BYKdb

Dataset for cluster tadcd of phylum candidatus-latescibacteria

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A0S7XD06 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Latescibacteria bacterium DG_63] (length=751 residues).
MFSRDSERKEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTIMVEVGGRAGGIESLFGVRSAMQSSV
VNEVILNNQVEILRSRTLAERTISKLRNLPVSDRLELFASEDGKASMASLIERLSPAVEISPIQNTNIIVVKARAGKPYE
ASLIANTIVETYLELNLSWARGEVTEIKSFVEEQLTLVRERLSSAEDKLKRFQESEKVASLSHETEAAVKKLAEFDALKG
QAEVDLESTQRRLTFLETQLSDQRKSLVDDIGRVSAPMVTQLRGTLANLEGIRTRYLAQGYPENHEKMKEIERRIEETKG
QLVTKTKSALSEEVSLQDPFSYSQELIERILDLEVEVRTLRARVEGFDQLVSQYAVELERLPGKALALARLEREREVNEQ
ILLMLMDRYEEARIKEAGQLGNASVVDRAEEPREPILPRKRRNVLLGSVAGLLLGLLCVFSLERLRDRIADVSDVETATD
GIPVLAAIPSATTKRRGFRLLRTRRRVFPFQGSSGEAVPKVLLTELSPRSEISESYRTLRTNILFSQVDKPLRTIVLTSP
GPTEGKSTVVANLGFVMAQAKNKTVVIDSDLRRPTVSLLLGTPKGAGLTDVLSGKAVLDDVITSTSVDGLFLVGTGTLPP
NPSEMLGSLRMRQVIAELAAKFEFVLFDSPPVLPISDAAALGARVDGVLMVARCGVTGVAGLSRAISVMRGVHARVIGII
LNDLDIRQRLGEGYYDYYRSYSHAQGADEPS
>gnl|bykdb|A0A1V4R2W1 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium 4484_107] (length=725 residues).
MEEEKQVGLEDYIDIVWRRKWIILLSFVSVLASTTYFTFTRPPTYEAASILMVEAEEGMNLLDPRGSLFGPLAKPVEFFE
RIMESPSYRDQVALKVTERLRNPHGILLPMDEALDLVEHNLTLNTSKTSDFLEIKAHADSPLLCYLLAASGTEVLKDRSR
GVDKEEAQSVLDFIEDQKIEAQQKLEAAEKKLQLFRERVGIVGNGEEGGALGKLIELEKELAGVQAQKELAQANLEAYDL
RIAQVLPDKTAGGRETEGLSREIATLESIRANLVRQPGEHHVEVLSLDKKIAEKKKKLVESIVQDTDVRSSGMQVEIAQL
QERRTAEELNIYVLESQERYYENLIEKFKAEHPSMLENAIELAQLTRARKVYENMYNILLEKGEEAKINASTGTGGVKVV
EKAREPDEPVPAHSKRNLVLGAMVGLGLGLGIAFALEYMDNTIRTAEDLSRTLGLSVMGTIPDIQKLENMQRKRSGKKKR
KGGGERDDPGLISRYETKDMVVESYRSLRTNLQFASVDKPLKSMLISSPGPMEGKTLTVANLGISFAEMDKRTIIVDADL
RRPRQHKLFGVGKEPGLTDYLVGTASLEDVILPTEVDHLSLIPAGRGSPNTAEMLGSNRMSDLIRKLISEHDIVLFDSPP
LVPVTDAALLASKMDGVLLVTKYASTHKDAVHHALEILEKVGAPTIGAILNDVEVVRRLGYYRYYYNNYYYYTYHEDEKK
EETKA
>gnl|bykdb|A0A1V4RNF1 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium 4484_181] (length=741 residues).
