BYKdb

Dataset for cluster tadcd of phylum candidatus-delongbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2G6P3T5 [Bacteria] Bacterial tyrosine kinase [Candidatus Delongbacteria][Candidatus Delongbacteria bacterium] (length=749 residues).
MFEDDNNQENYSFPWKEYFSIIYRGRWWILLTFITISSLSTYYTLRMTPVFQAETTIEIKDKDNMFSDMSSPFNLKRSDR
VIANNSELIKSRTVAKMVMDEVDKSEFAEHISVSKEVRKDLNENSRIQMLRRKLSIKPIKNTDILRLIITSSSPFEVSFL
ANTYAEQFELYSKLSNLGEVGAVTNFLKDQLDVIKKRLKLSEEALELYQKEGGIVVLEAETQLLIENSAKSEAKLNEIEL
NYQSANQKILFLKKELDEKSKRIVEDISRNATPEIEKLKIKVGELNAKKLNIELEKSAGYKRILKNLQKQIDNLEAKITE
KAKYFANSAQASANPVEDKSDIMRKILEAQAEQIGLKAQAKKVQETINNYNKKIAMLPETATEFARLKRKYEIDEKTYIM
MENKYNEYKIALAGQVGNARIVDKAITPKSPIRPDKPLYITIGLGVGLGLGVFISFLLAFFDNSIKTIEDIERFKINFLG
AVPTINIKDMKKKMRKKMDDLTDSEKTKINSKLISHFSPKSPISEAYRTIRTNIYFSSVDSPPSVIVVSSSVPKEGKSTT
SSNLAVTIAQSGKKVVLIDADLRRPVVHKNFNILREIGVTDFLIKNSSVRDISKMTDIENLSIITCGDIPPNPSELIASA
KMDKFIEELKKEYDVIIFDTPPVITVTDAVVLSRKTDGIVLVVSSGTVGKEEVRRSQDLLRSVDANIIGVILNNLDIKKL
YGNYYYYYHYYQYYYYYGADKKKKRRGRA
© 1998-2019