BYKdb

Dataset for cluster orphancd of phylum candidatus-omnitrophica

[Download (right click)] [Alignment] [Repertoires]

23 sequence(s)

>gnl|bykdb|A0A1G1J391 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RBG_13_46_9] (length=271 residues).
MKKILDILKKILAYYTPPMYVIKKMKTPDGVDGHLVSYTDKHSFVAEQYKVLRTNLYSLSPRETLKTIVITSSQSQEGKS
VTSCNLSYTLSLDTEKKILLLDADFRRPSIHRLFGIPRKPGFTDVLSGLVELEHFTKKPTFGNLHVIPSGTLITNPSEFL
SSIKMRNLIKELKTSFDYVIFDSPPVINVTDSCILGSICDGVILVVKAGITPKNMIEEAFTMLTHAQAKPKACVLTNTSI
PVYYYYVSRYKYYYKYRYGYRSDTPIDTSVK
>gnl|bykdb|A0A1G1JRT8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium GWA2_52_8] (length=230 residues).
MLFDTAHPSPVSESFRALRTAILFRFRRVSGCRVLLTTSPNPEEGKTTVSLNLAAAFHQNHLKVLLIDADLRKPKIHKIF
DVEDARGLSDVLEGTARPRDVIAENVDGLGFDVLFSGPHSDHPTEILGSKQMSDMLTELKSHYDIIIIDSPPYLAVADVA
VLNEYVDGITVVTRYHKTDKRHLKDMKKRLSREAEKILGIVINQVSVKEKDYYYQQYYYYGYGDAKPRKR
>gnl|bykdb|A0A1G1JUC3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium GWA2_52_8] (length=729 residues).
MNTANLPPYGAKPAVESHSEDHLEANLFAYWHILVKRRLVLLMALLVCLGLALIINSMQTPIYRTGAELVVEPKSSNESN
TDLQLNNLMRDPTYLMTQSRLVSSKKFAKRVLETAVDTGIQIQMLEQAGRSISHERKKNFKLEDREQELLMRIFAGSITL
RPVAAGARIFSLEVKGTQADLCAELANIAAEVYVEMNHAANIDAFKSRFSMTSKSLNEIREKVKASEMALEKVAAEADLL
KALKVFGEKYPDVIKLQGMIRALSGKLEESQNSLQLSQIAQRQRMFSIILKPHLTAEELIPVESDLTNLKNLLEQEIETN
REIYNSIYKRLQEMELAGGASLWVDIKVIEPAAIPGRPIQPNKKMNVLLSLVIGAFIGLALAFFLEYLDSSLRSLEDVRA
HLRVNALGIIPEVEFETADLRELQDKFHAEGSSRVMWSTSDLKIPLYVAEAYRIIRTNFVFGAVDKSLRIFQVTSAVKGE
GKTTTTVNLGISLAQVGLKVLLIDADMRRPSLHHALRLPKEGLGLQHVLKEGLPLEAVVQKTKTENLQVITSGGIPEHPA
ELLSAPVLTAFLNTLREVFDVVLIDSPPVISVADAPIIASRVDGTILVARSGYIPRRLSIQAKKAIEAVNGKIIGCVLNS
VAASHHPYYYYRYYSDHSYGYYGSEANGAGGKKRRSPIQGERVSSLEKLKLVFQSLLPKGNARFENLPPQPRHSGSRTET
ETSTPTMTV
>gnl|bykdb|A0A1G1MCV8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RBG_13_41_10] (length=231 residues).
MAKKKVESKIDPRIVAFHDPKSSVSEQYRILRTNFQGISSPKHPIKAITITSSVHSEGKTITAINLAVSMAHDLNKKSIL
LVDADLRRAKISKYLGVNAEVGLADLIANGTNIDDTLLNIGIDNLTVMPAGKIPHNPAELLGSAKLKNIITALKSKYDYI
IIDTPPIIHVTDAGLVGAQTDGTIMVIQANRTQKGVVEHAEMLLKQAQAKVLGYILTNIQYHIPAYLYRYL
>gnl|bykdb|A0A1G1N811 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_48_11] (length=231 residues).
MVIKKIGNSNVDPRIVTYFDPKAVITEQYKILRTNLLSMNKGKSPRIIVVTSSVHSEGKTVTTLNLAMAIAQSAQKLKVL
LIDADLRRGRMAKYLGVNQKIGLTEVLKGEADVADVMFNIDVENLTFIASGTVPENPAELLDSEIMKNLLTTMRTKFDYV
LIDTPPIVSVTDSGIVGSQVDGVLLVIQAGRTQRGIVKRATELLNQAHSKLLGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A1G1NXZ1 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_52_10] (length=226 residues).
