BYKdb

Dataset for cluster orphancd of phylum candidatus-desantisbacteria

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A1J5E0N0 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG2_30_40_21] (length=238 residues).
MDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNV
HNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAIT
DTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANIIGYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A2H0A8Q4 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_40_23] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A2M7JEF9 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG_4_8_14_3_um_filter_40_12] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRTRSFLSNAHANII
GYILTGVEHFVPGYLANYGYHYGYGQYNGYYAHSEEV
>gnl|bykdb|A0A2M7P361 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG_4_10_14_3_um_filter_40_18] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
>gnl|bykdb|A0A2M8AWJ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Desantisbacteria][Candidatus Desantisbacteria bacterium CG_4_9_14_3_um_filter_40_11] (length=277 residues).
MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRMIRTNLQRVNPENPPRLIALS
SSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVHNLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGK
IPSNPSELLGSHRMRDLLVELKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
© 1998-2019