BYKdb

Dataset for cluster orphancd of phylum candidatus-dadabacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A3M0ZE95 [Bacteria] Bacterial tyrosine kinase [Candidatus Dadabacteria][Candidatus Dadabacteria bacterium] (length=246 residues).
MEVIARPTSSGAEAVRTLRASLFLAAPGGAPGRLLISSAKPGEGKTCIAINLAAALAQMGRRVVVVDCDLRRPRVHKALG
LSQSPGVTNFLTGNVTIREVIRDSGQVGLDVVTAGPIPPNPVDLLDSVRMGELIRELEERYDHIVVDTPPALGFADVPVL
SNRLGGACLLVTQAGDTSRRVARQACEYLIRMQSKLLGVVLNRVASRSSGYSYYGYYGYYGYYSHYGEYYKRRPEDETQP
ALENTA
© 1998-2019