MSDSKVDQRVITYFDPKAVITEQYKILRTNVLSFSKTKPLKVMAVSSSIHSEGKTLTALNLAVAIAQSTSKPRVLLIDAD
LRRGRVAKYLGVKQPVGLANILKDEVKPSDALFNIDVENLTFIAAGPIPTNPVELLSSDRMNRFLILMRSKFDYIIVDTP
PVISVTDAGIVGAQTDGVLMVIQAGRTQRGIVKRATELLNQAHSKVLGHILTNIEYHLPEYIYRYL
>gnl|bykdb|A0A1G1P565 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_50_17] (length=231 residues).
MVIQKIGDSKVDPRIVTYFDPKALISEQYKILRTNVLSANAKRPLKTLVITSSLHSEGKTITALNLAMAIAQSTQKPKVL
LIDADMRRGRVARYLGVEQKTGLTEILTEKADPSQTLFHIDIENLTFLSSGAVAENPAELLASDGMQRLLADMKTQFDHV
IIDTPPIISVTDSGIIGALADGVLLVIQAGRTQRGIVQRATELLEQAHCKTIGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A1G1PTZ0 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPLOWO2_02_FULL_63_16] (length=308 residues).
KITQALEKAARERLQHTQAHATTTAQAVSIHIEPASGPGDVGDIAVADRIEVDPHIVAATDAQSPISEQYRILRTNLQSM
RMSSGSPVIVVTSAVHAEGKSVTAINLALTLARQEKLRVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSLVR
LQHPPLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQFDLIVIDAPPTMLVTDPAILASQADGTLLVVRAGKTQRKTVAR
AHALLTQMHAKVVGCVLTHVEYYLPGYYQHYYAYRYGEKKEATSDKGQATSSKQQGTSDKKQVSGLGG
>gnl|bykdb|A0A1G1PUA7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFOXYA2_FULL_45_12] (length=250 residues).
MAKATDDSGIDPGVVTYFDPSSSIAEQYRSLRTNILLNNLSRPLKTLAICSSLEGEGKTTTAVNLAITMAGDLERSILLV
DCDLRAGTVHQLLAIKSAAGLSDILASGAELESTLGQTRIRNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSKFDYIIL
DSPPIMPLTDACVISSQVDGVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTETKEHADRYGYYGYGEVQKSDSD
SLEQTEKAIK
>gnl|bykdb|A0A1G1PYB2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPLOWO2_12_FULL_63_16] (length=310 residues).
MSKITQALEKAARERLQHTQAHATTTAQAVSIHIEPASGPGDVGDIAVADRIEVDPHIVAATDAQSPISEQYRILRTNLQ
SMRMSSGSPVIVVTSAVHAEGKSVTAINLALTLARQEKLRVVLVDGDLRKSAVHRWLGLGERAEGLSTALARGGELNGSL
VRLQHPPLAVLPAGPHPEDPAELLGSSSMKRVLAALKRQFDLIVIDAPPTMLVTDPAILASQADGTLLVVRAGKTQRKTV
ARAHALLTQMHAKVVGCVLTHVEYYLPGYYQHYYAYRYGEKKEATSDKGQATSSKQQGTSDKKQVSGLGG
>gnl|bykdb|A0A1G1QJ19 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFOXYB2_FULL_45_11] (length=250 residues).
MAKATDDSGIDPGVVTYFDPSSSIAEQYRSLRTNILLNNLSRPLKTLAICSSLEGEGKTTTAVNLAITMAGDLERSILLV
DCDLRAGTVHQLLAIKSAAGLSDILASGAELESTLGQTRIRNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSKFDYIIL
DSPPIMPLTDACVISSQVDGVIFVVQAHRTPRRVVKQAQNMLEHVHAKILGFILTQTETKEHADRYGYYGYGEVQKSDSD
SLEQTEKAIK
>gnl|bykdb|A0A1W9R9H3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.1] (length=315 residues).
MGKISEALKKLNEEKERQKKEIMEKEKVLKKKEEAREEIKEDKSGAVRALLSSWGERLHFKENFFLFSSQSPSGIDPRIV
TYYDDYSPLSEQYRLLRTNVKSLVKRIKGNHKSIKGVNSPAIITFSSSLRNEGKTVTAVNLAMSLASEEGTKVLLIDADL
RNGTIHKLLNVEEEPGLSTVLVGEYDWSVGLHPTLNKNLFVIPRGKISAHPCEFLGSRKMRMILERLRGEKFNYILIDTP
PLLSFADAYLIAQLTDGLIIIVEAHRTKAEIVRKAKEVCEEAHTKILGFILTKVDYYTPDSYYYYYNYRKYGRKI
>gnl|bykdb|A0A1W9RBB3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.1] (length=322 residues).
