLLISKFVKNENDEIHLSLEKKLSIFAFQREEIRKKLSELILKKSSYQEKNNSLDIQAEMDSIILFINKNMGVLDRLD
GETLVLSQRKIEVSKELKNRLKESIDLSLFDKSYGELRNQLLELEADKSVLEETYIKGHPKLRSIGSKIKVLRTRANELN
DRFNNGSGRMSLDPVARSLNQEIRGLGFKVAALIQQRKSISEITKKEKKNYKSLNEAQSQILSLVNLEKDLRNEESDLTK
LIEIGGLNSKTIFLDFEYVKEVSDAVKFNNQFRNFGPILVFILALISVALVLYTKYFFSGKFMRSSDVSRVLPQPVYGMI
TNSKILNGDEIVCIENKTPAAESFRKLRANLSFHFDDLKTITISSAERGDGKSFVAVNLAASMAMMGKKVLLIDGDVRLP
RDHLMLGLENLLGFVDLMDDCSLDDVIQETKVNNLDFMSSGITSQNSADFLHSSRFGTIFTMLEERYDFILFDTPPVAYA
TDAFIYAKRTSVTLFVLSIDKTKVVNVEKYLSELENLGIDTMGLVINRVSEAELFGARSYKYYY
© 1998-2019