BYKdb

Dataset for cluster orphancd of phylum candidatus-raymondbacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A1F7F7S3 [Bacteria] Bacterial tyrosine kinase [Candidatus Raymondbacteria][Candidatus Raymondbacteria bacterium RIFOXYD12_FULL_49_13] (length=784 residues).
MQTPSVDPSRSAGLPEIVRHYAELFRRKKWLLLIMCLIATGLAGYCIIAFDLLKHAQPATVLIGIDRPLVGNGTIGQESM
GPKKIELIRSRALLQRVVADLSLCLRLEKGMREEFFDSIALGPTAVYGTYRVRWDPASKQALTVYLSKAPPVYRGEAVFR
SDLSKSAILEIPGTFLRLNERFIRNPGTFTFSIVSTRRATDNILDNMTIEGPTSRKENYFTITLSGRDYALTTKIVNAIA
DLFVLQNLSFEKRRVHERIETLGKQLELARKQLATSDYALRDFLTANPASALDKQAERTLGSLVQQESRGLELESFLNDA
ATLQKEFALAPGEGRIDIVREILILLSSKNVIRASVLQSELSRLLLEKDALERTYSKGHPLVQANQQKIDGLALQASQAL
NDFYQDISRKVSEKKDNISQLSTRLRSLPQKGMQLAELQRVQQINSESYSMLMSRFNEAKVEDAVEVSDAFVMDYAVEPL
PMPPMQKLLITLVLSLLAGLITSIAPIVFFDQYRRTAFSEIDLFKLIDIPILESIPVLRPAPQAQRTARERREAAGKPKP
SPLLITEGVLPVYAKEVFRSLRTKILLSFLGINQRSILITSLDSGAGKTIVAANHGITLAQHGLKTLIVDSDLRRGTLHS
VFGLKQSPGLSEYLGDNSEGPLPESIQHTAISGLDVMASGQLVSDVSELITPFRMGQFLTTAFLLYDAVVIDTPPLGVVA
DAAVIHEKFSKCMIVVKAGVTDINDLNEKLKEYPPIRNKIVGIVLNQARRDQRFKYYRSSPYIS
>gnl|bykdb|A0A1F7F7U0 [Bacteria] Bacterial tyrosine kinase [Candidatus Raymondbacteria][Candidatus Raymondbacteria bacterium RIFOXYD12_FULL_49_13] (length=716 residues).
MEHAGKTFNLKDYVTIVLRRKWSLLVIVLAVVAPLIFYVRTMPDTYFAQSQLVIEDLRNTNPMTPQMLRPSRSFDFYQGI
FNSRSFIQAVLQKVGRDTLAKAAGDTVEDKLAAYIASSISLSRGGFESFIVLSARASHAGMAFNLAQSATEIFKLKCREV
VAEEAENTVKETEKQLAIIRDKLEEAEHAYRQYLDKTGNSFDGATTELKLLQDKYYEIRSEWASKEAIYEANRQSLAMLE
RKVAPANTDPKNAEQYNKAKEELRKKEKEKKRLESLGLVLGPSSPINQDIDQLEKEVMRYGAKEERLDAKVVGQWQKMRT
VVAENEMELDLVNNKMKVYQRKIEQYKKSHPDELDQSLEVSRLERSRKVYEDTYNILLEQVEVAKIKKASETGGVTVVDA
VYYPTSAVPRKEAIYYVVGIMVALMLGFGYIFLREFLDTTVKSNDDLEAYNIPIIGTIPHIDIAKSEEIEIRRRSSSSSS
KEAVTTYPKELINFYKDESIVAESYRSLRTNLFFTSPDNPLHTLIVTSSGPHEGKSLTASNLCLACAQMGKRTLLIDSDL
RRPVVHHLFQQPRENGFTDLFIGNSLKSVVRETGLDNLHVITAGRFTPNPSELLASKKIEKLIGELKLEYDLIVFDTPPV
MAVTDAPLLSTKVDGTLLVVKSYSTDRVILERAINTIQNVNANILGFVLNDIDLSHRYASYGYYKYYYHYYRSKKD
© 1998-2019