BYKdb

Dataset for cluster tadcd of phylum candidatus-omnitrophica

[Download (right click)] [Alignment] [Repertoires]

25 sequence(s)

>gnl|bykdb|A0A0F0CSR3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophus magneticus] (length=648 residues).
MGVKKKGNKNMPNSTQNPFLEREQDIKEYLSILYNRRWLIISFTLVLCTISLIRTFMMRPVYEATTKILIQKKAPRIIKI
DEMDTTNYSASDTLFTQYKILESDFLAEKVFKTLGDYIPWDKWHGRKKINTSKPLTDLQKIETLLSHLKITPIPNTELVL
IKFEDIDPVLSAKIANLWANSYISYILDTRFDVSSYASGWLDDKIKEEKNNLETAEKTLQEYRKANTIIIDTVDEEHRVL
NKLLAKKSELEVLLSEKQEYYKAQHPEILGIKSELESIVKTIANEKTKELKIKDIEIEYNILLREVETRKEVYESLLKRI
RETEITGGLKTTNVSILDIAQVPTKPTRPNKKLSLIITLFISVLSGSALAFLIEALDQTLKTPEDIKKFLNIPPLAGIPL
PRDEEDKLISPEFITSKKPRSTIAEAYRSLRTSILFTAIEHKRKSLLLTSSCPQEGKTTTAINLAVVMAMAGEKTLLVDA
DLRQPRIEKVFNLKDKLGLSDVLIGNAKWEQMIIETNIKNLFILPAGSIPPNPSELLGSGKMTTFLEDIDKKYDRIIIDS
PPVLAVTDAVILSGKVDGTIIVARASHTHRHAICQAKELIETVDTAHIVGMILNMVSINIGSGYYYYYYGKYGKYGKTPK
KNTTVSAS
>gnl|bykdb|A0A1G1IP08 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium GWA2_50_21] (length=728 residues).
MDLITMPDPKVAPPYSTKESQISTGAPEERLDASIHSYVFVLWKRKWLIAASIVFCLGISTFINVTQKPVFRASTEVVLQ
PKESDTSSSSVHPGNSIMQDPTFLLTQLRVIKGPQLAERILQKFSTGEERQLAADCFALKGNWAKKDAPFTEREQGFLVS
MIRGFISAEQVERGARIIAISMTGYDAYGVKKMVDTAAETYIDLNYETQIDAFKKSFSVISKSLNEIREKIKAGEMALQK
IIKELQLLDQFKVYGDKHPMVVSLQTDITGLSVKLRESTNDLEKMEISQRKDRFSLIVESHTDMKSLTDAEVDLQTMKPL
LEQEVNTNKELYNSLFKKLQEVELSGSRNVWLDAKVIEKAAVPGRPIRPNKQMNLLLGLLLGGFIGTGLAYFLEYLDSSL
RSLNDLRSYLKIFPLGMVPMVELPELEKQIDLAENPELTRTWWNTNDGTLPLYVAEAYRIIRTSLAFGSLDKTIKVLQVT
SAVKGEGKTTTVCNLGISLAQAGIKTLLIDADMRRPSLHHILHIDDRNQGLSTILSGDPLLSAKDFVRPTTIANLYCMTA
GVIPPNPAELLSSRRIKSMLDALKEEFDMILIDSPPVISVADSPIISSHVEGTILVSRAGFIPRHICLHAKHAVEAVNGR
IIGGILNCVTSHQHSSYYGYGYYYGKGYGYSYYGSDEKQGGKKKKKRSAGAAPGKLEKLMMLKEPVIDMISSTVSNIISI
LKSGQPRK
>gnl|bykdb|A0A1G1IVX7 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium GWA2_52_12] (length=646 residues).
MAAAGSVFGEEEIHLRDYYYVLMKRRRLILTFLLAALSLGIFFTFTERVIYQASATLLIEKDNPNVLDFKEVLTFDASST
DYYQTQYQMLKGAGLIRELLHEERLENDPYLEGLVRGRMRNFLRKQPWVAGILGKFLVPQSPEDVFAAHMLQIKPVRNSQ
LVSVIVLHPDNRRAASIANTLARLYIEQNLRNRYEVSTQATELISGQIGILKDKVAEADLKLQKYKEEHSLVSIPSLHEK
DQFLQDAKLQLMKLQAREARMAKRYLPAHPKRIHLRSEIEGLDEKIKTEETRKIDIGGVAIQYDELEREAESARKVYRAL
LERLEQTHSEAKAQASNITVVDKAVPEPRPARPRPFLNLLMALVLGLMGGVFSAFLAEYLDPTIKIPDDVEKGLGLDLYG
MIPKAGRINASSAQGEIFSKWEIVPNPAAEAIRALRTALVFKLRHMKGCHALLVTSPNPEEGKSTVALNLASAFQQNHFR
ALLIDADLRRPRLHKALGEGCERGLSDVLEGQCDIVSAVRRNVAGFGFDFLPAGSRLDHPTELLGTETAAKLFTALRQEY
DMIIFDTSPYLAVADVAVLSEHADVGVIVARYHKTDKRHLKDVRRIFGEGNLKTFGIVMNLVEPRERHYYYHRYYYYGYG
GDTPPK
>gnl|bykdb|A0A1G1JR53 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPLOWO2_01_FULL_45_10] (length=554 residues).
