BYKdb

Dataset for cluster tadcd of phylum candidatus-dadabacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A0T5ZTK1 [Bacteria] Bacterial tyrosine kinase [Candidatus Dadabacteria][Candidatus Dadabacteria bacterium CSP1-2] (length=764 residues).
MEEGNKRDVVEYKSNELKEREDYPLSTQVRREYDTHIEEEPNLRDYIDVILRRKWIVISCLAISVVTVAIASLLMNRIYK
AEATIEIAPENPKITTFQEVVELEPQPQQTDSFYETQYKLIESKSLAKEVVSALQLDLHPEFAVKEKKPGFISFVNDTFA
QILQANEKKSDPIEIEKRQLAREEGLLDSFLDRVKVTPDRKSRLVQISFESSFPELSAKVANTLVDEYIGWVLERKLDAT
KAARRFLEKQLGEVKAKLERAEEELSSYAKGADIVSLDEKFNLTYKQLAELNDALSKAETERLTKEALYKEIQAGNYEYF
PQVISDSSIQTLDEEHTKLKSQYDNMSVIYGPNYPEMKQLAAQLGRIQSDIKGRINGIAESIKKDYQTALTKQNILMQRT
DEQKKLVTKLNDKTVQYRILEREVETNKSIYQNLLQRLKETEVASGIRATNIQVVDYASTPLIPYKPNIKLNMLLAILMG
LMGGVFLAFIFEHFDNTIKDEEEVKRRFSLPFLGAIPLVDENELQDLEKVVYANPKSLVSEAFRVIRTSILYSSPNSPPK
SLLITSTQPLEGKTTCASNLALSFTQSGLKVVLIDADLRKPRLHKLFLNNGYAFGLSTYLVGKMELSGVINRTSLDGLDI
ITSGPIPPNPAELLGSKRMKELIEHLLEEYDHVILDGPPIAGFADSRLLASVVDGVLLVTSIGITQRQTLRSSIEDILRV
RGRIIGTIVNRLESRRSKYGYSYYYYYNNEEGKRKKSNLHLPHA
>gnl|bykdb|A0A3M1K715 [Bacteria] Bacterial tyrosine kinase [Candidatus Dadabacteria][Candidatus Dadabacteria bacterium] (length=708 residues).
MRGMQDLMRLTAVRRVLAAVRRYRFVGLSFFIFVILGTLFFTFSQDELYRATSVVELRWNPKTEVFPFRDVSTQETWGGY
WSYDEFRNTQIEVIRSRRVLQRVVDVLGDPSLTPALLEARLTVEPVPDSRLIRVSYMDTSPQRAADIANTVVQAYMDVGV
ENRIRWIQQIVDWLRDRIDNTQDDIGRAQKDLFEFQKEMGSINLDKDRQQIEAEIDALHARYIDAHTRRIQLEGQLREMK
RLAEQGNSGLQQLAHALAVEDRQGAVATIQKRWVELQAERAGLSAVYGDAHPKMQALDRQLNALRSELLEAARKRIDGIR
AQMDIATAEEEELLKAMDELVSAALDRSKIWQRYQELSDEAVSRRQFYEVLLERFKEIDITRDLNREQAVLIESAVPPAV
AAWPNVRVNLAVGLFLALTGAIGMALLLNLLQQGVQNSEDLEAAIGVRALAELPYLQTDSIDYPLEKLMLHDPDSPLAES
IRVVRNHILFAPRGRRIRAILFTGAQPLEGKTTTANNLAIATAQAGRRVLLVDADLRKAATSKVWKARGRRGFADVLSGN
ARWQDVVQPTEVANLSVMGTGGDPSHPPELFQKEALERVLPVLQQEWDIVIFDGSPLLLVADSIVVSSVVDETFIVMEAG
RIHKREARDLVARLERIGQPTWEIILNKVTLPSAWGYDGYGYGYSYGYGSRGESELLVDQGDVTVETV
>gnl|bykdb|A0A3M1VEF6 [Bacteria] Bacterial tyrosine kinase [Candidatus Dadabacteria][Candidatus Dadabacteria bacterium] (length=783 residues).
MNRDKLPQLRPLTEGLPAGVEFEDGSDYQTLYPQFKEYLKVIIKYRMLILTSIVLLTLIALIYAFTVTPRYTAESVIKIS
TYQPILTATKIEDMLQQRSKEANYLETQVKQIKSYSLADRVLSHDNLKEQIFGKDSPGLLATLFGWDSKKGTEAHSKDNI
YNNSVREIQSYLDRIEVKPLRRTSLVKIQATFTDPVLAARVANTHAREYINWVREARVSQQSAGLKFLKGQAQELRQKVA
DLEREQADYAEANSIVAVNKDENITAQKMSQLNRLLTAATAKRLEAEHLYQESLKALKNNAAGIDDASTQEIRSRLAKLE
AEYQQLSAKFTPNYPKMQQLRYEIKALKQSIEGQRAQIVAGLKAKALAAAEEERSLKEELEKQKSMAFELSKRQVQYNIL
NRELQSARELLQNVLRQIDETSVAVEGNSSNVSIVDHAAVPLRPSFPKKGLVILIGLVLGTGLGFSLAFFLNYLDDTIRT
PEELTAYTALPSLGVVPSFEIENLLPENQSSVNGAGDIKAATGQTAKSNKGRGEKTGAPVPSKKPDNFPVVYLRDPKSLA
SEAYRTIRTGILLSQAGEPPRTILLSSAQSSEGKTTTTLNLAASLASAGGRVVLIDADLRRPSLLKIIDGEERIRPGVVE
VITGQANLEDVLIRDAMRRVSLLPSGNPPPNPAELLGSIEMAGIIDKLATMFDYVLIDSPPILPVTDSVILSRYVDGVVL
VVRGASTPRKVVLDAKERLRSVGARFLGAILNDVDVTSGDYYYYNRYYYSYYNQEKHDSRAAS
© 1998-2019