BYKdb

Dataset for cluster orphancd of phylum candidatus-marinimicrobia

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A359IET8 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=547 residues).
EQLKQVEERLRVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKEKELLNNFI
QTANPLILELQTKIAKLEASVVEAIAKGIDENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDPLSINQSMLEDV
IKLRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSV
PPKYPVSPKKKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQ
SRLITHFDPKSPVSEAYRSMRTNIELSGVDKSIKSVVITSAGPGEGKSTTIANLAIAFAQMDQKTLLVDTDMRRPVLQKV
FKVPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDAS
LLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGGSYYYYYRYMNYQYK
>gnl|bykdb|A0A3B9KQY2 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=578 residues).
ALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRVSEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYS
AMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILELQTKIAKLEASVVEAIAKGIDENAPQIQTIKVQMDKMKER
LNQETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNE
NIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKG
ITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDPKSPVSEAYRSMRTNIELSGVDKSIKSVVITSAGPGEGKST
TISNLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGS
KKMREIYQTLTEQYDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKH
MKGGSYYYYYRYMNYQYK
© 1998-2019