BYKdb

Dataset for cluster tadcd of phylum candidatus-edwardsbacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A1F5RCH8 [Bacteria] Bacterial tyrosine kinase [Candidatus Edwardsbacteria][Candidatus Edwardsbacteria bacterium GWF2_54_11] (length=752 residues).
MAAEQNIKPQETSLYEVVDLLWRRKTLILVCLAGILLPIIIANFTLPPVYESQTTIIFEQSREPIAAFDVSDAFSRKSYI
VNQIEEIKARTLAEEVAHKLAPETAAEILKDQGRGLSQEGRRQLLSQRIKKGISAEPIRDSDVILIKFQGPTPASAARTV
NLVAETVKERSSQVKREQASSTRKFIEVQLPAVEAGLYKAEDAIKGFKARNQVVSLSDEAREVLARMTEIDKMYAGTVTQ
KMALEKKLEAIYTKLEYKPDFSEGSSKMTSGAVADSLRKSLLDLQIEATQLSIKGYHPEHPQIYKLNRQIEATKNKLVEE
LANISRGGQAKPMPEMSDLLAQIPPLQIELISLEARELAIRDFNTGYESDLSKLPYKELELTRLLRAKDVNENIYKMLLE
KYEEAKITEAGKIGNVRVIDPAKEPLSPIKPRKALNLLIGLVVGLVLGVGLSFFLDSMDNSVKTAEEIETNFGIPVLGLI
PSIQSEGPRKKKRNGRDEISKIASTLVTKYTPRSPISEAYRAIRTNIQFSKIDAPLRSIVVTSAAPSEGKSTTVANLAFT
TALAGAKTLLIDADLRRPVVHSLFGLEREPGMTNILAERLAPEKVIKPSGVENLDILTCGAIPPNPSELLGSQRMKELVQ
QLKAKYDLVLFDSPPVITVTDTAVLSNQVEGVVLVVLSHGTDRRALARAKSLLSNVNANILGSILNKIDLTGIGSSYDYY
YHYHYYYYSDDGQNVKRKGRFWDILRPGGRRG
>gnl|bykdb|A0A3B9EB47 [Bacteria] Bacterial tyrosine kinase [Candidatus Edwardsbacteria][Candidatus Edwardsbacteria bacterium] (length=752 residues).
MAAEQNIKPQETSLYEVVDLLWRRKTLILVCLAGILLPIIIANFTLPPVYESQTTIIFEQSREPIAAFDVSDAFSRKSYI
VNQIEEIKARTLAEEVAHKLAPETAAEILKDQGRGLSQEGRRQLLSQRIKKGISAEPIRDSDVILIKFQGPTPASAARTV
NLVAETVKERSSQVKREQASSTRKFIEVQLPAVEAGLYKAEDAIKGFKARNQVVSLSDEAREVLARMTEIDKMYAGTVTQ
KMALEKKLEAIYTKLEYKPDFSEGSSKMTSGAVADSLRKSLLDLQIEATQLSIKGYHPEHPQIYKLNRQIEATKNKLVEE
LANISRGGQAKPMPEMSDLLAQIPPLQIELISLEARELAIRDFNTGYESDLSKLPYKELELTRLLRAKDVNENIYKMLLE
KYEEAKITEAGKIGNVRVIDPAKEPLSPIKPRKALNLLIGLVVGLVLGVGLSFFLDSMDNSVKTAEEIETNFGIPVLGLI
PSIQSEGPRKKKRNGRDEISKIASTLVTKYTPRSPISEAYRAIRTNIQFSKIDAPLRSIVVTSAAPSEGKSTTVANLAFT
TALAGAKTLLIDADLRRPVVHSLFGLEREPGMTNILAERLAPEKVIKPSGVENLDILTCGAIPPNPSELLGSQRMKELVQ
QLKAKYDLVLFDSPPVITVTDTAVLSNQVEGVVLVVLSHGTDRRALARAKSLLSNVNANILGSILNKIDLTGIGSSYDYY
YHYHYYYYSDDGQNVKRKGRFWDILRPGGRRG
© 1998-2019