BYKdb

Dataset for cluster tadcd of phylum candidatus-cloacimonetes

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bykdb|A0A1V4R675 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonas sp. 4484_140] (length=717 residues).
MEQFPEQEQEIKLRDYYRIILRHIKLIGIIFVLVMVATIYYTARAPRIYESNGKILLELNKQTDLFFSTGGFGRNDLNNQ
MEVIKSPSVMESAVEKLKRNQEAENFPILSLDNPSSILAKNIDVSAEREVDIIDISFKSTNPNEAQAAVNAVMDSYQDES
LKYTRAEVTSVREFLEKQLDVTSKKLAISEEDLRAYKIAHEVFALTEETKEMITNMVEFEAQLSSAQTELQIVEKKLAYL
KDELIKIDEALGEEMASISSPVSEQLRQKLIENESQLAILLTKKGYTENHPQLVSLRTEIDNIKRQMKSEIAKILEVNKY
SFNPLDRRQQLFTDIISTEVEFQTATAKVSGLETVVEEYSVRMSGLPDAELELARLERSKAINEQIYSMLITRYEEAKIS
EEGKLLNTKITNLSDVERYVKLPILGTIPDIPLDEKQLADIEDRMGKEKDKERLQELTTTQRQMVARLVPHYSPKSPIAE
AYRTFRTNVVSLPFKVPGLGKIFLVTSSGPKEGKSTSAGNLAITLSQMRSKTILVDCDMRRPMIHNLFIVSRENGLSKFL
TTDNIDIHDIIKPSGMDNLDIITAGHVPPNPSELLSSKKMDELFAKLREEYDYIIVDSPPIIAVTDALILSKKVDELVLV
IRVNSTEREIIEQAKSLLHNIDVKVAGVVVNGIEVKKYYSGYKYYYYYYYYYYTDDEKGAKKKKRKTQGHSRLSRKA
>gnl|bykdb|A0A1W9P0R7 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonas sp. 4484_209] (length=712 residues).
MKTNRTKEAILTKEDKDSHLDIIAYLKVLWRRKIVMTTAVGATLFFTLIYTFISPKIYEAQTSILIQQIPEGKDTFLTPW
EYIGARENFINNQAQILKSRTNLKLVIDKIRKEHSGENLPILKDPDPITSLAYNIIVKPVERTDIVNILVHSTDPKEAAI
IANTVAENLLEQSRLTARSAVSEVRKFLEKQLKIVQNNLKESADSLRVFKEKNRVFSLSNEGEELFTKLSTFDSKYNEIE
ADYITKKKQLDFLKKKYEQNQKNLVTDITEIKSPLIMNLRKKLISLETEYSNYLLQGLPENHPKMEKIKSLINETKRSLQ
KEVRKYISSGAENGNLITENQKITKLAQLERAYKINDNTYEMLMQKYEEAKITEAGQLGSVKIIDKAFIPTFAIKPNKKK
NLLFAILVGIGIGLVFTVFTEYIDTSIKEPKEVEEYIGEPTLGIIPNINHTFLSKEKNNGKLGNAKKLLLTEFPPRSGVA
EAYRSLRTNLQYFNTDKPIKSILITSSIAQEGKSTIVSNLAISLSQLGLKTVMVDADLRKPMLHKLFEADLSPGLTNLII
SKDVEFKKTIKNTRIENLFLITAGSVPPNPAELLESKRMKEVSYEITKEFDYLIFDAPPIVLVADAVILSTLVDGVILII
EAKKTRRDAIFSSKEIIKNVGGKILGTVLNKTRFSRMDYMYGGYSGYYYYGYDESGHKTKKKKQKGGKRNEL
>gnl|bykdb|A0A2G6BVY8 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium] (length=749 residues).