MESPRPSIKEEGLQLKNYTHIIRRRADVLILFFVATVSVITIGSFIMEPVYRATTTLLIDPESPNVLTTTGMVELESQNY
FSYKEYYQSQAELLTSYTLVKKVFNEFGLEEQFEYFDAKEPIKKFLKTIKVDPVRDTRLLKLNVDNKDPELAAKIANRMA
NLYVMRNLYYISRTELTNLLKNEYLKLESRVSEYAKVYKEGHPEMIKVKNEMAELVAKIEKEKKSVYDYDNIEDYLKPEA
QHQLAGFKANNISVQDSAEIPVVPIKPKRALNIVLAVVIGIMGGIGMAFFSEYLDDTAKSIEDVEEIAPWPFLGSVPRMK
GRGKRAELEKDVRVQRLPRDPVSESYRSIRTSILFSSTEERPLRSVVVTSPGPQEGKTTTLCNLGISIAQNGSKALLVDA
DMRKPRLHEIFNIENKNGLSDFLCGRIEFVSSVKATDIEGLSITNGGTHPPNPSELLSSQKMKYFIQEAERKFDFLLFDS
PPVGMLTDAMIFSSMVDGMIMVIESSKTSKRTLARIYKLINSAGVRVVGIVLNKISIHGDDYYHRYYRHYYGKP
>gnl|bykdb|A0A1G1JZ27 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPHIGHO2_02_FULL_46_11] (length=614 residues).
MKIFPSSKISDELQLSLYDYWYIIQKRKRLALTFFLIVVISTALYSLLSPKIYKATTRILIERSNQNILSFDNIFPVQMA
GLDYYPTQYKILRSRSIAKRVMDELHLWPQFSWASDPPAAFLQKVDIDPVKQSRLVDVSAYSTSPKQAADMANAMVKFYI
EQNLSNKLAMTQQAAEWLKGRSKDVREKLSKSELEFEAMKLKKELTELNEKYLPKHPKIIRTQERIRVIEEQFGGGISKD
FASGEISTQYNQLQREVDSQGKIYEAMLSRLKETSASEGIEDTNVVVIDRAEVPTRPVAPRFFLNVFLSILVGAFGAAAL
CIIFESLDNTVKTPEDIEKLGELPLLGVVSHWEAAQKQLVVHEDRSSGVAEGFRAIRTSLLFSSPDHPLRTLVITSPFAE
EGKTIVACNLAATIAQSGARVLLVDADMRRPRVNQVFQQNGVHGLSHALTDSANPSGFIQKTKIENLSVLFCGPLPPTPS
EMIGSQKMHQLIEKLKGQFDYVLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARGKQKFLGVQAKLVGVILND
VDLEQERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQDSAISSHPPRNFSPK
>gnl|bykdb|A0A1G1K0W1 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPHIGHO2_02_FULL_46_11] (length=610 residues).
MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFSLLYALHLPTVYTARTKIFIEGGKESAFQNP
EMMESPAANPLPTYFQTRAEMLKSHHILEQAAKELNLVEHYQKVNKRIKTNEEAADLLGDDKTNVKLLKGTQIVQLSVTD
TDPQWAAKIADGISDTFIKESWRERLFISEQILEWFPKEGETLQKSSGINQLRQLDKEGAITSLPSVAKDPVINSIKEER
IKVDAMMRELSKRYTSEHPKIKELQARADYLESEMKSQIQKIVSGLKSGLSGEFSASNMKVIERAEIPTKPSGPKRLVMV
SLSTLIALFLSIVLAVQLNNLDLNIKAEEDVRQIPMPFLGYLPQLDTLAGDTKSDRRENLLEHVLTDMRLMDDITNIRAA
VLFSMPADRSKLLMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPALHQIFGLENKIGLSHCLVGTAKPQEAI
QKIDKIPGLSIMTAGVTPPNPAALLGSSMLERLIQELEPHYRRIVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNI
AKKMKERILSAKGTLIGAAINGTDYKKLDYASYTYYQKYSKYYGVSKAGD
>gnl|bykdb|A0A1G1K375 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPLOWO2_01_FULL_45_10b] (length=614 residues).
