BYKdb

Dataset for cluster orphancd of phylum candidatus-rokubacteria

[Download (right click)] [Alignment] [Repertoires]

53 sequence(s)

>gnl|bykdb|A0A1F7NCG6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPHIGHO2_02_FULL_73_26] (length=246 residues).
MARRAKPAGTVTAVSALVAHADPKSPAAEAYRTLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVL
VVDSDLRRPTLHRIFGLGNARGLSTALLEGLPFADVAQATAIPNLFVLTSGPLPPNPAELVGAMRMRECLEAATTDFDLV
LLDSPPIVSVSDALALSAITDGVVLVIRVGKIPHDVVRRAVVQIESVKGRILGVLMNSVNMKREGYYYDYYRYYHAYYSP
ADGRRR
>gnl|bykdb|A0A1F7NSZ2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_72_37] (length=245 residues).
MAKRGKAAAPSTAAPLVAHADPKSPAAEAYRSLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVLV
VDSDLRRPTLHRIFGLGNARGLSTALLEEQPFADVAQATAIPNLSVLTSGPLPPNPAELVGSLRMRECLEAAAGDFALVL
LDSPPIVSVADALALSAVADGVVLVVRAGKIPHEVVRRAVVQIESVKGRILGVLMNSVNLKRDGYYYDYYRYYHSYYSPT
ESRRR
>gnl|bykdb|A0A1F7PJN6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_71_22] (length=245 residues).
MAKRGKAAAPSTAAPLVAHADPKSPAAEAYRSLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVLV
VDSDLRRPTLHRIFGLGNARGLSTALLEEQPFADVAQATAIPNLSVLTSGPLPPNPAELVGSLRMRECLEAAAGDFALVL
LDSPPIVSVADALALSAVADGVVLVVRAGKIPHEVVRRAVVQIESVKGRILGVLMNSVNLKRDGYYYDYYRYYHSYYSPT
ESRRR
>gnl|bykdb|A0A1F7Q5I6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RIFCSPLOWO2_12_FULL_73_47] (length=246 residues).
MARRAKPAGTVTAVSALVAHADPKSPAAEAYRTLRTSIQFAGLDHKCRTVVVTSSSPGEGKSTTVANFGVVSAQAGSRVL
VVDSDLRRPTLHRIFGLGNARGLSTALLEGLPFADVAQATAIPNLFVLTSGPLPPNPAELVGAMRMRECLEAATTDFDLV
LLDSPPIVSVSDALALSAITDGVVLVIRVGKIPHDVVRRAVVQIESVKGRILGVLMNSVNMKREGYYYDYYRYYHAYYSP
ADGRRR
>gnl|bykdb|A0A1Q6YM61 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_2_20CM_2_64_8] (length=570 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPEVEVEIDAEVEPEMPVDVESEIHDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEP
EIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTP
NSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNP
KGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGV
DGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNASGNGT
GYLSGNGITH
>gnl|bykdb|A0A1Q7G9Y1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5] (length=820 residues).