MFEDDNNQENYSFPWKEYFSIIYRGRWWILLTFITISSLSTYYTLRMTPVFQAETTIEIKDKDNMFSDMSSPFNLKRSDR
VIANNSELIKSRTVAKMVMDEVDKSEFAEHISVSKEVRKDLNENSRIQMLRRKLSIKPIKNTDILRLIITSSSPFEVSFL
ANTYAEQFELYSKLSNLGEVGAVTNFLKDQLDVIKKRLKLSEEALELYQKEGGIVVLEAETQLLIENSAKSEAKLNEIEL
NYQSANQKILFLKKELDEKSKRIVEDISRNATPEIEKLKIKVGELNAKKLNIELEKSAGYKRILKNLQKQIDNLEAKITE
KAKYFANSAQASANPVEDKSDIMRKILEAQAEQIGLKAQAKKVQETINNYNKKIAMLPETATEFARLKRKYEIDEKTYIM
MENKYNEYKIALAGQVGNARIVDKAITPKSPIRPDKPLYITIGLGVGLGLGVFISFLLAFFDNSIKTIEDIERFKINFLG
AVPTINIKDMKKKMRKKMDDLTDSEKTKINSKLISHFSPKSPISEAYRTIRTNIYFSSVDSPPSVIVVSSSVPKEGKSTT
SSNLAVTIAQSGKKVVLIDADLRRPVVHKNFNILREIGVTDFLIKNSSVRDISKMTDIENLSIITCGDIPPNPSELIASA
KMDKFIEELKKEYDVIIFDTPPVITVTDAVVLSRKTDGIVLVVSSGTVGKEEVRRSQDLLRSVDANIIGVILNNLDIKKL
YGNYYYYYHYYQYYYYYGADKKKKRRGRA
>gnl|bykdb|A0A2N2KUB8 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium HGW-Cloacimonetes-3] (length=761 residues).
MDNQTNTAPVQDEINLSDYLRIVLQYRYLIVLVFSLVVVSTVFYTARQDKIYSASARILLEDQKGSTDLMFLATPGVGKN
SLNNQIELIRSKPIMSLAWDIMKKYPDWDTFPANTSGNPIISLSRMKVESKRETDILTISFESTNQTEAMAAVNSISEAI
QQQNTQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSAETAQLIIQSSELEALYESSLTDQAIKAKS
LDMLNRQLREQDSLLVDVNNILKAPYISELRKQIVDTQSLVTKLVTKNEYPLDHPQILLLKREMENAKATLDLEVRKLVA
LSVNNDPLTTRSELLGKIIQANLELEMARAKVDGLEQTKEMYDQRIIAIPNTELELARLTRNMLLDEKIHGMMMEKYEDA
KIAEQAKVGNVRIIDFAERPTIPIKPRVSMNILVGIILGLGLGIGAAFIVHSLDTKLRTLEDMETYVRLPIVGTIPLIRE
SESKLQEFNYMIEAAEGENREQLTRSMHFVLMQLVSHYAPKSPIAEAYRTLRTNILARKAEGSTTLLITSSGPKEGKSTT
IANLSITLAQMNNKVVLIDMDMRRPTIHSKFALEKENGVSDYLIDPDVTLDQVVKSSGIMNLDIITSGFVPPNPSELIAS
PRSDVLIEELKKRYDYILFDTPPIIAVTDALILTKKVDMTFVVVRCGFTEKGIIKRTKELMENIDGKIDGIIVNSIYVQK
YYSKQNYYYYYYYYYYYYGDEVPKKQKKNVNRFLRKNKSVS
>gnl|bykdb|A0A2N2KXM8 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium HGW-Cloacimonetes-2] (length=762 residues).
MENQHINPVVQEEIKLSDYLRIIVQYRYLVVLIFTLVLAATVIYTARQPKVYSTSSRVLIENQKNTSDLMLFATPGVGTN
ALNNQIEMMKSLPLGNRAAEIMKKHRDWESFPISQSASPGAFIKARMKVESKRETDILTISYESTSQSEAQAAVNAVAEA
IQQENTLYARLEYTTVREFLEDQLDAISRRLQSSENDLREFKNANQLVELSAETQKLIEQSAEVEAQYEQALTDQAVKAK
TVEMLQRQLSEQDSLIVNVENILNAPYVNELRRQVIDTQALITNLVTKNEYPLDHPQIALLNAELDRSKANLDLEVRKMV
AIQMQSDPVATRSDLLNRIVQARIELEMARSSVSGLEETKEMYAQRMITLPNTELELARLRRNLLLDEKIHGMMMEKYED
AKIAEQAKVGNIRIIEYADLPRVPIKPRVSMNILVGIILGLGLGIGAAFLIHSLDNKLRTLDDMETFVKLPIVGTIPVIQ
ESEARIEEFNELIENAEGENKERLMKSMHFVLMQLISHYAPKSPIAESYRTLRTNILAKKPEGSTTLLVTSSGPKEGKST
SIVNLAITFSQMNSKVVLIDMDMRRPMVHNKFGIEKENGLSDYLIDADVKIEQVVKSSGIVNLDVITSGFVPPNPSELIS
SARTDMLIAELKERYDFILFDTPPIIAVTDALILTKKVDMTFVVVRCGQTEKGIIKRTKELMENIDAKIDGIIVNGIFVH
KYYSKQNYYYYYYYYYYYYGDEAPRKQKKDVRRFLRKNKSVS
>gnl|bykdb|A0A2N2LDB7 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonetes bacterium HGW-Cloacimonetes-1] (length=765 residues).
