BYKdb

Dataset for cluster tadcd of phylum candidatus-marinimicrobia

[Download (right click)] [Alignment] [Repertoires]

23 sequence(s)

>gnl|bykdb|A0A101ID17 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Marinimicrobia bacterium 46_43] (length=770 residues).
MNQNNHYMPYNEEEEINIKEIFQTLIKGKWIIALSFILVTAVTIWYTFNQTPIYEASTQILIGAAGNQTAAIFDIMTPLG
NSQMEINNQVEILKSRSLAENTIKNLMENYSPDSLYILGKGQEEKMESTLNRVKNWILFLGNRGTEDEELISSREDTIRS
LAYTLQEAITITPERNTQTIRISIKSPDPKEAALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRVSEDSL
RTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILELQTKIAKL
EASVVEAIAKGIDENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREF
KKLVDHYSKELEKLPQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLG
GILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDPKSPVSEAY
RSMRTNIELSGVDKSIKSVVITSAGPGEGKSTTIANLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGTN
TIEECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGV
THDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGGSYYYYYRYMNYQYK
>gnl|bykdb|A0A124FPG2 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Marinimicrobia bacterium 46_47] (length=770 residues).
MNQNNHYMPYNEEEEINIKEIFQTLIKGKWIIALSFILVTAVTIWYTFNQTPIYEASTQILIGAAGNQTAAIFDIMTPLG
NSQMEINNQVEILKSRSLAENTIKNLMENYSPDSLYILGKGQEEKMESTLNRVKNWILFLGNRGTEDEELISSREDTIRS
LAYTLQEAITITPERNTQTIRISIKSPDPKEAALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRVSEDSL
RTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILELQTKIAKL
EASVVEAIAKGIDENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREF
KKLVDHYSKELEKLPQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLG
GILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDPKSPVSEAY
RSMRTNIELSGVDKSIKSVVITSAGPGEGKSTTISNLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGTN
TIEECIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGV
THDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGGSYYYYYRYMNYQYK
>gnl|bykdb|A0A2D7IJL9 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=791 residues).
MNNQHLDYRSDNANYQTMENELYLKDYVIILRIHLKKIIIIFLIALSLGVYSTFSKIPKYRASATIMVTQKPGSQSLQSF
GNSDNNVQIINNKILLLKSRGLLESVVKDYWDSNRRNNMFLFNTRKFFPKGQAIRTLLKEIFTLGLYDAEKFKETKVLDG
FYKEEIGQKYAKVLQRNLSVGRKGGTNMIWINYESENADEARRIVNTIVRRFEQKDKEWTNKYAINSISFLDSLVNIQEK
KIENAENKKMEFMLEHDLFSMEANSDVIISQINDYEMKLYDIETEISIQQKQMDVLKSKFSKQELNLTSSLMDNINIQLS
SLRNEVGRIESQIALNSGIYGDTHGSVIALNEKHSLIKEEINKKASLLIEKGITTNDPLLMRNDQISQILALENSMMALK
LNKDQNEKMLDLFKNKLNSIPETNIIMERMNREDEILNEHYLQLVNTLETTKMNNVIEKGDVQIVDLAKKPSRPFTPNHQ
KDIIIFCFFGLGIAIVIVFLIEFIDNTIKTIDEIEKYDKSVIGVIPAIGKISSRGIISRYLESKSFTVLGGEKGIKRKII
TRDNPKSPISESYRGLRTNILLTNTKDIKSILVSSAGPGEGKTTTVANLAITFANLGRKTLLVDTDLRRPVIHSVFNVKR
EPGVTNYLSGQTDDYHSLVKPSEIENLSLLTSGLIPPNPSEMLGSKKMSQFIKKLESDWDMILFDSPPLVAVTDATMISK
EIDSIILVIKAGQTDKKAFHHTMANLKNIEAPLDGIVMNAVTSKSNYGSYYYYYYHQYYHYYSSHDNESDA
>gnl|bykdb|A0A2D7NA59 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=767 residues).
MSEKNKIINSIENYEISYWDIYFILKRHLKLICFSTVLILFLSVIYTLRLAPVYSSTGVILIEDPSSRVNIFDMGVGSDK
NLLENEIEILNSHTTAESVVNRLLNSNHKDNLYFFGTRKYTPVGLSKLLDSFFSINGEEYEKNEFLISDSLVNQLTLDLQ
QNISVNSQRNTDVLKISITSIDPNEAALLVNTLIDEYKNIDLKWANGEMSHLKSFLLEQIEKKEIELTEFENSLKQYQEK
EKIFGMSEMSNLLLNNLINSESQLYKSKAEYNILQERINYIKNLLTDEEKLLSEKVINTINERLFTLKNEIAIKEAELVS
TIVQQGENHNIVQVLTEKLDRLKLNLQKETRVLISQGISVADPIKYRQSLMDSVISITAVSAVYESKIKEFDNLVENYEL
QLGELPEKVLKYTRLERNLNIHAETYSLMRQKLEEARINEASKVGKVRIIDKARPDYNRIKPKNKVNVLIGLMLGLGVGI
GISFLLEYADNTIKSIDEIDKRGLSILALIPSIGKKINNKREHSKNLSKKIGNIEKIQRRLITHEDPKSPISEAYRSLRT
SLMYSKESLNHAKIILVSSPGPGEGKTTTIMNLAITFANLGKKTLLVDCDLRKPVTHKIFNVEKDIGITNFLVGNISNVD
KIINPTEIENLSIITSGIIPPNPSEILASENMEILIKKIKMDYDVILIDSPPLLAVTDTFILSKFASQFILVVRAGKTEK
GGLDRSLDQMNQVNVNLFGIVMNDVDESNSYGKGYYYNYYQYYYGDS
>gnl|bykdb|A0A2D8V7U8 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=760 residues).
