BYKdb

Dataset for cluster tadcd of phylum candidatus-eisenbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A1F5RFI7 [Bacteria] Bacterial tyrosine kinase [Candidatus Eisenbacteria][Candidatus Eisenbacteria bacterium RBG_16_71_46] (length=745 residues).
MDAREGATPTDLREIARVLWRRKTLLLVPWVAAVAAGVAAAFMLQPIYFSTTRLILERAQSLPGALGGMVPGDVAAHQAD
VMREQVQSSLFLRSVITSTGARDDAATRAWALAKARTIPGMRPDDMVEAFLVDFLRDAITVRRLRGDIFEVTIGDLAPMR
AREFARAVADQFVISSKAAQLEAVRATQEFSTEQQQVYKRKLEEVERRLEASRRALLTSTLAGSVVDGSNLARARTLLDQ
AGLEVQDGRRRAAALRSRIAERARGEGADPDLLSSPEAANLAAELAALERQLAQALLSATPGEDGSSVRVLLARATSDLE
ATLAANAARALPGLGPDARDALVRYRLGLADLDARAARRGYLAAQVAAYERQVVSAPDRELEIQRLSQDAENARSLHNSF
LQQSAAAQIAEAFENAKISGRFSVLEPANLPLAPGKPNRMMLILLGLIGGAVIGVGAVLVVEQHDQSVRNADEVESLLGL
PVLGAIPRLEELQRSGRRSRSAGSGVGLPAPREHGLLHRLKVESPLGLEFRRVYLKLAKTRGRSMPRTLLVTSATRGEGK
TTTAACLAITLARELRERTLLVDFDLRSPALHRALGLPSSSWGLAHILHQRHFDERYVRSTVLPQLDFLGAGRSEHPASE
LVDLPAVEWFLAEASARYPLVVVDAAPNLAVPDPLIIGRAVESVIYVIKAGSTVRKAAEYGVRVQREARENVIGVLINDL
GEVLPQYYGYHSAYGDPAEVAGNDG
© 1998-2019