BYKdb

Dataset for cluster tadcd of phylum candidatus-coatesbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A1F5FG50 [Bacteria] Bacterial tyrosine kinase [Candidatus Coatesbacteria][Candidatus Coatesbacteria bacterium RBG_13_66_14] (length=791 residues).
MEQTTNPGRGRGAPKVSEYLLVLRKRKWIIIFAVLFSLTVAAYQSYTTSPTYVATASLVLETSGQSTDLLQGFYTSFQPY
RLETELQIISSRTICLGVVERLDLAFHPQVQLPDGVFFQDPFVKVGFPAGRYRVIEGESGFSVMDDAHNVIGECLYEQPF
VSNDGLFGFTLHDPEPHPKRIISFRVTNPIQEAESIRQATTVQQSSDSNAFTVSVSHTDPKMVARLANTIAEVYVDENLR
WKQERARKAREFIGQQIEVAEVKLRLTEDLLREYKEELGIVSFTDEARELIHRLSVVEENRNSLEQELAELEEQQGTVEN
YLNRGEIDLDTLTAMSSWPAFQTDQMLKEFVRTAGELTLEKQQLRQTSGLLNPRLAEIDGELDAVEGGIERRLTYIATSG
ALGISIEGAKSKLDETSNSISELTAELSTMPREEMELSIRERKSDVASKIHSLLLERYEEARINESMETGDVRIIDRAIR
PTAPVSPNHASDLLLGLAVGLVIGIGLAMIVEMNDTTVKSADEVTGLTGLSPIGTIPKATEEFEELGEGRLIVLENPRSP
IAETYRIIRTNIQYFGIDKQIRVLSITSPSKGEGKTTTTANLGVSIAQQGHKTLLVDTDLRKAKMHRFFNIPNTPGFTEL
ILGDRTDEEVIRPTQVENLFVLPSGHPPPNPSELLSSRRTQDILERFRQEYDKVILDTSPVLAVTDPAVLGSLVDGTILV
IEAEVSEAEAVKEAVNLLKNARAQILGFVLNKVDLTRTYKSNRYYHYYYYHHDDEAERSKGSIWKRFRGKK
© 1998-2019