MVRGRTRGGGTSLGYRLPPGGETPPGEEWRGYFGSIKRRKRLVILVTLAGTALGVVATKLVAPYLPFYSATANIWIDGSG
HRPDRDQATAGPIHSGQLLGASGWVNLARSYVVLDSVARGLRLYVGWEAEQDSAALWSLGLKTQFRSGEYRLEVDSSGRR
FRLLTAKGAELQRGMVGDSIGGAVGFVWVPPASALTPRRTIRFTVSSPYDAATNLAQRLQVELDPDGNFMQVSLRGSDPA
YIAATVNAVATRFVDVATDLKRKRLGELTKILAAQLEHAQANLRSAETALRSFQVRTATVLPGSAIIPPEALAPGANAPP
PRRPPVSDLVGQSRDPVFANFLDIRVALDQLKHDRAAIERVLAQSADSGLAVDALELVGSVERSSELTDALKELVGKRAD
LRALRYRYTETNPEVRRVAGTIGTLERQTIPALSRQLVEELRTREAELARQVESASADLRHLPSLAIDELRLQRDVVDAE
QLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDAAPFLFLLSVVGSLGAGVLAAVLRDRVDPKLRYPAHVTQEM
GLPILGAVPHLPAANGKGGRKLSGNGVGTAAPVIEALRGIRLSLVHAHGTAGPLLVTITSPGSGEGKSFVAANMALAFAD
AGHSTLLIDGDIRRGQLHRVLNAARTPGLTNWLTAGPAPEAIVQATPYPRLSFIGCGARTPFGPELLGSAEMARLFAALR
PRYEVILVDSPPLSVGVDPYILGTLTGNLVLVLRSGVTNRELAGAKLDAVDRLPIRLLGAVLNDIRPDGAYRHYSYFPEG
YELREEEPAGQRKRILMAAG
>gnl|bykdb|A0A1Q7IM35 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_4_67_11] (length=570 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPEVEVEIDAEVEPEMPVDVESEIHDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEP
EIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTP
NSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNP
KGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGV
DGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNASGNGT
GYLSGNGITH
>gnl|bykdb|A0A1Q7NS62 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_2_68_13] (length=305 residues).
MSLIEPASFEAEQYRALRQLVERLHKSTALSIVAVSSPTVADGKTTTSINLAGALAQAPDARVLLVDADLRGAALAPRLG
FDEYVGPGLVDAIVDVNLTLPAVVHALPSLNLSVVPAGRFPSAPYEVLKSPRFGELLAEARKRYDYIILDTPPLVSVPDC
RVIEKWVDGFLIVVTAHRTARKLLEEALNVTERARIVGLVFNGDDRHLSRDSYGAYDSRQSARRNGGGWRRRVFGNRDRI
RRSVTAGRRRAPGFIGRAAEKIHWSRTRERDGDQRGRSLARDRHGVGDAALARPLDPQQLRAARL
>gnl|bykdb|A0A1Q7TX95 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9] (length=751 residues).
MVEELSGPHVGYLGLLRRIASHWRLSLIVCVGVAAPVAVWALLFLPKSYEAVAAIFIEDPRRGSVSTLRDWMPAGDASYQ
QAVLRSRSLAAAVVDNLPQDSMNELIRHAMHRDYVLAGQNLIRRLLGHEPVVFSPQQRAVRELLTARVRFESLPSGEVEI
RAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATRQFIENLLAQTKANLQEAEESLAKHQRGGTLKLPERSSVEMAQL
AQLESNLADIQASEEIAKRRLAGLKGGKDSAGMPGRAARQALSERLAALEAKLATLEEKYASEHPLVKSTQAEINELKTA
LAAPPSISPGGRSAIRLTLGPADQAAVAKQVADAEVELASLQNREDVLKQSIARLSSRLSALGAEEWETSKVLRRVETHR
SLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFGLGVGVAGVIEYFNQPIETEDDVFDAT
GLPVLGWLPTIAGHQPTTGVEREPLNLVNGSIPDTLPVEGCRSIRTSLESLNGSRKLQSIMLASAGPKEGKSTIVLNLAW
VFWELGRRLILIDADLRRPSLHRGLRCPPQPGLADMLTGNVPWPRAGQGIREGFVFLPAGSTGTAKPGVLLTVAKLRGAL
ELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVSPRETRRYYGR
YGDYYGSRDGNIEPWWQRCRFWANKRTGVLR
>gnl|bykdb|A0A1Q7UA97 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9] (length=570 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPEVEVEIDAEVEPEMPVDVESEIHDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEIHADVEP
EIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTP
NSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNP
KGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGV
DGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNASGNGT
GYLSGNGITH
>gnl|bykdb|A0A2V6PDA4 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=245 residues).