MNNNINSDFNQKEISLEEIVFSLKKHIKIILFITFFCFFCTLIYVIIQKPRFESTSLILIEDPSASAMDIFDAGVKTNKN
YIENEKEILKSRTIYEKSIRTLLESDVKNNLFLFGTREYNHPFNFIPSFLYKKPDYRYIDNTLNETEFLSAVKKLKDKTT
IVNKNKTDIIKVTVNSIDPDESALLANTIVNVYQGTDLEWSTGEMTSLKSFLDSQITIKENELNISAQELKKFQEEEKIF
SIDDNSSLLLTSLLNIESEYYKYKAEGNILKERISYIEDQLTSEEKKMVNNVTNTINNRLFALKNELALKETELISAISQ
QGEDHQIVKNIERKLESLKERLKLETRKLVSQGIAVADPINYRQSLMDSVISISAIYATIEAKSSEYEKLVNQYESQLVV
LPEKLLEFSRLKRNLNIDTETYSLMRSKIEEAKINEASKISKVRVIDKANPDYERVTPKRKLSLLIGLIFGGILGVVAAF
IIEILDGTIKSIEDIEKRGLTILALIPSIGLHDKKRKNKLKNSIDNAKKIQRRLITYEDPKSPVSESYRTLRTGLLYANS
KKAGNVILVSSPGPGEGKTTTIVNLAITYANLGKKCVIIDTDLRKPVAHTIFDVKREPGITRFISGVDDKIDDLIHKTEI
ENLSLITCGVVPPNPSEVLASERMKNLVNHLKKKFDVIFFDAPPLLAVTDAFISLSYTDQFILVVRSSHTQKGGLDRAIE
LLNQSNAPLSGVVINDIDSSNSYGGGYYYNYYQYYYGSEK
>gnl|bykdb|A0A2D9VF15 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=684 residues).
MNELETNFNIKELLFFIRRNIKIMMAVFSLIMIFGCAYILKKKPIYNASGTILIESSNNKSDVFNFSHENKIIEDKIEIL
KSSTISKRAIKDLISISKNEKLYALGNKVYKPEGFYRKAFEYLSTLGGVLDSKEEDISLNYNSESTILYLAKKLRQSIKI
ENIRKTNILNISVNSLSPTEAALIVNTFIDAYIDQEKKWANQEINQSITFLESQIEKKELELEEIENQIKTFQISNEIYN
IGETSKLLLEQFLDIESKLIQEKINYEDAVNLKNSYLQEESAKNEVSSTRKLELKELKREVNANQKIISERILNIKEELL
IKQNALNHLPEETIELMRLERIKNISEQTFRLMMQKLDESKIMFESQTGDAKVVDYAYPNINRVSPKVRKEMMLCIMLGL
IAAFSIALFIEQFNTSIKSLEDLEKYGLNVLAIIPSIKNRKKHKKIRKTLKEENKIERHLITLEDPKSPISEAYRTLRTS
IMYSDTNTNKTILVSSPGPGEGKTTTVANLALTYANLGKKTLLIDTDLRKPVINKVFSVEKNPGLTNYLINDEKFEVVIK
ETDIENLHIIPSGIVPPNPSELLDSDSMKTMIDNLKEQYDIILFDTPPIVAVTDALILSKHIDKFILVCRPGVTQKGALE
RVLKNLDQVNSKINGCVFNAIGDLDSYGSAYYYNYYQYYYNSDN
>gnl|bykdb|A0A2E0B890 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=769 residues).
MNNSNQDFHKEEVSIKEIFFIIKSNIKKVYFSLFLFLFIGLIYIVITRPTYSSYGAIIVESEDSAMSSIFDMELGSAKNY
LENEIELLKSRTTAERTIQSLLNSNQINNLHLFNTKKHEDGFLREFFRNILFLDLNKNPEILINNEVNDSLFNVFVKKIR
NNISISNLRNTDVLKISYSSPDPYEAALIVNTLINEYQRRDKEWASGEMNHLKNFLFEQVVLKEKELKEIEEKLKLFQEK
EHIYGLDDNSNLLLNQLTTVESDYYNTKAKKNISLERKKYFQNQLSKDEKEFANRVSNTLDVQLYSFRQELASLEAEYNS
TKAREGSTHPAVIDLDKKIKNLKILLNTETRKYVNQGIIVANPIESRQAIMDSVINLDAFISAYNSKLLELDKLISNYES
QLSLLPEKYLAYTRFQRDKIILDETYSLMKQKLEEAKINEASQLGKIRIVDSAVENVRKTAPKRKFILLISLLFGTIFSV
GFILLTEFLDSTIKSIEEIERRGLPILAIIPSIGSQINQRIKKKGYRLNLKISNSEKIERRLLTHEDPKSPISESYRSLR
TSLMYDNNEQDSKIILVSSPGPGEGKTTTVANLAITYANMGKKTLLIDADLRKPVLHKMFKNKENKGLTNFLSQSENNID
NILIDSGVENLSIITSGIVPPNPSELLSSPAMIDFIKKAKENFDVILFDTPPLIAVTDAFVITKFVDKFLLVVRASVTQK
GALERSLVNMSNMGNSISGVIFNGVDESNTYGGGYYYNYYQYYYGSDEK
>gnl|bykdb|A0A2E1NF27 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=781 residues).
