BYKdb

Dataset for cluster orphancd of phylum candidatus-latescibacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A1W9RIK7 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium 4484_7] (length=235 residues).
MVKKDAKTIFEMFDQESPMATEMRRLYTNIRHIHGKKDMRSFLITSSNRGEGKSTIASHLALTVARFRGKKSLIVDADLR
RPRLHRIFDVPKEPGLLECLEGKIDPMDAIQDTKVENLKVIPSGGKISSPAHLFEGDTLSEIIEKIRFYYDIVIIDSAPV
IPVSDPMLIANEVDGVILVLLAGKTPRNVAIRAKNILIDGNATILGVVVNNLSEVLPYYYDYKYYGYKESEDSNG
>gnl|bykdb|A0A3A4ZF06 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium] (length=253 residues).
MTDSERKNIYDVFDQESPMATEMRRLYSNIRHHHGRPDMRSFLVTSADRGEGKSTIASHLALTVARFKGKKSLIVDADLR
RPRLHDVFAVPREPGLLECLEGKIDPLAAVKDTPVENLKVIPAGARIKSPAHLFEGDVLSEIFKKIRFYYDIVIVDCAPV
IPVSDPMLISSEVDGVILVLLAGKTPRHVAQRACDILRDANANVIGVVVNNLSEVLPYYYDYKYYGYREHEGEKGGASGA
GNAPAGSGAGGPR
© 1998-2019