BYKdb

Dataset for cluster tadcd of phylum candidatus-fermentibacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2G6LUW6 [Bacteria] Bacterial tyrosine kinase [Candidatus Fermentibacteria][Candidatus Fermentibacteria bacterium] (length=737 residues).
MGHEPVMENPSGRLINTEDFSSEEESIDIHYYLWMLRRGKWIILICVLLGLLAAGWINMTTVPVYSSSSTFIYNTDNSMA
RTLDMPVSSWFQMDAMRNDQIYLINSRTLAEQVADSVLQSPDADSLIAVLFQGDIPERQYIRNSLAGLAQSCVSVSWIKD
SDFFVLTGTGYTPEASAVITNLVLHVYYRWNRLQARGENREVRLFLEEQLNLVSSQLADDENALLVFKETNGITDIDAET
GQLINRLAGFETQMRAAGADREAARVRRDYLTELLNQQRESVEVEISDANSAYVDQIQRDLARYESARASLLAQGAAPDS
DPVTAMEQNIETRRQELEEALSEISEMDYPYEPRRGMENLFSSLASAEADFRSSSARKQALQHELDLMSAGLSELPDMEY
QLVALERNRTVSENIYILLRTRFEEIRIAEVGQMGNVTIVDTALSGSMIKPTTRRNLIMGILVGFALGIGIVFMLNQVNN
TLRSPEQLEKMGITLLGVIPQFSIKKSTFLLAILESPKSPSAEAIRDLRTSMSFVRPGEGISKLLITSSGPQEGKSSISS
NLAVAEAHAGKRVILIDCDLRRPVINKAFGFQRKPGFTELITGQATVEEVIRKTDIPGLSVICSGHIPSNPAEIIESAVR
QEIFNRIEEHADLIIVDSPPAAVVTDAVSMAPSMDSVLLVSRSGKVQQKVVQGVWQKLLRTGAHLSGAVMNDFDPISSYT
SYSYYTYRYQYYYSGKS
© 1998-2019