METNENTRIQNLETDYANKSLSFRDYIFLFRLHSKKIIFLTILSTLISIYKVYITPPSFTAKATIVIREKPETNLIMDMT
GNRDRNRIENEIQLIKSKTVAKAVIKKIWEVKRNNLDLFNSYPYYPGGRELRKSLKKLFTLGLYDPKLDKPINYGDQLYT
DQIGERFSDKLLLRLKISPRPRSDIIDISYTSVWPIEAQLIINTIANTYKDFDKNLSGEEASKTLKFLEKLVQNIEQELY
KSEKELTEFKKKEKMYDLNGPAIDISAQIAAIEIEIYNASSEKQLKQEKYSILKSKLSKEEKNLANKILNTIDAQVVYLR
DDIGSLEGQLIQNIALYGEGHSAIKSIKSRIDILKVQLNNKVNELTEQGIVVQDPLQSRQEIVTQLISLDNEIVALKLKK
KQSEELKTIFQDKLNQLPPKQLEFSRLQRNNIVLNQNYSLLRQKLEEAKINIFSKFGKVQIVDYASVPEKFESNHTRTIL
FGLFLGIGISFCLIMLIEVIDNTIKTNYDIENNNLSVLGIIPSIETDESLSSFRFLRFLKKNSSNNSNRGIKRRLMTRED
PRSPISEAYRSLRTSMLYTGVESEVKSILVSSAGPGEGKTTTVANMAITYANLGRKTLLIDTDLRRPVVHKIFDLEXEPG
ITNFLSGNTSDFNQLVKNTDIDNLKVVTSGIIPPNPSELXGSKKMGDLIKNLEKDWDIILFDSPPLVAVTDATMVSKAID
KIIIVVKVGYTDKKAFXHTVRSLRNVNAPIGGVVLNAVTKKSSYGSYYYYYQYYHYYGSDK
>gnl|bykdb|A0A2E1Q0C7 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=780 residues).
MTTELHNTQNGQQEISQEKSLNLRDYYFIFRTYYKLIVVMTILGLCIGFYSVLTLPPKYTATSSVAIREKPGASMIMDLT
GNRDRNRMSNEIQLIKSRSVAKGTIESIWDQKKNNLALFDSYPFYPRGKRVRVLLKELFSMGLYDSKSNGPAKYTEDYND
EIGERFADRLLAGLSTKHRQGTDVIDISYTSVWPHEAQLIINNLVKVYKKFEMEISGEYAGNTVNFLEKILSDHDTKLER
SEKEFTNFKNQERMYDLDGTALMVTTQVANIESEIYNAVSEINIRSEKYNLLKSKLSSDEKILADRLLNNINVQVLSLRG
ELGKIESLLIQNIAQHGENHGAVRDLKKKLEGIKEQLSLKIKELTKLGMVVQDPLLARQNIVTELITLDTEIVAYELKKN
ESKNLLKIYLEKLKDLPEKQLQFSKLQRNSIILNENYSLLRKQLEEAKINLAVQVGKVHIVDYARLPFVSGQNNNRTLLL
GLFLGLSLGIIMALALEVMDNTIKTTYDIERKNLAVLGIIPSIGEEQKNKKSYFFNKSNKSSSNLKRRLITQDDPKSPVS
EAYRALRTSMLYTSADKKIKSILVSSAGPGEGKTTTVANLAITYANLGKKTLLIDTDLRRPVVHKVIGINKEPGITDYLS
NNEKDISKIIQKTEIKDLCVIPSGIIPPNPSELLGSDRMSNLLRDLEDEWDMILFDSPPLVAVTDAAMVSKEIDQIVMVV
KVGQTDKKAFDHTISSLRNVGAPISGVVLNAVTHKNSYGAYYYYYQYYHYYGNEKETEKV
>gnl|bykdb|A0A2E1Q8L9 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=761 residues).