MKIFPSSKISDELQLSLYDYWYIIQKRKRLALTFFLIVVISTALYSLLSPKIYKATTRILIERSNQNILSFDNIFPVQMA
GLDYYPTQYKILRSRSIAKRVMDELHLWPQFSWASDPPAAFLQKVDIDPVKQSRLVDVSAYSTSPKQAADMANAMVKFYI
EQNLSNKLAMTQQAAEWLKGRSKDVREKLSKSELEFEAMKLKKELTELNEKYLPKHPKIIRTQERIRVIEEQFGGGISKD
FASGEISTQYNQLQREVDSQGKIYEAMLSRLKETSASEGIEDTNVVVIDRAEVPTRPVAPRFFLNVFLSILVGAFGAAAL
CIIFESLDNTVKTPEDIEKLGELPLLGVVSHWEAAQKQLVVHEDRSSGVAEGFRAIRTSLLFSSPDHPLRTLVITSPFAE
EGKTIVACNLAATIAQSGARVLLVDADMRRPRVNQVFQQNGVHGLSHALTDSANPSGFIQKTKIENLSVLFCGPLPPTPS
EMIGSQKMHQLIEKLKGQFDYVLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARGKQKFLGVQAKLVGVILND
VDLEQERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQDSAISSHPPRNFSPK
>gnl|bykdb|A0A1G1K4H2 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPLOWO2_01_FULL_45_10b] (length=610 residues).
MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFSLLYALHLPTVYTARTKIFIEGGKESAFQNP
EMMESPAANPLPTYFQTRAEMLKSHHILEQAAKELNLVEHYQKVNKRIKTNEEAADLLGDDKTNVKLLKGTQIVQLSVTD
TDPQWAAKIADGISDTFIKESWRERLFISEQILEWFPKEGETLQKSSGINQLRQLDKEGAITSLPSVAKDPVINSIKEER
IKVDAMMRELSKRYTSEHPKIKELQARADYLESEMKSQIQKIVSGLKSGLSGEFSASNMKVIERAEIPTKPSGPKRLVMV
SLSTLIALFLSIVLAVQLNNLDLNIKAEEDVRQIPMPFLGYLPQLDTLAGDTKSDRRENLLEHVLTDMRLMDDITNIRAA
VLFSMPADRSKLLMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPALHQIFGLENKIGLSHCLVGTAKPQEAI
QKIDKIPGLSIMTAGVTPPNPAALLGSSMLERLIQELEPHYRRIVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNI
AKKMKERILSAKGTLIGAAINGTDYKKLDYASYTYYQKYSKYYGVSKAGD
>gnl|bykdb|A0A1G1KL63 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPLOWO2_01_FULL_45_24] (length=599 residues).
MTANLEKQKERHLKDYIEVLRRWRDIAITFFVSMVLLVTISSFIMKPVYRATLTMIIDPESPNVLTATGMVALKSEDYLS
YKDYFQSQMMIMCSHSLAKKVFEDFKLGETKEYYKTKEPIKNFLKTIRVDPVPDTRLVKLSVDNKDPQLAANIANRMAEL
YVMQNLYYTSKVELSNLLKNEYLKLETKAAEYAKVYKEGHPEMIKLRTEMADMIKRMDNVNMPIHDYSKMEESLKSDSGR
TLAGFKANNISIRDPAEKPVTPIKPKKRLNFLLSIVIGLLGGVGLAFFFEYLDDSVKTVDDIERICEWPILGCVPDIDSR
ISVEEAASPLGELEKDIFVSIKPKDPIAEAYKSIRTRLSLSSTEEHPLKSVLITSPGPQEGKTITLCNLSIALAQNQKRV
LLIDADMRKPRLHKVFKKENVSGLSSLLSGQAVFDNIIQKTDITNLYFISGGILPPDPSELLASGKTKESIAKAGEKFDF
VLIDSPPIGILTDATILSSIVDGIIVVVESGKTSKKVLARVCQIINESKTHVIGLLLNKISITPVNNYYSYYYGNSNNPP
KSKSIRDRFSSDMIIKRAGKWAKLLANKISSILKKSVSK
>gnl|bykdb|A0A1G1KQI3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPLOWO2_12_FULL_44_17] (length=590 residues).