MENQVQNQSNVSQDEIKLSDYIRVIVQYRYLIVLVFVLVITLTIFYTARSPRIYSASSKILLENQKSQSDFLFLATPGVT
STTINNNIELMKSKTIGTMAWEIMKRNPDWDTFPINSSGSPVNTLRSSVKIESKRETDILTISYESTNQVEAMVAVNSLA
EAVMLENTQYARLEFTNIREFLETQLDAITRRLQTSENDLREFKNMNRLVELTEETTKLIEKSSDVEAEYESALTDQAVK
AKSLDLLNKQLREQDSLMVNVNNILKAPYVAELRKQVVDTQSLINKLLSKNEYPLDHPQIMLLNRELENIKATLDTEVRK
LVKISLNSDPLQSRSDLLSRIVAANLELELTRAKVNGLSQTKEMYNERIVTLPNTELELARLVRNMKLDEKIYGIMMEKY
EDAKVAEQAKVGNIRIVEYAEKPVSPIKPRVSMNIMVGIILGLGLGIGVAFIVHSLDTKLRTLEDMETFVRLPIVGTIPM
IAESESKLEEFNRMIEQSDGEHKEQLLKSMHYVMMQLVSHYAPKSPIAEAYRTLRTNILSKKSEGSVCLMVTSSGPKEGK
STTIVNLAITLSQMNAKVVLIDMDMRRPMVHNKFGVEKENGSSDYLIDPELTIPQVAKATGIQNLDIITSGFVPPNPSEL
ISSKRMDQMIVELKSIYDYVLFDTPPIIAVTDALILTKKVDMTFVVVRCGYTEKGIIKRTKELMENIDSKIDGIVVNSIY
VQRYYSKQSYYYYYYYYYYYYYGDDVPKKQMKNVNKFLRKNQPVS
>gnl|bykdb|A0A3C1LP64 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonas sp] (length=763 residues).
MEQQNIPNPASDEINISDYFRIILQYRYLVILVFILVLIGTIIYTARQPRVYSASNRILLETQKSGADLFLAGTGTGKNE
LNNQIELIKSKPILNAAWEIMKKYPDWESFPAASTPNPAAQLASVKVESKRETDILTISYESTSQGEAMAAVNSIAEAVQ
QENTQFARLEYTTIREFLETQLDAISRRLQSSENDLREFKNMNKLTELSAETTQLIEESAKIEAEYEAALTDQAVKARTL
ELFQKQLQQQDSLVVNVSTVLKTPYINELRKQVIETQSLITKLLTKNNYPTDHPQIIALNAELERTKDELDIEIKKLVAT
SSTDDPLAMRNETLVKIIQTNVELEIARTKADGLAQTKEMYDERIISLPNTELELARLMRNVQLDGKIHGIMMEKYEDAK
IAEQAKVGNIRIVDLASRPVSPIKPRVSMNILVGVILGLGLGIGAAFLVHSLDNKLRTLEDMETYVRLPIVGTIPVIQES
EARMEEFNAMIEKAEGENKEQLSKSMHYVMMQLVSHYAPKSPVAESYRTLRTNILSRRNTTGSTSMLITSSGPKEGKSTT
IVNTAITLAQMNAKVILVDMDMRRPMIHNKFGIEKENGLSDYLIDPDVSIEQVTKATGIPNLDVITSGFVPPNPAELISS
ARTDILLEELKAHYDFVLFDTPPIIAVTDALILTKKVDLTFLVVRCGFTEKGIIKRTKELMANIDATIDGIIVNGIYAQK
YYSRQNYYYYYYYYYYYYYGDEAPNKLKKKHAGRFLRKDKPVA
>gnl|bykdb|A0A3D3EZ13 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonas sp] (length=762 residues).