MKELKINYMTNQENKKEDLNIDEIYFLILKHYKILLSSIVSCLVFSFFYILTIDPIYESQGSILIEDPQNDVSNIFDVGL
SKTKNFIYNETEILRSRTNSEEVIKQIYNSGQKLYILQNREDKKGLIKSFFNKQYYIDDMVLTDSLLLEFSNYLRKSMKI
ENTIDTDVLNLSIQSKNPEEASLLVNKIIEVYKQRDLNWVTGEMQHLKQFLNEQLAIKEVDLNNIEEKLKNFQENEKVFS
ISDNYSLLLGELSELESKYYNFEAEINILKSRKEFMYNQLSKDEKNLAQSLSNAINARLDALRNEIATKEAELIKTVNQR
GENHEAVSFIKEKIGRLKKKLKEETNDFINNGISVSDPLLYRQEIMDSLIKVESIIPNLQSKKNEYKNLIDEYEKQLSNL
PQKVLEYTRLERIRNIQSETYSFMRQKLEEARINEASKIGKIRVVDSAIPNYIPIKPNKKLYILLSLVLGLALGIFIIGI
KEFFDNTIKSVEQIERRGFSLLAVIPSIGKKSSKKRTKQYISQNKNLDKIERRLITHEDPKSPISEAYRGLRTSLMYTNV
DENCRVILVSSAGPGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVVHNIFKFDKSPGLTSYLSGNESDELKLVNSTET
KNLDVITSGVIPPNPSELLDSPKLKKLLEKLKSKYEVILFDTPPLIAVTDAFVLMKHSSQFILVVRAGVTERLALDRVMT
NLYQSGFKETGVVLNALEESHAYGAGYYYNYYQYYYAENSD
>gnl|bykdb|A0A2E1WWX4 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=752 residues).
MIENQNSNLESSYTIQEILFLLKKHIKIILAIFFATILLILIYTFSSDYIYKSSSTIIVNKDPNSLSILNMGYSGERNFI
DNEIGILRSRTTSEKVIKRLLDSDNIDLHLFGKKNNNKSFFNSTDNNNDFQALSKEDFVNKYANKLKKSVYISNNKRTDA
INISIESKDPEEAAMLVNTLIDVYRERDLEWATGEMSHLKTFLLNQLSKKQKELNEIENLLKSFQEKEKIFTIDDNSKII
LDNLTLFETEYNNVLASIDIINEKEKFITGQLNSDEKLLAKKVSNTINQRLQAFKVEMAVIESELISTQTKYGNNHSAVL
ELENKLENVKSKIEDETRNLINEGITVADPILYRQTLMDSVISIKAVKANLLSKAKAYQNLVDDYDNKLSMLPEKILEYT
RLERDRAIHAETYRFMSQKLEEARIGEASKLSKIRIVDKAIANKIPIKPNKSQNIIFSIILGIVLGIGASMVMEFFDNTI
KSIEQIERRGLAILSMIPAISSKNNRNKNSKRYVKNDGQVEQLQRRLITHEDPKSPISEAYRSLRTSLMYTKSNSESNVI
LVSSPGPGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVIHNVFKADKSPGLTSFLSGNSDLKSILNKTDIDNLEIITS
GVIPPNPSELLDSNKMIDFIKKVKNQFDVILFDSPPLVAVTDAFVLMKYIDQFILVVRPGKTERGALERVIASTQQSNMN
ITGVVMNAMSEEHSYGSGYYYNYYQYYYGDKT
>gnl|bykdb|A0A2E2VWX2 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=753 residues).
MSXXDNQKXDLTLKEIYFLILXYXKIFXXSIFSCXIISLFYVFTXDPXYESYGSILIEDPQNDVSNIFQVGLGKTXNFLE
NETEILNSRTNSEEVIKQIYXSGEKFFILQXXQVNHSFIXSXINKHYXIENMVLTXSLLSEFSEYLXKSMRIEXSNETDV
LKISIQSKNPEEAALLVNTIIDVYKQSDLXWATGXMQHLXQFLKEQLSIKEIELNXIEXKLKDFQENQKVFSISXNYTLL
LKELXNLESNYYNFEAEINILESRKKFMYDQLSKDEKNLAKSLAXTMNARLDALRSEIAXXEAELIKTVNQRGETHEAVX
SIKDKIERLKXKXQIETNDLISKGISVSDPXLYRQEVMDSLIKVESIIPNLESKKYEYKNLIDEYEKQLSXLPEKVLEYT
RLERIRNIQSETYSFMXQKLEEARINEASKIGKIRVVDSAIPEYIPXKPNKKLYVLLSLVLGTIXGIAIIGIKEFFDNTI
KSIEQIERRGFSXLAVIPSIGKKTDKRKTKRYISQNKNLEKIERRLITHEDPKSPISEAYRGLRTSLMYTKVNDNCRVIL
VSSAGPGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVIHNIFKFDKSPGLTSYLSGNESDEKKLINSTDTKNLDIITS
GVIPPNPSELLESSKLEELLLKLKNKYEVILFDTPPLIAVTDAFVLMKHSSQFILVVRAGVTERLALDRVMTNVHQSGFK
ETGVVLNALEESHAYGAGYYYNYYQYYYAENSE
>gnl|bykdb|A0A2E3DVU2 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=789 residues).