MSLLDPISFAAEQYRTLRHIVEQPHRAEPLSVLAVSAPTIGDGKTTTAINLAGAFAQAADVRVLLVDADLRRPTVSSRLA
LDDSGPGLVDAILDPALGLGDVVRPRPPFNLWVLPAGPRTDSPYELLKSPRLAALLHEARQQYDYVILDTPPLVPVPDCR
IIGKYVDGFLLVVAAHKTRAKLLDEALGVLGSSKILGLVFNGGDVTDSGYYYAGRYGARRGGDDPEDAFRPWYRGGQPLD
RLLRR
>gnl|bykdb|A0A2V6Q732 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=268 residues).
MSRHRVATLDECLVSLVAPHSYEAEQYRGLRHLVEQAHRTSALSVLAVSSASVGDGKTTTAINLAGALAQASDARVLLMD
VDLRRPAIAERLGVEEGRHGLVDAILSHDLKLADVARPCGPLNLAVVTAGVFSDIPYELLRSPRLGDLLEQARRDYDYVV
LDTPPLVPIPDARVISKWVDSFLLVVRANTTPRSLLEESLNLMDPPKVLGLVFNNDERPRTTYHDYYAGSGRHNKGGAPW
WRPFAKIRSVFDPDAAGRRRAERRREIR
>gnl|bykdb|A0A2V6RAF2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=613 residues).
MTELQSARVTFTPLPSGEVEIRAVAYAPRVAMDLANTYVEVLQTRSRSNIRDEARTSREFIETLLNQTKTSLQQSEEQLA
KVARGRSLRMPERNAIEAAQLSQLENSLAEIQGSKEIAKVRLAQLKGKDASGRPVPQAAQQQVTRRLLQLQEKLAGLRER
YTDGHPLVKATQAEIKDAQDMLTAGPQGLPERVAAPQFGAAERAASAKQIADLEQEVSALETREEVLKQRLARTSQGLSN
LGAEELEVAKLRQSVESQRNLVTTLSEKLGTVRIQEQGEDRGLRLIDLAALPQRPSSVPAMRVILLGMVGGLGLGIGLAG
LLEYFKQPMETEEDITAATGLPVLGWLPTIQGSGRPDKGPEREPMSFIDVFAPNTLPIEACRSIRVSLLSMYRAEDVRTI
MLASAGPGEGKSTVALNLSYVFSQAGRRLLMVDGDLRRPSLNRPLRLPVKPGLVDVLASHLPLAAALQPIKDGLQLLAAG
TTDGADPGVLLSADNISRLFDLAKGHADLVVFDSAPVLAVADNLALASMVDAVILVVRAGVTQRRDLVRAKAMLDKVRAP
VVGAVLNRVSSRETRRYYRSYSGYYGVGEGTSVRRRFRSAQSWWPIRRSEKVG
>gnl|bykdb|A0A2V6RB03 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=393 residues).
MGTTVKPDVVETTVLAAAPQDATSRAGQDAARRGGIVLPRAPGSVDPQVERSRGRRPRTTIAHRLQDERPSNEVFCHLSR
EGSPVSKFLKALERAEQQRALGRHPAPSEAASERGLAVPETAPPRPPRASHELAREVPNGLEEHLVSLLAPRSFEAEQYR
TLRHLIEQLHKSTGLSVVAISSPGVADGKTTTAINLAGALAQASDARVLLVDVDLRGGALAARLGIDERAGRGLVDAILN
AELTLEAVVEVRPDLNLTILPAGRLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLVSFPDCRVIEKCVDGFLIAVA
AHKTSRKLLEEALNVTERAKIVGFVFNGDDRHLSRDSYGTYASTRSVDLGGGGWRRLVSSSSRTHRRQTASDH
>gnl|bykdb|A0A2V6SBN9 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=264 residues).