MTTRPYLEQEESEAVNLRYYFDLIFRQRVPIVTFLIIIVTVAVLVVLKLPNNYQAVAELLFDNPEAVSAPERELATPNYG
QDHIATQLQILKGISVTEEAVKKTNYHEKVGMSMERAAGSALGALSTIQIKGTRIVRVVFQSEDPKIAAEMVNAICEGYI
KKNIENRLYFSQEIMKLLPAETQKTLKSQTPMGQLEELSQKELIESLPSVQADPTLRELKKKKTEIENELTALRQQYREQ
HPSIIQREANLKFIDESIQIETQKIVANLKSSISGRLQISNVRFIKRADPPMSPSGPDRKKLLLIVVLGYLFASSLIVIL
LDQFDDRIKGQEDIERYLHLPYLGHLPLIRKQDVKSNQERALYSHHKPDSEVAEAIRYIRVGINFSAPPEILRCLLVTSS
LPQEGKSFTAANLAVSMALDGNKVLLIDADSRRPVGHRIFQLRNEVGLINFLTSNISFESVIQPSGVNEHLFVMPSGPTS
PNPSELFASGRMKELVQLARTQYDRVVIDAPPLTGIGDGFVLGGVVGHLILIVMAGKTSRYAVSAIKHRLVDSNIKIVGV
ILNSLDVERERYGYYRYHYYTYQRYYGKKK
>gnl|bykdb|A0A1G1LHA8 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica bacterium RIFCSPLOWO2_12_FULL_50_11] (length=614 residues).
MVNVPESALGGMQFESERESDEVNLELLWRIFRTRSWFIFTVVAMVTVLASIYALRLPNVYTARTKLLVQKVDPSPLQNP
ELMKPTTAYGDTYYLTRIEVMKSRPILAPIAERLNLPEHYGVETTENAAQILRGNLDAHLVRNTEVIEVALSDRDPKMAA
RIADAVAEHFARETWREQLFISDQVLKWFPEEGKILEMNSPIGQLRRLENDPIASLPSVMQDPVIGGIEQKQMGVDEEMT
VLSARYTPEHPKMKELLTQAAYLQSEKKARIEKIISALKAGLTGDFTITNVKVIEPAAIPSRPSGPKRSIIVLASAAVSF
AGSLLLVVFLHHLDQNISSEEDVRKIPATFLGYLPLISGLNGRSKNGAKSNLLHRALSDSRLIDSITNMRAALLFSMPAE
RSKRIMCTSAIPEEGKTTVLGLLGISLAQIGERILLIDADMRNPSLHQVFGLKNECGLSNCLIGSSRARDVIQVVEGVPG
LHLMTAGARTPNPPVLLGSASIDRLIREIELDYHRIIFDVPPSLHIADGLILAGKVDGTVLVFRAGKVHQKIGRRMKEKI
DAAGGVIIGGVINRADFKRLDSTYSRYYRQYTKYYHRRDGSKTEELSRLEPVHQ
>gnl|bykdb|A0A1G1PGV5 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Omnitrophica WOR_2 bacterium RIFCSPHIGHO2_02_FULL_68_15] (length=706 residues).
MSPTLSEAVRQAKTLEWRFDDYVVFIRRHWLTIVLGGLLGWGAAAWWVSTIPNSYQAQTRLLIDRYSGEPVGFGETASMS
SARRDIEFLATEYQLIISRPVLEEVLRTMNLGGFPPFSISNDPAGVLSGLVSVVPVRGTKLVDIVVTSTNPTLAMRIANT
VAETYVQLNLERRQQQATGGAEWLQEEVVKTEGQMKAAQEALQGFKEKHQMVSLEDQQNVIVQRLQELSSAATEAKTARL
NAEAEWAEISRALSAGRPVDSLPIVRQSPRILTLEPQIAAKETELSDRQKIYGEKHPAIAQLTEELTALRKQREAEVGKV
VEDARLEYSAVQAKEQELQQALVEQERLALGLNRLKLDYENLNRQAQLSVDLYNSLSKRLKELEVVQSMQSNNVRIVDGA
KLPDGPIAPHRVRIVLQGLLLGLVVGGGLAFLQDLMTTTIRMRRDLEELVNLPFLGHVVRVPLPRGRRGGALFFSRHPDG
VAAESLRAVRTTLEFLLPERTTQRVLITSSLPQEGKTTVSSNLAVSLQELGRRVVIIDADMRRPTLFRTFQVPIEPGLST
YLQGQAALEEILQTPAHVQGVTVIASGATPPRPADLLASPKMGQLLEQLSASFQYILVDTPPVLAVADSTILSRVVDSAI
LIVRANRTTRENLSSTQRILTQSPLKFVATILNDIRPEYEYQYYRRGYSYYTKRPPSTPVPAQSPG
>gnl|bykdb|A0A1J4VP59 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG1_02_49_16] (length=585 residues).