MKNNHLAFKEDNHNYHNIENELYLKDYFLLLRIHLRKLIYCVILFLLIGFYTTINKTPMYSSKGTMIVRVSPGANTVADI
TKQKNNNQIRNKIELLRSRTLAEDVVRSFYDSKRRNNLFLFGTRKYYPKGQRIRTLFKEIFTLGLYDAQDALKVSTLEGP
LTYERLDDFSKRIKNHLTVKHIPNTNLIEVSYRSKNADEARRIVNRTMGIFSVKDKEWSNQYALNSVSFLDSLVNVQEKI
LQNTDSLKMDFLLENKLHSMEAKSDDIIKRINGYEGELYNIKTQKSINKQKIEFLSSKLSSEEKDLADKIVGNINIQLSA
LRDEAAKLESQIITNSSIYGETHEFVQDLKKKLNNLTVAIDERVTKLALKGIAPQDPLRERQEIISEILNLENNIYYLNI
TENETQKELDRFNEKLRSIPETKMQMDRFERQEMILRDYYLALINKLEETKLNNAILVGDVRIVDLAKLPKIPYSPNHQK
DILMFLFFGIAIGLFIIFVIEVLDSSIKTIDEIEKYDKNVIGVIPAIGKMKSQNFIMRYFDDKTVNILGGEKGIKRKIIT
KDNPKSPISESYRGLRTNILLSNDKEIKSMLVSSAGPGEGKTTTVANLAITFANLGKKTLLVDTDLRRPVIHSVFELKRD
PGVTTFLSGQTDDYKTLLQAGEVDNLFIMTSGIIPPNPSELLGSKRMIHLVRELEDDFDMVLFDSPPLVAVTDANMISRE
IDRILLVIKAGQTDKKAFHHTMMNLKNINAPLEGIVMNAVTSKSNYGSYYYYYYHQYYHYYSSSEDDEK
>gnl|bykdb|A0A2E5GDL9 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=779 residues).
MSNNNIYNNPVVELTLQDYLIIFRIHLKKIIIITLIGMVYGIYHTYTVPPKYQSTATVMIREKPGANMMNFGGNSSKNRM
VNEIQLIKSRALAKSVVKELWNSSRRNNLHVFGTRKFYPRGQRPRVIIKELFTLGLYDPDSDMPIQYNQPYSESIGDQFA
GNILSGLNVNNRRNTDILEITITSVNADESSRIANSIASNYVRLSKIWNSEQAMQSVEFLESLVSMQEEKLNTSELEIKN
FKINNKMYSFSGSNTSVTDQLAVLDSELLNILSEINIRKEKISLLNSKLSEKEKNLADQLVNNINTQLISLRVEIGDLDS
KLMQNTALYGENHAAVKELKAKIGGLKDRLNLKVADLIAKGVTVQDPLVARQEIITELLKLDSDILGLEIKMAETKRIQK
LFINKLDDLPQKQLELALLQRGSDILNQHYSHIRQKLEEARLNVAIEVGNAQFVDSALKPNKPSSPNHRKNIIIGFSIGL
GISVILSLLIEFLDNTLKTVDDIERHDLTVLGIIPSIGGESSKNSKGWSFFGKSILSSKGNSHGLRRRLITKEDPKSPVS
ESYRSLRTSMLYSTTNKKIKSILISSAGPGEGKTTTVANLAITYANLGKRTILVDTDLRRPVVHKVFELXXEPGITTYLS
GXTNNYKNLIKXSQIPNLXIITAGIIPPNPSELXGSERMXKLVKXLENDWDMVLFDSPPLVAVTDANMISXEIDQILLVV
KVGQTDKKAFHHTVSNLRNXKSPLGGIIMNAVTHKSSYGSXYYYYYYQYYXYYGXDKES
>gnl|bykdb|A0A2E5JPH8 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=795 residues).
MNTSSELHGNHDGQLGQEPELTIHDYWLIINRGRTSIIISTLILLVLSVYYNYSVSPDYTATSTLLIKSESDASAIFDFG
GRMSQSELANQIELVQSRQVATNTIKTLWNSKHRNNLSVFGTRKFLPRGQRPRRFINEIITFGMYDPESNKPKKYDKEYS
EEFCRRFVIKIKKSMEVKSKRGTDILILSSTLPFPEEAALVANTVAEEFAKLDARWGAEHTHNLLSFLESQIVIKENELA
VAEELVKDFMEAEKIFDLTGNAELIMMQSTDVESKFYETAAEININEENILYLQEKLSKEEKQLADQLLNSLNSKLFALR
QEIGQREAEQIRNEGLYGSQHDAVISTRKRISTLKGQLDQEIQSLISRGVAVADPIEYRQTLIGELLKSQATLAGYKAKA
DQYRKLMNHYNLQIEKLPKKQMEFARLERDRSVLNTTYMFMRQKLEEARVNVASEGGKIQIIDRAHIPGRASSPDKGRNM
LLGLILGMGFGVGIVFLREYLDRTIQSIEWIERFGVSVLGVIPVVTGMGSNQKSKKGKKDSASGSKNVQRRLITREDPKS
PISESYRTLRTNILYSQADKKIKSILVSSPSPGEGKTTTISNLSITFANMGKKTLLLDTDLRRPVIHRVFGIKKEPGISH
YLAGNIENFDSLIQKTDVENLYVVSAGITPPNPSELMGSKKMAELVDKLEREWDMVLLDSPPIVAVTDASMVSQEIDAMV
MVVKAAETDRDAFRRAVKSLMGISVPLAGVVVNGISRRTSKDTYYYYYQYYQHYYGGYYGYYGKDKEKELEGETA
>gnl|bykdb|A0A2E5SGC3 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=777 residues).
