BYKdb

Dataset for cluster orphancd of phylum candidatus-fermentibacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A163UNQ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Fermentibacteria][Candidatus Fermentibacter daniensis] (length=476 residues).
MAGEIASINDSYIDTLQEELALLEASRATLLARGAQPDDPALTELEEEISIRTEALSSSLEGLVRARYPENPSAAVQSLV
GEIIRVEADLRAETTRESVLRAQASSLESDLSRLPAAEMNLARLQRNRLVSENVYLLLRNKYEEIRIAEAGQIGNVTIID
TALPGNMIRPSRRKNLMMGLLVGLALGLGTVFLKQQLDTSISSPEQVEALGVSILGVIPHLPKSALASRASRTVPSSTLV
THFAPRDPISEAYRDLRTSLKFARADQPLESILITSAGPREGKSTTSANLAVAFAQSGRRCILVDADLRRPVIHNIFGLD
REPGLSEAAAGVTPLAECVRKTSIDNLSILPSGFIPHNPSELLGSRRMKDVIAGLTAECDMLIIDSPPMAVVTDALLLSP
EVDGTLLVVGAKLGNRRVLQTSLSRLSRTSSFIVGAVLNGFDPLRMYTSYGYYTYRYYYPYYNPEGQGRGKGRRTR
© 1998-2019