MTLNDGIGNVPKMGLDGNQSTDLAKYWFVFLAHLRIIASATGVFFIISVFHFFSLPNIYTATTTILAEQTETPPSRQEML
KTTTSTDVDEYYGTQLAILRGLKIEKMVKAELGGDSEGYAISASHIRDTRILSLSVTHLKPELAAKIANKFAEIYVRESK
HENAFIGQQILQLLPGSPEAVLPGGSAVVSQGFSKQEFASSLNSVSGDPQVTQLLNEKLGIQSKLTELSQRYGPEHPAIK
DLNQRLSTVESDIKARSETILSNVKANLAGEANITNIKVLEEAPVPKNPSGPNRFRGILSWTLIGFCASASLISFFEYAN
QKVRTKNDVISLGICFLGYIPLVKEFLKGQKYHEFSEEPDLVRVLKANATLADAVANARTHILFSMPYEKSRRIMLTSAI
PDEGKSTVAALLAVSLTTLGRKILLVDGDLRKPSLHNYLGFRNDKGLTDYLVGAATIDEIIQPMRNNPLQLITAGSVSRN
PSELLASERFRELLDRCGERFDRIVIDVPPVLYIPDGLIVAKIVHTGILICGADMVNKETIQEVKEKFDSIGYSFIGAII
NRADFEREGYRYKYYGTYKSYYKPR
>gnl|bykdb|A0A1J4Z4I0 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG1_02_43_210] (length=615 residues).
MIPKSDLKELNFNDYLEIVGKHRWIVVTFFVAIVSFVAFFSFWVEPTYRATTVILIERQQPKVLSVEEVYGMGLADKEYY
ETQYKILRSRTLIKLIFDDMNLYLDPEFSDARDPISVFISRLTIDPVRNSRLVNLHFDGKDPQKITTIANTLAELYIKQD
AEIRTKASRDAVSWLMEQIVSVKKRLEESETALVKYMEQEKITESPEAGNKDNTVNLPETLKREQLRLEVEISEISRRYG
PKHPQMVKVLSELESVKSKLDIETQNLINLNRKAAQYTILKREVDSNRDIYETLVKRAKETGVSEQLEATNIRVVDPAEV
PDRPIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSARKEARTEDEIDLIVYQKPHSV
ISEAYRSIRTSILFAFAGKPSKTILMTSSSPQEGKTSASINLGITMANTSEKVLLVDADLRCSRLHKSFGIQKENGLSDY
LVGNITLDAAIKPTRIENLSLLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDRIIIDAPPILMVTDAAILANIVDGVIML
VRCGKIHIEIVSRTKQKLQDSKANILGVLLNNVDYGKESYYHYYYYSDEEKKKNV
>gnl|bykdb|A0A1V5SP48 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium ADurb.Bin277] (length=611 residues).
MPNVPEAQNPQIHRDTEMDFKKFFSAVRDRYIIIIILTTVILAGVLFYNSTLVPIYRATTQLMIEIPEFVGHDTKEAKSP
TIGSSDYFNSQYEILRSVSLARKIAEKLDLKALPEFQGKIPELALQEMITVKPVKNSRIVMLSVESSRPELAANIANALA
DIYIQQNIEGMMFMSKEILRVISGEHGLPEPGMPSDILPSAAERQKIIQMLPSVVNNPEILNLRKERSGIESQIAQLSKR
YKPKHPRMIALNTQLGSINEQIKARTDEVIASVKAELEGKLRPNNIRILDRAQTPKIPIDSPKIPNILKGILAGILLGLG
LIYLLEKIDTTVKTQEDVQQSLRLPFFGDFPFLKGGDKMMTGPESLLKLDSNIPASNAIREIRIGLNFLTIKNTPPKTFL
ITSSVPKEGKSLLAVYLAFSFAKSGANTLLIDADLRLPKLHYSMNVRQSPGFADLLRGTMSPDSVIVRTGIPDLSILTAG
QSNDNPSELFSRPNVPELFHQLSSQYDKIIIDSPPSLMIPDALLLARIVESTILVIRSGKLSANSIVKLKEKFDAIGAPL
TGFILNGSRLEKIQHYSSYYKSYYNKAHATKKKPAFKPKNKKPAIVPPAGS
>gnl|bykdb|A0A1W9RLH0 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium 4484_70.2] (length=628 residues).
MRGMIEEKEIGYSPSEEGIRDILNKIYKRRWFIFNFTFLCIVFTLFFSFKVKPVYRAKTRILIESKVPKIVQFEDVYLTD
YGNSDRYYNSQCEILKSNTIAKMVLDMLGDYKPWDIWHGRKKDATFTEEEKIKALLKNVKVKKAVRSQLVDILVEDTDPE
LAAKIANFWVGAYLNYIQQSRSSLTKYASTWLEKEIERAKKKVEEAELALQKYREENNIIDDPATTSEDTALLNKLIERK
AELETELAQQLNYFKEKHPIIKGLKAELNSINKKIEEERQRLLALKEKAIRYRILKREVETNKAIYESLLNRLKETKSIQ
NLRLTNIRVVDRATVPIKPVRPNKKMNFVLALFIGLFLSTGAALLIENLDLSIKEPDEVQKYLGLPLLGTIPLYKQKKDK
STHPALSIFTDSHSPALESYRTIKANLTLSNPDLAKKLLLITSSVPNEGKSVFSVGLARIMAQAGEKVLLVDVDFRHPNL
HEVFGVQRTHGLSDLLAEGIQDIHNYIKKTNVENLDLLTCGSLPPDPAELLGTKKMEELIQELSKRYDRIIFDAPPVLAV
TDALVLSTKVDGVIIIVRFEFTHRKALQRTKETLERVNAKILGAVLNMVNPRGGSYYYYYYYHYGKKG
>gnl|bykdb|A0A2H0LEC5 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_64_10] (length=614 residues).