MNDFNENSKSFKNTDSSFDYSLKELYYILKNHAFAMLVTFFIVISIVIYYTLTVKPVYESSSTVMVRQDQKSMSIFSMLD
MGLTKDRNYIENEIEVLKSSTTLDVVVNRLFESKYKNDLFLFGTKKYEPSWIRAFLTFGIDSFASDFELGEELNDSLKII
FSDRLLNSLDVLNKRNTDAIKITVKSKSPIESKLIANVLIDVYRERDLNWLTAEMGHLKNFLSSQLKQKEKELNQIEEKL
KKFQEEKKIFGLEDNSKLILENLTDIESRYNNILAMIDINSHKIKHINDLLTIDEKEFSESVTNTINDRLFALKNELALS
EAELVSLETQYGKNHAALELLNNKIEILKSNLKDETRVLISQGVAVANPIDYRQGLMDSVIHFKTIKGILESKAISYKKL
VDSYDAKLSSLPEKMLEYARLERQRVIQAETFSFMSTKLEEARIGEASKLGKIRIIDHAIVDSKPISPNKLMNLISGILF
AIACSVAIAFLIDYSDQTIKSIELIEKKGIPILSMVPDLTNLNVHGKSRKNIEQLKAYITDNQIERKLIAYEDPKSPVSE
AYRSLRTSLLYTSNKDMKGQCVLLSSCGPGEGKTTTVANLAVTYSTLGKKVLLIDSDLRKPVNHKVFKVSRSPGFSSYLS
GQKNDIEEIINKTYVDNLDILSAGITPPNPSELLESDTLGELMHTLKQKYDIILIDTPPLIAVADAYILMKYIDKFVLIV
RAGVTEKGAFERVCSELQYGNFPITGVVMNAMTEEHHSYGAGYYYNYSNYYYSDNDS
>gnl|bykdb|A0A2E5U5G7 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=770 residues).
MDKQNQSSFEDSREYSISEILFIIRKHYKLSFLIFFITLFFTIYYTLAVKPQYRSTSMIMVNEDQKSRSMLNMGLDANRN
FISNEIQVLKSRTTSQLTIEKLLDSEYRNDLYILGTKKYEPNFYRTILTFGLLDNSQNIVDVDSEIFAESSDAWIDFCTK
ELMKSISVKNEKNTDVLSISITSLSPFESSLLVNTLIDIYKKRDIEWVTGEMSHLKHFLVDQLSEKEIELNQIENKLKEF
QESEKIFSLDDNSKLILENLTQFETQYNNILAEINIIEEREKYLNAELTADEKGLVNRVSNTINNRLFALKNEIDINESE
LISTITQYGENHSAVISLKNKINKLRTQLGDETKSLIENGISSADPILYRQTLMDSVISIKAIKANLNSKSISYKEIVDL
YDKKLSDLPDKALKLTQLERDRSILSQTYSFMKSKLEEARIGEASKLGKIRILDKAISNSKPIKPNKIKNIFLGVILGCI
LGLGIPLLIEFFDNTIRSIEQLERRGLSVLSIIPDIMISSNKKNKNNKKYLNRNMDVLKLQRRLITHEDPKSPVSEAYRS
LRTSLMYTESESNCQILLVSSAGPGEGKTTSIANLAITYANLGKKTLLIDSDLRKPVIHNVFKLDKTPGLTSFLSKNSSY
SDILNKTDIKNLDVITSGIIPPNPSELLASNSMQKFIAMIREEYDVVLFDSPPLIAVTDPYVLMKYVDQFVLVVRSGVTQ
RGALQRVLEVVGQTDFDITGVIMNAVSESDAYGSGYYYNYYQYYYGESDK
>gnl|bykdb|A0A2E5VVQ3 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=790 residues).
MKNQHLEYKSDNVNYQSMENELYLKDYIIILRIHLKKIILIFFIALLGGIYSTYSKIPRYRATATVIITQKPGSQSLQNF
GNSDNSAQINNKILLIKSRALLKLVVQEYWDSNRRNNMFLFSTRNFYPKGQTIRTIVKELFTLGLYDAEESKKTKILEGP
YTEEIGEKYAKRIQNNLSAGRQGGTNMISVTYVSKNADEARRIVNSIVKQFEIKDKEWTNKYATNSVAFLDSLVTLQEKK
IENSENEKMKFMLENNLYSMEAKSSVIISQINAYELDLYDIETELSIQQKQIDLLKSKFSNQELNLTSQLMNNINIQLSS
LRNEVGNIESKIALNSGIYGNDHGSVIELYGKLNLIKAEINKKVDMLIAKGIAVDDPLLVRQEQISQILSLEGSMTALKL
SRDQKVKMLNSFKNKLNSIPETDMILERLNRQDEILNEHYQQLVQTLETTKMNNVIEKGDVQIVDLAKKPSRPFSPNHQR
DIITFCFFGIGFALVIVFLIEFVDNTIKTIDEIEKYDKSVIGVIPAIGKVSSQGLLNKYLENKTFTALGGEKGIKRKIIT
RDNPKSPISESYRGLRTNILLSNTKDIKSILVSSAGPGEGKTTTVANLAITFANLGRKTLLVDTDLRRPVIHSVFNVKRE
PGVTNYLSGQTDDYNSLIKDSGIENLYLMTSGLIPPNPSEMLGSKKMSQFVKLLESDWDMILFDSPPLVAVTDATMISKE
IDSIVLVIKAGQTDKKAFHHTMANLKNIDAPLDGIVMNAVTSKSNYGSYYYYYYHQYYHYYSSHDDTSEA
>gnl|bykdb|A0A2E5VWZ7 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=786 residues).
