BYKdb

Dataset for cluster tadcd of phylum candidatus-margulisbacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A1F6QP92 [Bacteria] Bacterial tyrosine kinase [Candidatus Margulisbacteria][Candidatus Margulisbacteria bacterium GWE2_39_32] (length=621 residues).
MELLEYWGFFLRRKTVIISIFLLVVIMGILYLSMAKPVYEADCALLVTETKGPGLLGDLEVGALLSETIGKSDPIDTQLE
LVKRRPILSKVIRDTKLVDGRGNPLKIRALREAINVQAINNTNLISISYRDHDPIVAREVVNTVALTFAEQNQKLNKEEI
SSARVFIENQLRTQKEKVIGAENSVLDFKRKLQTVALEQETTTQLEGLSLVEATKMDLETKLKGSYAQKQQLESKINGKI
AQSSPFYSLWMKSLEDTNNEITNLTAQLANITSEIARITVDLNKLPPKEIELARIVRDEKLASEVYTRLLGRYEEARINE
AGKVANVKIIEPAITPDEPVSPNLKKVILLTLLLGLIAGISVAYLIEYIDDVPGSVEVVKNILPYNTLGMLPNQSNINPL
FMINDPRSPLAEAVRLIYTNLKFKEIMGKRCITMLVTSALAGEGKTTLSSNLAISLTNMGKKVVMVDIDLRRSRLNKVFN
MPGNKGVTDYLIGDVEIEDIVVIDPVSGVYIVTAGVIPPNPAELLAGKKIQELIARLREKFDIVMLDSPPITLVSETLDF
ARTVDGIIITVDMKNTSLRAIQGMQELLKDKHLPILGMVFNKLSVENAGYAYCSYKYKYSY
>gnl|bykdb|A0A2W4JTQ5 [Bacteria] Bacterial tyrosine kinase [Candidatus Margulisbacteria][Candidatus Margulisbacteria bacterium] (length=621 residues).
MELLEYWGFFLRRKTVIISIFLLVVIMGILYLSMAKPVYEADCALLVTETKGPGLLGDLEVGALLSETIGKSDPIDTQLE
LVKRRPILSKVIRDTKLVDGRGNPLKIRALREAINVQAINNTNLISISYRDHDPIVAREVVNTVALTFAEQNQKLNKEEI
SSARVFIENQLRTQKEKVIGAENSVLDFKRKLQTVALEQETTTQLEGLSLVEATKMDLETKLKGSYAQKQQLESKINGKI
AQSSPFYSLWMKSLEDTNNEITNLTAQLANITSEIARITVDLNKLPPKEIELARIVRDEKLASEVYTRLLGRYEEARINE
AGKVANVKIIEPAITPDEPVSPNLKKVILLTLLLGLIAGISVAYLIEYIDDVPGSVEVVKNILPYNTLGMLPNQSNINPL
FMINDPRSPLAEAVRLIYTNLKFKEIMGKRCITMLVTSALAGEGKTTLSSNLAISLTNMGKKVVMVDIDLRRSRLNKVFN
MPGNKGVTDYLIGDVEIEDIVVIDPVSGVYIVTAGVIPPNPAELLAGKKIQELITRLREKFDIVMLDSPPITLVSETLDF
ARTVDGIIITVDMKNTSLRAIQGMQELLKDKHLPILGMVFNKLSVENAGYAYCSYKYKYSY
© 1998-2019