MALIGEVDWKPEDYLHAAFSHKFTLFMITLVIGSYAYFREAQKPDIYQASTEIVIEQDDADLVQFQRGARYNANAGDQFL
RTEHMLIRGPEILQSVVKTLNLDAFPPFARSEYPADLLAGMVSVQPVRGTNLVNISVTGKKPDLVARISDAVAETYADRN
LQRRIEKTGGGTQWLQEELAWTEKKMRAAQLELQNFLEEHETVDFSTNRQNTIFQRISDLNRALTQVKQERIEAETRYRE
KHPILQELLKREAEMEAAFKQQEKKALEFTRLSIQYNVLQRNSETTEGIYDVLLKRLKELSVEGNLQANNIRIISRAKIP
KSPIGPNRQRGILVGIFLGLILGCGQAILREMLSKTLRNRREFEGTLQIPFLGALPDIHVGRAHKGKEKLFLIKQPQSTE
AESLRAIRTTAEFLLPAQQSSHVLIITSAIPEEGKSLVSLSLAISLAELERRVVFIDADMRRPTVHASVNLPLDPGLSGF
LEGKVDPGDLIQTSSEAPGLSVITAGSQPAQPTDLLISGKMKDLIHQLRDEFQYVILDTPPVLAVADTTALASLTDGIIY
VVRAGRTPRDVTLAGKTRLTDVGAKLIGGVLNGTQPEKRYVHYYYYQGARKARR
>gnl|bykdb|A0A2H0LL91 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_45_26] (length=613 residues).
MVSMDQPAVGYPNSPEEAESINLSYYLGLLYRHRVFLFTFFFISVTLVGIFLMKLPDQYRSTTQVLIESAPVSAGASEEL
EPTFQSYTYVDTQAEIIASIPILTVAAEKEDLANFFEVEDLREAVFVLKKKLRVRAVRGTQLINISIATPSAEKSAAIVN
SIAETYVKQSIQNRLFFSKEILNLLPEGGGKKTIEDLSPIGQLEKLEDIKFAATLPSVRSDPTILELKNQIAKAETDLFE
LKRQYREQHPDVMKVQANLKFLKESVDVQIKRVVHELKTALSKRLQVSDVRVVQAGEPALLPEGPKRLRLILLFIILELL
LSFGFVILIDYIDDRVKNQDDIERFVRLPYLGHTPVLRLEGEKNKSKGYFYVYANPQSDLAESLRYIRVGINFSAPPDML
RAFAITSSIPQEGKSFCSCNLASSFALDGNKVLLVDADNRRPVLHTVFNMDNDYGLINYLTSDVTLESITRKTDVPGLDF
IASGPESPNPSELLGSEKMAEFIQKAKSQYDRVIVDAPPLVGIGDGLVLGKLIGHLILIIRSHRISRKVIRQIRERLQQH
QIKVLGVILNHLDMEKDRYGYYRYHYHTYNRYYGKKAIKRKEKKERRHHKKAS
>gnl|bykdb|A0A2J0KU82 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15] (length=752 residues).
MEREPLYKFYKEWELKDYIEVIIRRKKILLTFLLSLVFIVSVYSYTATPIYQATTQILIERNEPQILNFQEVYAMPSAET
EYYQTQYRILKSRSLAEKIVEKLNLTASPRFQGGNPIDALLGMIIIEPVGKSRLVNINVQSDNPQFAATIANTIAEEYVK
KDIEDKLFTTKYAVGWLTDEMKKMKEKVEESEKKLQEYKETNELVSLEESQNIVVQKLAELNSKATQAKGKKLETENKYK
QVEENRDKPDTLPSVRDNALVQELKQVCATKEGTLSEMMKRYKEKHPKIIQLKSELKTLQERIDTEIGKVVDSIKGEYEE
AEANERTALLALTEQEKKALELNRMAIEYNVLKRDTETNREMYEALLKRMKETDISGGLQASNIRVIDKAEVPKGPIKPR
KSTNIIMAIFIGILSGAAAAFTLEYLDDSIRNQRDIEAYIQLPFLGHVPIVRTKGATVGLYANLYPRSEVSESLRSVKTN
INFTLTTPPPHALLLTSVAPQEGKTSLSSNLSIVMAQGGDRVLLVDADMRHPTVHKIFKTENSKGLRDYLSGAADFDSVV
QKSMVENLSIVASGRVPPNPVELLDSPRTKLFLKEAKAKFDRIIIDSPPIIAVSDALILAKLVDGVVYIVRGSKTSREAA
FEGKRRLLDIDAKILGIALNYIDIRKERYYYYGYYYGGQGKRRKTEEDEVGKIGSQTAVSESEGEAVKAEELTQSKQLTD
VEKIAKAEPSVENKSKRPAFLRKLKRKPQSLS
>gnl|bykdb|A0A2J0LAF9 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG02_land_8_20_14_3_00__42_8] (length=693 residues).
MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVTTITIATFMQKNVYRAAATVIVDAESPDVLSVKDIVKLGESNYF
AYKDYIETQQEIIRSRRTAHKVMKNLGLKDRTEFIRSKDPLETLLKKLRVELVRGTRILKINADDNDPVQACRIANEFAN
VYVDSNIALKMRTSNEAEDWLKKEVDKQKTKVREAEFMLQSYKEKNDIISIENKENIINDSLISMNASYLAAQKKRVSSE
TTYKSLVDGGGKLNLDRLPTILTDNDILKELKKEYLKQEALLVEYKKVYKDKHPKMARLFENMDYIKSRIKTEVENEYNY
AKEEEAKFKKMLETQKNELLALERKVIDYNALKRELETNERVLDIVLNRLKETSISSQVQTNNIRVQDLADVPKKPIKPR
KKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEIAGLLQIPVLGSVPRVRVDGISIKQETDIDRIVEKDSASLVAEAY
RSIRTSLLFSLEDSRSAKSIVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSRLHTIFNMDNQTGLSQFLMGE
KGLIDIINPTAVDNLYIVTSGKSTHKPAELLSSSNMKLFLEQAGGQFSKIIFDTPPVCLVTDAAILSSICTGTVLIAEGS
RATRELLKRSKEILGKVDARMLGVIVNNISMVRDGYYYPQYYYGRYYVPSRSK
>gnl|bykdb|A0A2J0LFS5 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG12_big_fil_rev_8_21_14_0_65_43_15] (length=590 residues).
MVTFFVAIVSFVAFFSFWVEPTYRATTVILIERQQPKVLSVEEVYGMGLADKEYYETQYKILRSRTLIKLIFDDMNLYLD
PEFSDARDPISVFISRLTIDPVRNSRLVNLHFDGKDPQKITTIANTLAELYIKQDAEIRTKASRDAVSWLMEQIVSVKKR
LEESETALVKYMEQEKITESPEAGNKDNTVNLPETLKREQLRLEVEISEISRRYGPKHPQMVKVLSELESVKSKLDIETQ
NLINLNRKAAQYTILKREVDSNRDIYETLVKRAKETGVSEQLEATNIRVVDPAEVPDRPIRPNKKNNIILACLVGLMLGV
STAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSARKEARTEDEIDLIVYQKPHSVISEAYRSIRTSILFAFAGKPSKTIL
MTSSSPQEGKTSAAINLGITMANTSEKVLFVDADLRCSRLHKSFGIQKENGLSDYLVGNITLDAAIKPTRIENLSLLTAG
STPPNPAELLHSGKMKAFLEDAIKKFDRIIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRTKQKLQDSKANI
LGVLLNNVDYGKESYYHYYYYSDEEKKKNV
>gnl|bykdb|A0A2J0LM30 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG12_big_fil_rev_8_21_14_0_65_42_8] (length=693 residues).
MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVATITIATFMQKNVYRAAATVIVDAESPDVLSVKDIVKLGESNYF
AYKDYIETQQEIIRSRRTAHKVMKNLGLKDRTEFIRSKDPLETLLKKLRVELVRGTRILKINADDNDPVQACRIANEFAN
VYVDSNIALKMRTSNEAEDWLKKEVDKQKTKVREAEFMLQSYKEKNDIISIENKENIINDSLISMNANYLAAQKKRVSSE
TTYKSLVDGGGKLNLDRLPTILTDNDILKELKKEYLEQEALLVEYKKVYKDKHPKMARLFENMDYIKSRIKTEVENEYNY
AKEEEAKFKKMLETQKNELLALERKVIDYNALKRELETNERVLDIVLNRLKETSISSQVQTNNIRVQDLADVPKKPIKPR
KKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEIAGLLQIPVLGSVPRVRVDGISIKQETDIDRIVEKDSASLVAEAY
RSIRTSLLFSLEDSRSAKSIVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSRLHTIFNMDNQTGLSQFLMGE
KGLIDIINPTAVDNLYIVTSGKSTHKPAELLSSSNMKLFLEQAGGQFSKIIFDTPPVCLVTDAAILSSICTGTVLIAEGS
RTTRELLKRSKEILGKVDARMLGVIVNNISMVRDGYYYPHYYYGRYYVPSRSK
>gnl|bykdb|A0A2J0LS24 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium CG_4_8_14_3_um_filter_43_15] (length=615 residues).