MEPAAPRHLGRPVIEPPAPVTKPRVDRPNRAEDHLVSLFDSESWEAEQYRVLRHAVETLRKGVNLQIVAVTSAAVGDGKT
TTAINLAGALAQSADARVLLVDVDLRRPAVARHLGLGGSKGSLVGALLDSGLTLEAAVERLANSNLSVLPAGRATVAPYE
LLKSPRLEALFEEMRQHYDYVVLDTPPFLPVPDCRLIEKCIDGFLLVVAAHRTPRGAVAETLNLMDPAKVVGAVFNGDDA
RRSNYYDVYARPSAARWRRAWSKP
>gnl|bykdb|A0A2V6SIE8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=615 residues).
AYYGTQFELLSSRPVLGRVEAALGLPKHPAFAAGGWFGRAGQSSSFEGLDRYIEVTPVKRSRLVRITARVPDADLAAAIP
NRVATEYIGMLSQERREASDAAAKWLESQLGGLRSGSEATGGAVQRFVEQNDMVPSQDGKEFALTQLEDLNRAYTEAEND
RLQKEARARMLTSADPATAGAALGSDLVRGLQAEEARLEREVARAGTTYGPQHPKMVELQADLANAKKRVETEIGKGRSA
VQEEARAAARRAEEVGRRLDAQRQRAITQHVRQMQLTLLKKEADVGATVYADLMKRLKEVQLAAQMRMANVKVVDPAEKP
RGRSSPNHPRDLLMGLVGGLLGGVALAFVREVADKTLRTPRDVDLLVRLPSIGAVPTIPGYRRRTLPPVAELPGVSLPGE
APAWPEQMAEEAFRSIRTLVFHRQAPGTPRTMLVTSAEPGEGKSFVAVNLAVALAGTGEPVLLIDADFRRPSCHQVFDLN
LPKVGLSSILYRDQPWDGSIVATSVPNLAFLPAGPMPPDPAALLSSERARELLAALRERYAWIIVDSPPVLAASDACALA
RQVEGVLLVVRANATPIEAAQLVRDRLERLGANVVGVVLNDVRPTRDRYFYANYG
>gnl|bykdb|A0A2V6SIM1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=300 residues).
MSQFWEALEQAKRDRALQAPQSLPVPAPPEPKGDSALRLVAEAPVEPLHRVDDHLVSLLAPASFAAEQYRALRFVIEQTH
RESAVSVVGVSSPSVGDGKTTTAINLAGALSQASDARVLLLDLDVRRPQIGRRLGLDPNQPGLVDAIVDPRLDLADIARA
VRPFNFAVVLGGQSAKATYELFKAARLRTLLEEARESYDYVVIDAPPLLPMPDCQLIGGFVDKFIVVLACDKTPRRALAE
ALNVLAADKVLGLVFNRSDQLLSDYRREDYGEKVRGARWRWAAKRIQPFNGAKTRSSDIR
>gnl|bykdb|A0A2V6SK79 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=244 residues).
MRRPRQPQAGSGTPTALVTETAPKSAAAEAYRTLRTNIQFAGLDRPCKTIVITSATPGEGKTTTAANFAAVCAQSGSRVL
LVDGDLRKPTLHRIFGLDNQRGLTTTMIEGKSLADVAIPTRVPNLSVVVSGPLPPNHAELAASRRMHDLMEAATRVFDLI
VIDTPPVLSVSDAVALAAQMDGVILVVRGGKTSAEAARRAAEQIDAVKGRILGVLLNRVDARNSGYYADHGRYYDAYYGS
DHKG
>gnl|bykdb|A0A2V6T785 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=381 residues).