MENQYQNQQPLQDEIKLSDYVRIVLQYRYLIVLVFILVMAATIIYTARQDKIYSASSRIMLEDQNQGAEFLFMGAPGMGK
NSINNQIEIIKSRPTLTLAWEIMKKYPDWDLFPIASHENPAGALGKVKVESKRETDLLTISIESTSPTEAQAAVNAIAEA
IQQQNTQFARLEYTTIREFLETQLDAISRRLQASENDLREFKNLNRLTELTAETTKLIEQSSELEAELEASLTDMAVKAK
SLDLLTKQLRDQDSLLVDIDNMIKTPYITELRKQVVETQALITKLLTKNEYPLDHPQILLLNRELENTRANLDREIRKLV
SVSVSADPLSTRSDLVNRLIQANVDLELARTRVDGLGQTKEMYEQRIISLPNTELELARLSRNMMLDSKIHGIMMEKYED
AKIAEQAKVGNIRIIDYATRPQIPIKPKVPMNILVGIILGLGLGVGAAFLVHSLDTKLRTLEDMESYVRLPIVGTIPVIR
EAESKLAEFNDMIEKSEGEARAQLAKSMHFVMQQLVSHYAPKSPIAEAYRTLRTNILSRKAEGSVTLLVTSSGPKEGKST
SIANLAITLAQMNARVVLVDMDMRRPTVHTRFNLDKENGSSDYLIESDLRVEQIVKESGIPNLDIITSGFVPPNPSELIA
SNRFDKMIKELKSLYDYILFDTPPVIAVTDALILTKKVDMTFVVVRCGFTDKGIIKRTKELMENIDARIDGIIVNGIYVQ
KYYNKQNYYYYYYYYYYYYGDEVPKKQRKNVNRFLRKNKSIS
>gnl|bykdb|A0A3D5VBP3 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Candidatus Cloacimonas sp] (length=759 residues).
MQDQFYEQTEEQEIKLTDYLHIISRYKWLIIAIFVLVVAATVIYTFHSPKIYSASSTIMLEEKSSENLLFSSMANKATSI
NNYIEILKSRPVLEAAYSIIQNSEIYPEIPLNPANHEEPDKFSPIGAIKEKLAVESQRETDIIKISYESTHPGEAKLVAN
ALALGLQNKDNEYARIEFKNVREFLENRLDETERRLRNSEEDLRSYKIDKGISMLSEETTQIIEQSAELELLLSEAETEY
AVAKNRLDFLTSELSDQDKLLSDVNSIITTPLLEQLRREIVTNQSKYLNLLSKPSYSPDHPELVALKNQIDNAKRQLNEE
IQKTTNVKAGTADPLVYRADLISSISKARVEKNIAESKVENLRKSVEQYNRQLSLLPDAEIELARLERNNRINEKTYTML
NEKFEEARIAEKSKMGKIRIVEEAQLPEAPIKPNKKMNLLIAIVLGLGGGIGSSFLLHSLDSKIRTFDDVRNYVSLPILG
TIPFIRVHDSDIDYLEKQIKNATGEGKEELKHIKQQVESRLITNYAPKSSTSESFRMLRTNIVAKKKKGQPLSLLVTSSG
PKEGKSTIISNLAVALSQMDKKVILVDLDLRRPMQHKIFNLEKNEGISDFLYDHDKELETFIKKTKIDNLDIITSGFIPP
NPSELLASSHMDEVLDILKQKYDYILLDTPPTMAVTDSIILAKKVDFRALVVRINQADKIVIKRIKEILDNVDSDFTGAI
INGIHPQKYYSSYEYNYYYYYYYGKEDEKKDGALPKKSS
>gnl|bykdb|B0VJW4 [Bacteria] Bacterial tyrosine kinase [Candidatus Cloacimonetes][Cloacimonas acidaminovorans] (length=762 residues).
MLENENNQLPVQEEIKLSDYFRIILQYRYLVILVFLVALVATVYYTARLPKIYSASTRILLEDANKQSDLMFLSTGGLGK
NTLNNQIELIHSKPIMNLAWEIMKKYPDWDTFPASQAADPASTLGRMKVESKRETDVLTISFESTNPTEAMAAVNSIAEA
IQQQNTQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSEETNKLIEQASDLEAEYEAALTDQAVKAK
SLDLLNRQLQEQDSLLVNVDNIIKTPYINELRKQIVDTQSLITKLVTKNEYPLDHPQIQLLYREIENAKEKLDQEIRKLV
NLAVTDDPLATRSDLLTRIVQANIELEMARAKVDGLEQTKEMYNQRLIAIPNTELELARLTRNLMLDEKIHSMMMEKYED
AKIAEQAKIGNIRIIDYAERPTVPIKPRVSMNILVGVIIGLGLGIGTAFLVHSLDTKLRTLEDMENYVRLPIAGTIPVIH
EAESKLQEFNDMINSATGENREQLTRSMHFVMMQLVSHYAPKSPIAEAYRTLRTNILAHKGESSIAILITSSGPKEGKST
SIANLAITFAQMNSKVILVDMDLRRPTVHSKLGLEKENGTSDFLIDPEVSVEQVIKPSGIANLDVITSGFIPPNPSELIA
SPRTDNLLEELKSRYDYVLVDSPPLIAVTDALILTKKVDMTYLVVRCGFTDKGIIKRTKELMNNIEGRLDGIIVNGIYVQ
KYYSKQNYYYYYYYYYYYYGEEVPQKQKRNVNRFLRKNKSIS
© 1998-2019