MNNQNNLEKNSIQNFSENYTLTLQDYLLIFKIHLKKIIICLIIGFMSSIYYTYTITPTFQSTSKIEVREKPGANMIMDIS
GRAKIDKMTNEIQIIKSRVLAKRIVKRLWESNRRNNLHLFGTRIHYPKGQSVRQLVKEFFSLGLYDENSFKPKEYNEPYS
ENIGEKFSGKVLSGLKVNNIKNTNILKITFSSPNADEARRIANLVANTYIDFDRERSRENARRSVAFLDSLVYSKREEIE
IIEKEIREFKLNNNMYGLDGDASSISLQLNNYESDLYTIQAEINIRKEKVEILNSRLTKEEKSLTGQIINDINSQLINLR
LEIGRLESQLLQNKNKYGSSHDAVIGLTNKIDRLKGELDTKVSILISKGITVQDPLQNRQEIISQLLNLDSEIISYQLRE
SEIKKMLNHFTQKLNDLPEKQMDLTKLVRDADILKQNYLFLKQKLEDAELNVAIEVGDVFLLDKARRPSSPIGPNHNRNI
ILGIFLGLSFGVLLVFMIEFLDNSLKTVDEIEKYALTVLGIIPAIGNTQQNSKKDFLFWKNKLLTNQNTNTLKRRLITRE
DPKSPVSEAYRSLRTSMLYSSTNKVKSVLVSSAGPGEGKTTTVANLAITYANLGKKTLLVDTDLRRPVVHKVFNLEREPG
VTNFLSGQAKNIENLVQETDIDNLSIITSGIIPPNPSEMLGSEKMISFVKTLEEGWDMVLFDSPPLVAVTDANMISREID
RIVLVVKVGQTDKKAFHHTINNLKNIDAPLGGIIMNAVTNKSSYGSYYYYYYHQYYQYYGSEKDSD
>gnl|bykdb|A0A2E5XY54 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=781 residues).
MNQTQSNNYSXDNNXIELSLRDYFLILKIHSKKIFFFTLIGLLISIYFVSVKKPEXTAVVTVAVKDKPGAGMVMDMTGNR
DRDRMINEIQLIKSRRVVKATIKEIWPNKKNNLALFGSYPFYPRGRRVRTFXKEFFTLGIYNSNMEEPVKYSMKYNDXIG
ERFVGXLIQNLKATPRKGTDIXDISYTSVWPAEAKLIVNTIAEKYEEFEHMLGSEQAASSLKFLEKLVKDQENDLINSEI
KLTEFKKKERMYDLDGSALNLVSQISNVESEVYNFESEINIKQQKYNIGKSRLSAEEKSLTDQLLNNINIQVLSLRGEIA
VLESSIIQNEVQYGKNHVAVIELNNRLLSLKKQLIEKVNKXVAQGITSEDPLKSRQXIVLELIALDSEIIGLNLRKKEAD
KLLNILNTKLNELPPKQLKFSKMQRDISVLNQSYALLRQKLEEAKINVASQIGRVQIVDYAKEPINSAKDSKRIIIMGLI
FGXGFGVALAFSLEFLDNSIKTVDEINKLNLSVLGIIPSIGDDNKKALFNFRKKFGNSNSSKGLKRRLMTREDPKSPVSE
AYRGLRTSMLYSSTKSEPKSILVSSAGPGEGKTTTVANLAITYANLGKRTLLVDTDXRRPVVHKVFDLKRXPGVTAFLSG
SIDNYKKLVQSSGVENLSLITAGIIPPNPSELLGSDRMARLVKTLENDWDIVLFDSPPLIAVTDATMISQEIDQIVLVIK
VGQTDKKAFHHTVSNLRNINAPLSGIIMNAVTGKSSYGSYYYYYYYQYYHYYGSEKNDNKA
>gnl|bykdb|A0A2E6AXM8 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=780 residues).