MVSKFFKALEQAERDRVEREGQGTKSPLAEPPAAPDASSARPSDTPHPVVAPETAASVAIPGPPVDVGDIGRSPTVEHAR
VPAPRAADAPAARPSVRASRVGREAGAPTAAAPNIVDAAARAHASVDEHLVSLLLPATFEAEQYRALRHVIEHQRAATGL
TVVAVTSPAVGDGKTTTAINLAGALAQAQGGRVLLVDADLRRPSIAEHLGLAGPHRPDLPGLVDALVGGPVRFEEIGQTY
EEFNLTVVTAGGVPHAPYEVLQSPRFAAILEDARQRYDYVILDTPPLVAVPDSRVIMKVVDGVLLVVSAHQTPRRLLEEA
LGLVDPAKLLGLVFNQDDRPLSGYYRGYRGYRTYGAAPTNGHEASRWNRLVRRGRRIENGG
>gnl|bykdb|A0A2V6TVU3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=305 residues).
MSKFFEALERSETEVALRTRASSPRSTEDLAASPAPEAPSVEVLPAAPRGFPRPVFEAPSTAINRVVGRSNRVETHLVSL
LDPRSYEAEQYRVLRYVVETLRKGNNLQVVAVTSPGVGDGKTTTAINLAGALAQSVDARVLLVDIDIRRPAVARQLGLAT
KRSLVATLLDARLTLKDTVEHVAHFNLWVAPAGGPAGAPYEVLKSPRLEALLGEARECYDYIVLDTPPCVPVPDCRVIAK
YVDGFFLVVKAHQTPRGELARALDLMDPQKVAGLVFNDDRVRRSSYYDVYAGPPRSPRRRLWRRP
>gnl|bykdb|A0A2V6U1W4 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=602 residues).
MPPPPAPEETEDLALASPLTSAVLSRLSIEPVRSSRLVRISFESHFPDLAARVPNALADAFIAQQLDQKVEATRYATQFL
ATQLDETRDRLGEAEGKLNRFLKANNILFIAGGDKTSQAQDLITQQLTLLSDGWLKARSERIAKESLLAQGNTQDVGTLP
AVLQNSLVSKLREDLAALESEYEKLSQVFKPGYPHMRQLAEKIAESRRQLRTEIDRAAQALQADYQAALRNEQELEGALA
QQRLQAGGLADNMAKYNLLRREVDTSRDLYSSLLGRLRETQISAALFTSNISIVDRAEISGIPSRPKRTTNLLVGCIAGL
LGGVVLALVFEYLDTNINIKDAKDVESVLRVPILGMVPSWALRRRREPADGLPFALAAQSETASDFAEAFRNLRTSLLYS
SPDHPPKTILVTSLQPEDGKTSLATNLAISLVQVGAVEVLMIDADMRRPNLHNVLSVPQAPGLSTFLTGQAELADVIVPT
SVRNLSIIPSGRIPLNPAELLTSTRLPQALEGLGGRFAHIVVDTGPIFGVSDAMIVAAQVEGVVLVLRHGRASRDAAQRA
IRNLMSVGAKLLGVILNDVDVRAEGYYGYYSNYGYEAEKETA
>gnl|bykdb|A0A2V6U3P1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=207 residues).
MQFAGLDRPCKTIVITSATPGEGKTTTAANFAAVCAQSGSRVLLVDGDLRKPTLHRIFGLDNQRGLTTTMIEGKSLADVA
IPTRVPNLSVVVSGPLPPNHAELAASRRMHDLMEAATRVFDLIVIDTPPVLSVSDAVALAAQMDGVILVVRGGKTSAEAA
RRAAEQIDAVKGRILGGLLNRVDARNSGYYADHGRYYDAYYGSDHKG
>gnl|bykdb|A0A2V6V7G3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=286 residues).
MRAADAPAFTESVPTVKDDDAESVDDRLVTLLTPNSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLA
GALAQARETKVLLIDMDLRRPAVNGQLGLRGFNPKGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRL
HQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLIIVNAHKTPTRLLSETVNVLGQSKVLGLIFNRDDQPIAEHLY
NSYGPDPSGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLSGNGITH
>gnl|bykdb|A0A2V6VAA8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=746 residues).