MIPKSDLKELNFNDYLEIAGKHRWIVVTFFVAIVSFVAFFSFWVEPTYRATTVILIERQQPKVLSVEEVYGMGLADKEYY
ETQYKILRSRTLIKLIFDDMNLYLDPEFSDARDPISVFISRLTIDPVRNSRLVNLHFDGKDPQKITTIANTLAELYIKQD
AEIRTKASRDAVSWLMEQIVSVKKRLEESETALVKYMEQEKITESPEAGNKDNTVNLPKTLKREQLRLEVEISEISRRYG
PKHPQMVKVLSELESVKSKLDIETQNLINLNRKAAQYTILKREVDSNRDIYETLVKRAKETGVSEQLEATNIRVVDPAEV
PDGPIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDVTNYIGLPFLGYVPSARKEARTEDEIDLIVYQKPHSV
ISEAYRSIRTSILFAFAGKPSKTILMTSSSPQEGKTSAAINLGITMANTSEKVLLVDADLRCSRLHKSFGIQKENGLSDY
LVGNITLDAAIKPTRIENLSLLTAGSTPPNPAELLHSGKMKAFLEDAIKKFDRIIIDAPPILMVTDAAILANIVDGVIML
VRCGKIHIEIVSRTKQKLQDSKANILGVLLNNVDYGKESYYHYYYYSDEEKKKNV
>gnl|bykdb|A0A351I6G3 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=707 residues).
MENTTFNKELHIKEYISVILRRKWTLIAFFLITVTAVTFATFKQHPIYRAVSTIIIDVAEPDILAVKDIIKLGETNYFAY
RAYIETQQEIIKSRNIAMQVINNLGLADKEEFKKEKDPVGHLLKKLKVELVKDTRIIKISIDDKDPRQAVLIVNKFAKVY
TDSNIASRINPSNEAETWLREEVDKQKLKVRESEFSLQAYKEKNNIVGSIEDKQNIINDALMKLNTVYLDAQRKRIQAES
AHKSSVDTEGNLRLENLSTLLSNNEVLQQLKKDYSKQQAILAEYKEVYKNKHPKMIALFETTNYLKSRIKSEELHIKAEE
TSRVTTKLETEDDYAAEEEGKLKKLLDERKEEALEVERKIIEYNALKRELETNKRILDIVLNRMKETAISSKIQTNNVRI
QDIAEEPKRPIKPKKTLNIALSIVLGIIGGLTLVFFREYMDTTIKNSNDIVTLLQLPVLGSVPRIKPDGKNIRNKIDADR
VVEKDSLCMASEAYRSIRTNLLFSLKDSGYSKSIAITSSVPKEGKTISAVNLAIMMADSGESVLLVDSDMRKPRVHTVFN
IDNVSGFSNYLAGQVDFDRIIKYTGINNLSVIPAGSISHKSAELISSKNAKLFLEKAGARFSKIIFDAPPVALVTDAAVL
SGLCDGVILIAEADRTTKDLLNNSKELLHKAGANIIGVILNNVSLTRNSYYYPQYYYGKYYKPLNAK
>gnl|bykdb|A0A3C0MWS5 [Bacteria] Bacterial tyrosine kinase [Candidatus Omnitrophica][Candidatus Omnitrophica bacterium] (length=544 residues).
MQAQEVSGTSEYPDILIRRRKTIILFFVLTLAAVGMGTVLMTPVYQAKAVLLIDVAGPDVVATTANVAMESQGASYYSYR
EYYRSQMAIVKSYPIIKQVFDEFGVGKSEKYAKAKDPMKEFLKTIDVQSVRDTRLMDVNVENEDPVIAAKMVNRIADLYI
RRNLDYISKSELLNLLKNEYLRLDARLAEYSKIYKEGHPEMIRVREEMADVVASINKEKETGLEGSKAVHDRYKEQLRGA
LAGLKANNVSVVEYAQDPIEPVKPNKLLNLLLAIVTGLFGGVGLALFFEYQDATIRSVEDIEKLTSWSFLGKVPVIPGSK
KEFSTHLKPEDFTSEAYKSIRTQLLLLDTKTHPLKTIVFSSIGPQEGKTLTVCNLAIAIAQSQKRVLLVDADMRRPRLHE
VLKVKDGKGLCSFLSEKAALEELVRKTDIENLYFVADPYSCANSTELLSAQKISDFLAFARKNFDYILLDSPPVGIVSDA
TLLSTLADGLVLVVESGKTPRKAIVRQRKALDGAGIKVAGVIINKAVISGSEGYYYSKSYHRMK
© 1998-2019