MESQATTQYGFYDILYFLKRNYKYIILVTLLSVFIGALITLRTKPVFTSFSEIEIVEDDNSGFGKMSGFEAFVDQRSLSD
KIRNIGLRPIAEKTIDKLIKPVNSVFLTKDNKLLYNYNYDKIDTLYFTYNGESKKIKINVTQGCGVLYEDVRVPLGIKKV
DTNDVLVLSDNSLNNNFKISDTLIPDGEYHNGCDLPDFRQMYLLNTKKYKYFGLRKTFKNIITMFGLFPIIDKNDDFSRN
ESFSDGEIRFFVKKLQESLFIEPVKETSHLVITVKSFSPSEAADLANCVIDSYIEEEIKIANKRTSAQIKFLKKDIKLNS
DILKEIEDKIQDFQQEEDILSVDGNVDEHVGQFLKLKSDRVTQKLKLKDLIYSKQIFEDEIIKQDIPKSYELSVKDTLRS
LNINIELVNNRIENIAQEISSYQEFLDDLPRKTREFNNLKERKIEISTENIFLTEKLKNAELIYNSAQPGLTIRVDAKED
FERLKPSVFENLLLSFTVGIIIGILGLFTIEYFNNSIKTIEDLERYGLNVLAIIPSIGKKNKSTKGKNIERTLITREDPK
SPISEAYRTLRTSIMYSSENKKDAKIVMVSSPGPGEGKTTTVANLAITYANLGKKTLLIDADLRKPVVDKVFDLKKVQGL
TKYIVENINIKSIIQNSSIDNLDIVTSGVIPPNPSELLDSNKMRDLFDNIKLDYDIILIDTPPIIAVTDALIISKYVDNF
ILVCRSGQTQKGALDRSIKSLKLVGGKFDGAILNAISEGNNYGSSYYYNYYQYYYNEESN
>gnl|bykdb|A0A2E6SF50 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium] (length=786 residues).
MINRQSGLQSNGQMPNWQDNELTFRDYLFILRLHLKKILLFGLLGLGYSIYHVMTIPPSYTAIATVVVQDKPGAGMIMDI
TGNRDRNRMTNEMQLIRSRSVAKATIKEIWRYKKNNLALFGSYPFYPRGKRLRQFTKEILTLGLYDPSTDLPLRYNEEYS
DKIGERFAENLIARLKVNHRQGTNIIDISYTSVWPMEAQLIVNTVADVYQDLDQKWSGEKANNSVQFLDELVKNQEKKLR
DSEKALTQFKKQERMYDLDGKAIAITGQISSVETEIYNTASEINIRKEKYNHLKSKLSQDEKNLAEQLMNNINIQVISLR
NEISQLEANLIQNIAQYGEEHGAVMELKSKMQGLKSQLNTKVKELTQQGIIVQDPLKARQDIVTELISLDSEIMGYRLKK
KESERLLSLYEEKLDLLPSKQLEFSRLQRNNIVLNQNYSLLRQKLEEAKINVASQVGKVQIVDYSRLPGSTGQNHKRTIL
MGLIFGLGLGIFLAFGLEFLDNTIKTPHDIERKSLSVLGIIPSIGKEIVNKQRFFSFKSGLLSRSKTSHGLKRRLITRED
PRSPVSEAYRSLRTSLLYTSADKKIKSILISSAGPGEGKTTTVANLAITYANLGKKTILIDTDLRRPVVHKVLDLNKEPG
ITDYLSGAKDDFNSLVQSTSIENLYVVPSGIIPPNPSELLGSKRMSDLLKRLEKDWDMILLDSPPLVAVTDATMVSKEID
QIVMVVKVGQTDKKAFDHTITSLRNVDAPLGGIILNAVTHKNSYGSYYYYYQYYHYYRSDTETQSA
>gnl|bykdb|A0A2H0XTF1 [Bacteria] Bacterial tyrosine kinase [Candidatus Marinimicrobia][Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22] (length=796 residues).
MEGLNNQSQSDFQGKEVSLQDYLRILYHGRWIIGISFVLVMIITTYITFTAQPQYQSTTLLSLAGRAGQTSTLFSNPFMP
TNMMKVNNEIEVLKSNALSRRVIAALRQSPYADTLYILGTRHYQQKGIDFKKVFKPLIFGLEAIFQNIPFDTSTSLVDTL
DRALVRALQASMKVEPIRETEAVRLTVTSASPIEAAFLANMIAREYYRLDIEFNLGEVVEVKNFLEEQLVDIEKDLTASE
EALKDFQKREGVFGLDETAQTLIDQLSTFEATYYTSLAELEVSKKKWDNQQKMLTDREQMVLKDAVNTTNPLISQLRQAI
AEIEAQKITAMAVQGYKTGDAAIRELDGRIQELKIKLYKEAENLTNLGLSPEEQSTISADLLRSVLFTSVEKIALEAKCS
EYKDLVNQYAAKLNKLPESSLEYARLDRERQVNEKYFILMKTKHQESRITEASKISNIRIVDPAVPPEKPVKPKKKMNML
LGLFLGLGLGVGIAFVRDYLDHSIKNAEDLQKLGLATVSIIPKIDVKSATEKSLKVFKGENLEHSLKSRLVTHYDPKSSV
AEAYRTLRTNIQFMNPDNPIRTLVVSSAGPGDGKSTTVVNIAITFASLGKKTLLIDSDLRKPILHKVFDISRGPGLTHAM
IEDLNDSDIIRATEIPNLYIITCGDIPPNPSEILSSQKLKNFIERMKSEFEIVLFDSPPIIAVTDASVISKMTDAILLVV
KAGVTDTRVVARAIELLRQVKTHLIGAVLNGVNITGGYDSYYYYYNYYYYYGDGGKKKKKSRFRKNRSASPAEPER
© 1998-2019