MDAKTTGSIDYLRLVRRVVVHRWRIIVAGFLAVVVPTVAVVSLSTENLYEASATLFLLPEKSDPPFLREFTSPEATAVYV
VLLRSRSLAQAIIEALPKESREELTKRVLFRDYLLTATNSLRRLTGGEVVVYSPTELALRELQEARMNFTIARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLESLMTQAKMSQGEAEDAMRRFQAKTGGRIKLPEESKSDLTA
LAQLESQLGDLQVTREVAENKLTYLKGEKSRPGSPTASADSSTQGLQERLTQLEAKLAALAEKYTDQHPSVQTARAEIQE
TQERLASALRPRQAPKPGGASASLKPIEAAQLSKQMAALQVEIVSLQAREEVLQQRAARLRRSLSAMGAREQEYSGFMRT
VLTQAKLTDMISDKLTAARISEQSQIRSIHVIDLASLPRQPSPKQPLTLLFMGVLGGLALGVGAATAREWVLQVVETERE
VTRATGLPVLGSIPVADRPGSSEKGAAPADDLPVLFVAGNDLHSLPADACRAIRTALDCQGLDRPLKTLLVTSPGAHEGK
STVLLNLGRAFLETDRRLLLIDADLRRPSLHRALRTPNEIGLADVLRAGTVWPEAFRPLAPGMDFMPSGIKPANPSSLIA
SKHMLRVLELARERADVVLIDAPPVLAVADCLPLCRYVDGVILVARFGATRRRSLIRAKEQLERVGAHVVGVVINGLSRH
ETRHYYSEYTHYVGIQKRKRKGKRRK
>gnl|bykdb|A0A2V6VPM0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=370 residues).
MGAEEWETSKVLRRVETHRSLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGLGLGVGVAG
VIEYFNQPIETEDDVFDATGLPVLGWLPTIAGHQPTTGVEREPLNFVNGSIPDTLPVEGCRSIRTSLESLNGSRKLQSIM
LASAGPKEGKSTIALNLAWVFWELGRRLILIDADLRRPSLHRGLRCPPQPGLADMLTGNVPWPRAGQGIREGFVFLPAGS
TGTAKPGVLLTVAKLRGVLELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASL
LGVVLNQVSPRQTRRYYGRYGDYYGSRDGTIEPWWQRCRFWANKRTGVLR
>gnl|bykdb|A0A2V6W355 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=288 residues).
MSKFFEALQRAERSATPSVPAPASAEPPPMMEPRLPPPALAPRPAVAASLRSASVELHLVSLLEPASFEAEEYRVLRHAV
ETLHKDAHLQIVSVTSPGMGDGKTTTAINLAGALAQSTDARVLLVDIDLRRPAVARHLGLAHSKRCLLDALLDPGVKLED
TVEHIARFNLSVLPAGGPEAVPYEILTSPRLEELLNEARRRYDFVVLDAPPFVPVPDCRLLTKCVDGFVVVVATHRTPRG
MLAETLNLIDPAKLAGLVFNGDVAPRSSYYRVAEPTPVARWRRPWRSP
>gnl|bykdb|A0A2V6X2Y0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=304 residues).
MSRFFKALEQAEHEQALRRQTAPVEPAPAPRVERAPVPSSAGTWPPPQRPVSAARASAPAFSSELDEHLVSVLAPTSFEA
EQYRALRHRIEQLHKTTDLAIVAVSSPSVADGKTTTAINLAGALAQAPDARVLLIDADLREGSLARRLGLDVNMRPGLVE
AILDPNLTLDAVAHADHNLNLSVLTGGRLPSAPYEVLKAPRVGELLGEARRRYDYIVLDTPPLVSVPDCRVIGRWVDGFL
IVVTAHKTSRKLLEEALHVTEPAKILGLVFNGDDRHVSRGYSYGGGRRSQTYGRARRRQTASDD
>gnl|bykdb|A0A2V6XML6 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=307 residues).