MQEVSEQEVSIHDYLRILYKGRWIIVISFLAVVISTVFFTLRATPIYEAKTTILIETGKTGAAIPLFEAPGFTRRETMIN
NQVQILKSRTIAELVLNELRKLSGSQTFAIFKTDLGRPWSREDALKTLEESIKVTPIRDTDIVEIKCQAPSPEEAVAIAN
TFAHVYYQQRLQMSREEISETRRFIEDQLAKVREELRASEEALRDFKQKEKVVALPDETKALVEQLADFEALYNEAETDL
GSSQTRLNYLRKQLREQQKDLPEKIAMVSSPLIQNFRGEIAKLEGKYANYIAQGISEDNEKVVAIKNRIQEIKNKLKEET
RKLLSEKLAPENPLLFSQALVDKILTLEVEVEASSAKASALKRIVDQYAEKLQALPEKSLELARLERTAQVNEKIYIMLM
EKSQEARITEAGQIGNVRIIDEAREPKYPIKPKKKLNVILGAVVGLGLGVGIAFFLEYIDTSIRTPDEVERFTNLALLGT
IPLIKGRDNDKKTRHTEASLISSRLISHLAPKSPASEAYRTLRTNIQFTKLDRPLQSLLVTSATPGEGKTTTVANLAITM
AQMGTKVLLVDTDLRKPMLHQIFGVERDVGLTNVLVGERGLSSVIKPTDIEGLSLISCGPIPPNPSELLGSEKMGQLIEQ
ARREFNFILFDSPPTVAVTDAAVLATLTDGALLVVQSAKVSREAVNRAKSVLEGVGARVLGAVLNDFDVESQYGYYSHYY
YYYYYNYPESGEKKRRRKARA
>gnl|bykdb|A0A1V5ZEN4 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium ADurb.Bin168] (length=672 residues).
MHDEKKDFRVYVDVVYRKKWLILFIFLIVFLAALYFVRKQAPSYSSSSSIYIESGNPAAMAVALTADAQGKRPIEFFMGI
LESRSFRDAVRDAVRDHAISRGMPPIQATDLSREAIESLQIKRSKNEGFYTVIAESESPDIAYATDSLAVSLFMERCILY
ARQQTNAMTAFVAMQFDSARARLERAEDNLQAFRKQHNLIQAGGGPATDPSLPIDYVRLVEGYYDARQERQTAQAALEAA
EEASRLLRINLDTLATDKLRRALPALDLAEAEERTRKARTELQLKELQEQSFLAQLQAYEASHPGLSDVSIGYLRLVRER
DIYVRLSDLLLERREELRVKSASETGGVRVVDAPSEPTPKPSRAPLILIFAAIIGLSLGAGAAFLLEAMDTSVRTVNDIT
EALEVPTIGTIPSIGVTPGGKRRRETERRRVLISDGNPKDPIAEAYRTLRTSLLFSSGDQPIRSVVVSSAGQAEGKSITV
ANLAIVCAQMGQRTVILDADLRRPVQHILFELEREEGLTEALVHRRELSEVAKPTSIENLDVVTCGVIPPNPATLLGSAA
MGERLEELAQHYDIVLIDTPPVIVVTDAVLVARKTDGVLLVVRCNSTPREAARHTADTLRTANIPLIGAVLNDVDVTRRY
GGYHYYNYYYHYYYGGYYGSSDGSGDTKTAKT
>gnl|bykdb|A0A3D4BE10 [Bacteria] Bacterial tyrosine kinase [Candidatus Latescibacteria][Candidatus Latescibacteria bacterium] (length=726 residues).
MKTRTGDKSLQGTEIRLQDYIGVVYRKKWILMLSFVLVLGIALYDAFTTPPVYISSATVKIDTRTLSTRGDGAMVRAVAQ
SVDYYDRIFRTGIFRNELLDSLSADEASIIAQNHNLSLENLIEFNLSLNADAVQSFFRITASASNPDLAYRLADVSSHLF
QKRLIDIESESMVESDVYLDEQITLLRNKLETKEIEIQKFTREQHIIPGKPGSVGNTGFMAFQIKLDEIEVQRELTAIKL
RIYRQRQDEISRRQYTYNNVDLLVDQIDQEIRSIGAKADSLESLQATLRNSLDQTHPDVIKINKQIRDIQFEENEVYARI
YQISSPQKRNLLPILKAKIDAAEEAMFELTTEAEYYDIKIQEFTPDSNTAFFNNELHLRRLMRSQELYETNYNVLIQLNE
ESQLKKATQSGGVKMIDPAYRPKAPVPSTASRKILFGAILGMSLGLGAVFLLEYMDTSLKSSDEISRFLQIPLLGEIPKI
DADKPTRKWLRFLPGTIKSNEEAYDSRIIAHFDPKDPIVESYRNVRTSLLFTFTSGDPLQAFVISSPNPSEGKSLTTSNL
ATVFAQSGKKTLIIDTDLRRPVIHKIFRLPKNPGITDVLVGQIHWNEAIRQTDIDNLFVLPSGTSPPNPGEMVGSERMTE
ILDILKEHMDIIILDTPPVVAAIDAAVLGAKTQGIILVLNMEETKRDSAKFSIDQIERAGGKVLGGLLNNVDVNRRYGYY
YNQYYY
© 1998-2019