MGKISDALRKVMEEREKQNREAKTLITSTINKEDSGFSSDDISPISLKSSRRSTQKFLPVKDKAYIAKTRDDSGMDSKVV
VYYDYPPPISEQYKILRTNIKSYLNKTVNIDKINMNKTVTPPRMITITSSLRGEGKTVTCANLAVALARDCENKILIVDC
DLRGGTLHKLFNLDCRPGLSDILTTDFDWSVALHTTKLENLFVLPRGETIPNSSDLFSSKRMKLIIEKLKSEQFSYIILD
TPPLLFFTDASVLGVQTQGIILVVQARRTPLQVVKKAEEFIKQSSNRLIGFIFTQVDYYASNYYYNYYYYRDRGSNYQKG
KY
>gnl|bykdb|A0A1W9RLY2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.2] (length=310 residues).
MGKITQALRKIQEEKEKKSKIQKTIEDSNVVKDNFVKKEKEEEDFPFSRGKEYSLKNKAFLVSKKDISGIDSRIITYYDP
SSPLSEQYRILRTNLKSILRKIKATRRNIKSSNFASVFTISSSLHNEGKTITAVNLAMSLASETETRVLLIDGDLRNGLI
HKLLNIEAEPGLSTILINDYEWTVGLHPTRKENLFVIPRGKISPISSELLSSRKMHIILEKLREENFNYIIIDTPPLLSF
ADAQLVTQFTDGIIIVVEANHTKAEVVKKAKELCEQANNKILGFILTKVDYYAPDFYYYYYNYKNYKKDV
>gnl|bykdb|A0A2H0LKN2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_63_9] (length=304 residues).
MSKITKALEKAARERLHKLQEHANVRSEAVEIPIETPSRISEAMAAGRVHIDPHIVAATDSSSPIAEQYRILRTNLQSLR
LRPGPKTIVVTSSVHSEGKSVTSINLALTLARQENLRVVLVDADLRKGSINKWMGLGERAEGLSTALLRGGELNGSLLKL
KDPALAVLPCGDYPEHPAELLESSSMKKVLAGLREQFDVIVIDAPPVLPVADPGILAAQADGVLLVVRAGKTQRKTVLQA
QSLLRQMKANVLGCVLTHVEYYLPGYYRYYHQYRYGVVKDKDGNGKAAAGSPAQPEAQSSTPQT
>gnl|bykdb|A0A2J0KUN7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15] (length=708 residues).
MEENSNLEATLRDYLEIVAKRKTVFVVGFIIALIGSIAVIFLFVPLKYRATTEIMIGSPVTEVVDQQGTVYIRGKYDVAV
AFELMRSDIIPEKISKTIEIEEKVLISPGEVKGMIAFIAASAQRTKNPYAHNLILISAIHTDTRKAYLVAKAAIKILFEE
TRKYRKRVIKEMYDALSSQLLEKHRQLEESERELTRYIIDNDIIAKGIEVGSDLKGGKPGVEVWRGPQINEKYLALKSQR
LNEEQFLEEVKKNRQQDEVVTLSIISKKYGGLVDEKLRDELYEKERVLSKLLLTQSEMHPDAVEAKGEVDEAKKKISMEL
DRALQSLDRSSATLKREEEKLRTLIKEGLSDKMVEYSSLHRDVEVKQEIYNSVVKQVEELDTYEKLLSTGFLKVVRSPIM
PRNPENPRSGSCTMAFFFSILCGIACVFLFEVLDISIRNVEDVEDIIGITMLAAIPSWEPKTENKDAKVKSAKRQDAGLV
VARNPKSIMGEAFRTLRTNIKFVCVDKNIKSIVITSVGPKEGKSFISSNLALSIANSGEKVILIDADLRRPTIHKYFGIE
NQKGLSNLLIGDGSLDEFEAADSAFENLKIIPAGPIPPNPNEILGTRRMEEILEHLKGTCNIIIIDSPPLLTVSDALILA
KKTDGVIFTFFTNKTAKKAGKRAVFLLKNAGINMLGGVLNYVKTSKGGYYYYYYSYEYYADKNDKKKS
>gnl|bykdb|A0A2J0L3X7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15] (length=200 residues).