MSKFFEALERAETEQVLETPAPSPPPTVDPSASAAPAAPSAEVPPTPSVRFPPPVREARAPTTERAVDRSHRVGAHLVSL
LDPRSFEAEQYRMLRHVVETLRKGAILHVVAVTSPGAGDGKTTTAINLAGALAQSADARVLLVDLDIRRPAVARQLRLSG
ARRSLVDALRDPGLTLEDTVEHLAHFNLSVLPASRPAVEPYELLKSPRLEALLDEARRRYEYVVLDTPPFVPVPDGRIIA
KYVDGFLIVVKAHRTPRGALAQTLDLVDPAKVTGLVFNGDNTRRSGYYDGYVASPRGARWRLPWSKP
>gnl|bykdb|A0A2V6YDI1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=291 residues).
MSKFFKALEQAERERAVRRQTATSEPANGQGPAVAEPIAYQAPRVSRGLAKGVSNGFEEPLVSLLAPTSFEAEQYRVLRH
VVETLRKDANLQVVAVSSPGVGDGKTTTSINLAGSLAQAADARVLLVDLDIRRPAVARQLGLAGSKRSLVDALLDSSLTL
EDVVEHLAQVNLSVVPAGGPARAPYELLQSPRLDALVDEARQRYDYVVLDTPPITPVPDCRLIAKCVDGFLVVVAAHRTP
RGGLAESLAMMDPAKVVGLVFNGDTRRRRGYYDVYAGAPERAGWRRAWRRP
>gnl|bykdb|A0A2V6YDI2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=309 residues).
MSKFFEALERAEREADRPTPASSPRPEAGPSGSPPPAAPPAASPPPAAPEPVAPSVFKAPATATRPPVDRASRIGEHLVS
LLNPASFEAEQYRVLRHLVETLRKGANLQVVAVTSPGVGDGKTTTAINLAGSLAQAADARVLLVDMDLRRPAVAGQLGLS
GGKRGLAEALLADSGLSLEDTVETLAHFNLSVLPAGRATVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRV
ITKSVDGFLVVVTVHRTPWGVLTEALDLIDPAKVVGLVVNGDDTRRSSYYDVYAGSSRGARGRGAWSRA
>gnl|bykdb|A0A2V6YHI8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=1105 residues).
MDQPKSSEYVRLLRRVATNRWRLVLAGFLAVALPTIVWAVFLTPDTYEATATLFLLPEKSDPGFLREFATLEVNTLYQVI
LRSRSLAQGVVETLPKESRDELSRRIGFQDHALIVMNQIRRWQGQEVVVYSPTELATRELRESRMNFNIAKDGTVTLTAT
AFSPRVAADLANTYVEVLLSRSSSFARQQARGTRELLESLFTQARTGQVDAQDALRKFQSQTGAAVKLPDEARVDLQRLT
QLETSLSDVQVSREIAENRLNYLKGDRKSGPPTGDASVQPVRERVAQLEARLDGLKEKYTEQHPLVQVARADLQEAQERL
KSTVQGQQTPRPGGVVALKPLEAAQLSKQMADLEVEIISLQSRENGLQARIARLKKSMATMGAREQEYAGLARMAETQAK
LTGLLADKVTAARISEQAQVRGIHVIDLAEQPRQPSSKRPLKFLLFGLLGGLGLGVATAVLREYASRVIETEQEVVAASG
LPVLGSIPIARPLTGAPAGTKTTPMIFVSTHDPHSLQADSCRAIRTAIDCHSLGLEHPIKTLLVTSPTAHDGKSTVLLNL
ALAFVESGRRVLVIDADLRRSSLHRAVGVPNERGLVDMLQKGVAWPEGFRGVATGFDFLPSGIKAANPGALLSSRHMAEL
LDQARERADLVLIDSPPVLAVSDCLPLCTKVDGVLLVTRFGTTQRRSLIRAKAMLEKVGAHIVGVVVNGLSPRETRRYYA
EYNHYVGSGKSRRTRRRKSMKSFFSGLLIVLSVLGSGITARAAEDEYRIGADDVLHIIVWDNKELEQTVVVRPDGKISYP
LAGEIQAQDLTVPQLTEELTKRLSTAVKNPNVSVMVQEIKSYRVHFVGKVVKPGVYPIKAGTPLLQALTLAGGTSENADL
TAAYIIRGNKTLPVDLRKLVQQADLSKNVRLERDDTIVVPEIALGSSLQEMQDRRIYVLGKVTKPGVYNLKEDVPILHAL
FLAGGVVEGGDLASAFIIRGKEKIPVDLWKLIQKGDVSQNVMVKHEDTIVIPAGGELQNAVYIMGEVLKPGVYSQPEALS
LLKLVSLAGGFTKYAAPGRATLVRRDGDKKVLLKVDLKDIMNDPKKYEDLALRPGDVLIVPERLF
>gnl|bykdb|A0A2V6YK84 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=310 residues).
