BYKdb

Dataset for cluster tadcd of phylum candidatus-fischerbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A1F5VPS3 [Bacteria] Bacterial tyrosine kinase [Candidatus Fischerbacteria][Candidatus Fischerbacteria bacterium RBG_13_37_8] (length=742 residues).
MYGNELEYEGREPELKDYLYVILKRKEVVAVTLIIIFLVSLIYSLLQVPVYRSSAVIEIKPEKIQIVDDLSGQTYYQTSL
ETLLNTQVRILKSRDLAKRVIYNTNISAEKKELLPSQQNNKKKNLPTNKEQNKNEPINLESFLLGSLEVNLIRGTRLIEV
SFITADAKFSSKLANSWVENFINMSANLETLTSRNTSQFIAQQIGKIQNEIADKEARLRGLAQNSEIVIMDEKLNIAMKN
LSQLNTSLFDAQSERINKESYYNKIKNSPPDSLPEVFNNPVIQNLENDYNKLERDSNEKSIIFKPQWPEMVRIKDQLQKA
KEKLIQEKDKIYQNILDSAKAEYLSAIQKENKISAEFQQQKSEAMKLNADAVTYNALKVELENQKLLLDSLLKKRGESSI
SAEIQPQTAQNIRIIERANIPQSIFKPNIKINIFLSIIIGLMTGFAMAFFIDYIDDKVKSIEDIEHYIKLPLLGLIPLYT
PGSHHRTKRKKKWAINFWAKTGLKTPLEAATRDGIPYLISHSNPKALVSEAFKVVRTSIMLTKDSNHPKCILITSTQPKE
GKTFVATNLAITLSQVDKKVILLDCDLRNPMIHKIFKQDNSSGVSSLLLQQKKLSELIIPTPITNLSIMTAGHRAPRPAE
LLSLPAFKQLLDELKKQYDIIILDSPPIVPIADTSIIAPSADMTILVLLNEGTPRKSATLAINRLRSINCDIFGCMLNSV
DFEGRSNYYYKYYNYSYYYGTQ
© 1998-2019