BYKdb

Dataset for cluster tadcd of phylum candidatus-poribacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2E9F5L9 [Bacteria] Bacterial tyrosine kinase [Candidatus Poribacteria][Candidatus Poribacteria bacterium] (length=743 residues).
MQNNTPXTAXXHDSDEIDLLALLGAXIDGKWIIAGFTVCFAVIGVAYALLATPIYQANAXIQIEEKSGSTLSGLGELSDM
LGSTPEAVTEIELLKSRAVIGQAVENLKLDIIVEPNYFPIIGRWMARRFEPETSDAVASPLLGFDSYAWGGENVDIFQLE
VPNSYLSEPLELVAGENSTYTLYNEDGDVLLQGTVGEQASKDGFTMQIKTLTARPETRFDVTKQRKLNTIIGYQHQLGAS
ERGKDSGIISLSMQHEEPQYAIEVLDEVSRLYVRQNVERNSAEAAQSLEFLKEQLPQVRKELERYEQALNEYQTSTKSVD
ITIETQAILDQIVELDTLISEQNLKRAEMERRFTRQHPSYQALLDQMQQLQRQKSELTSKVESLPATQQELLRLTRDVAV
TTEVYTAMLNSTQELDVLRAGTVGNVRVIDTADVNVEEPVQPKKALIAIIATLLGGFAGVALVLLRKALNRGVEDPEVIE
QLGLPVYATIPFSRDQEVVEGGVKSRRPAGHHAASGLLAVSNPADLAIEALRSLRTSLHFARLEAKNNILMISGPSPGVG
KSFVSANLGAIMAQAGQRVLLIDADMRKGYLNKLFKLPAENGLSELLATRITSNDAIYKTEVDGLHIVPRGQIPPNPSEL
LMHANFTSFLDNVKDEYDIVIVDTPPILAVTDAAIVGRQVGMSLIVTRFAVNAAREIEVAMRRFEHNDIQLKGAIFNAVE
KKASAYGYRNYGYYNYEYKSDQK
© 1998-2019