MITSALAGEGKTITAINLAISMAHDLDNKSILLIDADMRKGKIAKYFGLGSHPGLSELLKGNADQEGVLINPGIPNLTVV
LAGKTPKNASELLNSKKMEQILSYFKTRFDYILIDTPPVMPLTDACILGPVVDGIIMVIQAGKTQRDIIAHAEQRLYQAR
AKTIGYVLTNIEYHLPQYLYRYVHQYDGNYSYEEKAAAKT
>gnl|bykdb|A0A2J0M9Y8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG_4_10_14_0_2_um_filter_44_9] (length=258 residues).
MGKFTEAIRKAAEKRIERVEKKEEFKPYVIRTVSDSKIDPHVVTYFDPTSPISEQYRTLRTNLQALDKANPPKVLAITSA
IHGEGKTITSINMAITFAHDLNNKSILLVDADLRKGNLTKALGLKADKGFADILTDGTTVEDSLLSIDIKNLHILPVGNK
PNNPAELMGSAKMRQFISEVRKQYDYVFFDCPPVIPVTDASVLAHQCDGALMILQAGRTQKGIISHAQDRMSQAKVKVLG
YVMTNIEYHIPEYIYRYL
>gnl|bykdb|A0A357BIJ1 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=261 residues).
MGKITNALKKAAEERLERIEKISRLKEREDLIVKKIGESNVDPSIVTYFDPKALISEQYKILRTNILSMNKGKPPQTIVI
TSSIHSEGKTVTVINLAVALAQSVQKPKVLLVDADMRRGRMVKYLGVDHKVGLMEILTGAAKAEDVLFHLEYDNLAFVGS
GGIPENPAELLASDKMKQFLAEMKSDFDYILIDTPPIIPVTDAGIVGPIADGVLMVVQAGRTQRGIIRRAEDLLFQTHSK
ILGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A358AEN7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=296 residues).
MSRIGEALNKATQEKIARNQEAAFPVQSPLEAQKPPAQERSRNSGYIAKATDDSGIDPGVVTYFDPSSSIAEQYRSLRTN
ILLNNLSRPLKTLAICSSLEGEGKTTTAVNLAITMAGDLERSILLVDCDLRAGTVHQLLAIKSAAGLSDILASGAELEST
LGQTRIRNLTVLPRGEIPRNPSELLSSKKMRGLLQELKSKFDYIILDSPPIMPLTDACVISSQVDGVIFVVQAHRTPRRV
VKQAQNMLEHVHAKILGFILTQTETKEHADRYGYYGYGEVQKSDSDSLEQTEKAIK
>gnl|bykdb|A0A3B9ZHK0 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=262 residues).
MGKLTDALKKAAEERISRIEKLDSQDEVKYQFIAKKTVESKIDPRIVSFYDSHAPVSEQYRSLRTNLQALNTSKPAKVIA
ITSSINGEGKTISAINLAITMAKDLNQKSILLIDADLRRSRITKYLGITPELGLSDIITNGSNIDDALLNIGIENLTVLS
AGKHPTNPAELLGSQKFKNLMNQVKAKYDYIILDTPPIIPVTDAGLIGAQADGVIMVVQASRTQRGVVKHSEGLLKQAQA
KILGYILTNVQYHIPGYIYRYL
>gnl|bykdb|A0A3D2GIE7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=261 residues).
MGKITEALRKAAEDRLERIDKIARIREEKALVIKKIGDSKVDPRLVTYFDPKALITEQYKILRTNILSANARRPLKTLVV
TSSLHSEGKTVTALNLAMVIAQSTQKPKVLVVDADMRRGRVTKYLGVDHPMGLTEILTDKIDPSEALFHTDMENLAFIAS
GSVAENPAELLGSDRMRQFLADMKTQFDFILIDTPPIIAVTDPGIVGALVDGILLTIQAGRTQRGIVRRATELLDQSQSK
IIGHVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A419DVK8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=262 residues).
MGKITEALKKAAQERLARIEKLDNREEVKFEFIAKKQVDSKIDPRIVTFHDPKSSVSEQYKMLRTNLAALGTKKPVKVMT
ITSSTHSEGKTITAINLAISMAHDLNNKNILLVDADMRRARITRYLGVASESGLSDILNDGANIDQALLNIGINNLTILP
SGKIPHNPAELLGSGKFKNLVAALKNKYDYVIFDTPPIISVTDAGILGAQTDGVIMVIQANRTQKGVVKHAETLLRQAEA
KLLGYILTNIQYHIPAYIYRYL
© 1998-2019