BYKdb

Dataset for cluster tadcd of phylum candidatus-melainabacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A1F6QKE9 [Bacteria] Bacterial tyrosine kinase [Candidatus Melainabacteria][Candidatus Melainabacteria bacterium RIFCSPLOWO2_12_FULL_35_11] (length=707 residues).
MNFYEAIRIHLRLGLLIVFLVPTVSWIIALNITPIYESRARLLIEAKDLGLDSNESSAPFRSISRLSDPIQTQIEILRSS
TILEKVIRQFNLRYRRGPQKGQYLSYLSLSQNLSVSADRNVDVVELKYKDPDPKKAKDILRAITDSYIEKTIELKASDTA
SAIRFLKKERNKAEREALEASKRLREFEQRSKTAGRDFNSELIKSSYGLKSLRLSIDTEYVKAKTAAEQVSKQLMSNIDD
ALLENTINQDPFLAALKKDLFERQTQLVKIQTKVKPGHYQLEEIKQQIQGDNKLIAERVKELIGHDVNPNTIPYSQDPLR
AGLIKNLLETKTAELAIEQELMVVDEAIAELQKKIDKLPNEKYIYNQLLRQNEIAEKRLQEIEVKLIESRMKGVIASHIT
NIRLIDPPSFAARPKWPNISSTLMTSFIFGLLLAGLVIYLVEYFDDVIKSVDTLPKDLGCPFLGQLPYIHVSDLPTVYQE
PRSEYTEAIHALRTNLSFLSLAGNKKLLLVTSSTKNEGKSTISVNLAITYAQSGKRVLLLDADIRNPSLYKYLARPKDAV
GISNTLINEIDFYDVVQKSILGIIGFDYLPGGDIPPNPVQLLESDKMRELLETCQHIYDLVIIDTPPIGYFSDALLLARH
ADVVALVSRYNQTSRKELSASVSLLKKTNVTALGVILNGIPVGAQGAYGYYGYGHESERYIREQPAA
>gnl|bykdb|A0A1F6RGM1 [Bacteria] Bacterial tyrosine kinase [Candidatus Melainabacteria][Candidatus Melainabacteria bacterium RIFCSPHIGHO2_02_FULL_34_12] (length=706 residues).
MNFFEAIRIHLRLGLLIIFIVPAVAWVYSLTITPIFESRARLLIEAKDLGLQGNQQPFKTIARLSDPIQTQIEILKSATI
LDKVIRQFNMRYKGGPNKGRYISYLTLSGNIAISSDRNVDIVELKYHDPDPNKAKEILQAITDSYIEKTIELKASDTASA
IRFLKKERNKAEREALDTSKRLREFEQKSKTVSLQSNQELVKTAENLKQIKLTADSEYAKFKSVTVQLKKQLMSTVDDAI
ITSTVSQDPFLAALRKDLYEKENRLVQLQTKVKPGHYQLEEIKEQLSGNKKLILERIKELIGKEVDINSFPYSQDPLRAE
LTKNLLQTKSAELAAKEQLKIIDIAITELNKKLERLPSEKYIYTQLLRQNEISQKRLEEIEQKLIESRMKGVIAQHITNI
RVIDPPSLAGRPKTPNIPINVFYSFIAALFLAGIVIYLVEYFDDIIKSIETLPKEMGCPLLIQLPLVHIGDLPIVYQEPR
SPYTEAIHTLRTNLSFLSLSGNRKLLLITSPSMSEGKSTVAVNLAITYAQSGKRVLLIDTDIRNPSLYKYLSRPRDSVGI
SNTLINEIDFYDVVQKSILGIIGFDYLPGGDIPPNPVQLLESDKMRELLETSQHIYDLVILDTPPIGLFSDALLLAQYAD
VVALIARNNKTSRKELMSAIDVLRKTDVAGIGVILNAVPSSSQSGYGYGYYGYGDSERYAKRQPAA
>gnl|bykdb|A0A317IV02 [Bacteria] Bacterial tyrosine kinase [Candidatus Melainabacteria][Candidatus Melainabacteria bacterium] (length=756 residues).
MLETKSTDFRRQVSHNDITLADAIGSSIRFVRRQRRVIISSVLVLVTLGVLTRFLTPSRYTARAVVYADLSRQEINPPQQ
QAIGPSPEDPTQVDSQVEVFRSLSVLLPVVEQLKLREDPEFSKKGSQGQEEQRELSSLLEKLEKALEVKRVGKTHIIEVL
FTAQSPNRAAEVANAISNSFIQDRLQAKYESAQRAIAWLHNRLTELKRQSSAAEEAAERFKSSHVMSAELLAQQLSELKS
RRVSIQSEVDNADATLGHIDFILRSDFSIAAVDGSILEASSELAKLRSRYLELVSQEAELTSGANHDHSAEVNVRKQIEQ
MRASIKEELKRIAENYKSNHEIARAKERAVGEELAQKNALLKSENEHQVKLRELENIAKNLRTTYDDNASFLQRDIEQLQ
QQSMPTSGARIISLALPPLKRSSPKTSLLVGGAALAGLMLGFAIGFFRDMADRTCRSREQIEAILDVPCITMVPRLGANR
RTQALRNWNLHLHEKKIKASGFLTSKNQLLSRTDSRGKSSSAARQTDYISFLADTTQISQEPFFSRFSEAIQTIALSLDQ
AHAASQIVAVTSALPNEGKSTIIAYLARTLAQSGRRVLLVDCDLRVGKLTKVFAEQSPIGVRDIVMSEVSAQIAIKQHDA
GFAFMPAGTGACPTHPNEIFAMAKTHILFEELRKSFDYILLDLPPLGPVTDVVAIGKFVDSYLFVIEWGRTQTQVVPQTL
NRAQLVRNNLLGVILNNVDLKAIADYERTYYSYEEN
© 1998-2019