MSKFFKALEQAERDHAQREPVIPAEASSERASVVPHWPEPAAEQPPVFTPPPPRAPRAVIESRVPVDSPRIAPALLDEHL
VSLQAPATPAAEQYRVLRHLVETLRKRANLQVIAVTSGGVGDGKTVTSINLAGALAQSEDARVLLIDMDLRRPSIARYLA
LGATRPTLADALEASGPELKDAVVRIPRFNLSVLRAPVSTAAPYEVLRSPKLEALLAEARRQYDYVVIDTPPFVPFPDCR
LIAKSVDGFVLVVASNRTPRGVLAEALKAMDSEKAVGYVFNAHPWTPTSYYEDGNGHGRTRSWHRKGENS
>gnl|bykdb|A0A2V6ZH60 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=326 residues).
MSRFFKALERAEQERALRVVASPPPAPPSETSPTVPETVPPRPSPAAPKTTPPRAQETFFRPPRAAATAGRAERIIGVEE
HLVSLLAPTSFEAEQYRALRHKIEQLHRSTDLTTIAVSSPDAGDGKTTTTLNLAGALAQAPDARILLIDADLRGANVAMY
LGLDEHTAPGLVDAILNPSLTLGSVVQTHPYLNLTVITAGRQPTSPYEVLKSPRLGELLAEAREKYDYVIVDTPPLVSVP
DSQVLARLVDGFVLVVGAHRTPRRLLLEALNLLEPTRVVGLVFNGDDRHLSRDSYASKRVYEMTVDGTRRHRFSSRSRGR
QTSSDE
>gnl|bykdb|A0A2V6ZW34 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=325 residues).
MSKFFKALEQAERDNVEQVSQAPVEVVSHRPSVMTPPVVTPPPPRAPSPVDEPPAPPAESPRPVFEAPRPVFKAPRPVVR
SPRVASALLDEHLVSLQAPSTAAAEQYRVLRHLVETLRKRTNLQVLAVTSPGVGDGKSVTAINLAGALAQSEEARVLLVD
MDLRRPAIARYLALGESRPTLADALGTPGLALKDAVVQVPSFNLSVLRAPVSAAAPYELLRSPKLEALLAEARQEYDYVV
IDTPPFVPVPDCRVIAKSVDGFVVVVASNRTQRGLLAETLKAMDPDKAVGFVFNAHPTLPTSYYDYGNGHSHGKTRSGRR
KGERS
>gnl|bykdb|A0A2V7A3P7 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=1145 residues).
MPRVFGHYVPARLLTLAAGEAAIVFGSVFLGLALPLVGFHVIRPAWGDGFAPSMVLTTLVLSMAHIAALYDTRQDYGRAE
LLLRLTIAFVAAYLVIAMLGYFILHLTLARKAFLLSFVTAFPASFLLRLVHGRLTAQSRARRKVLLLGSGEVSQMIAATV
RASRHTYEVVGRLDANGRGGDGSDGVWSLGTLEDLDWVSKVTRPDVIVVALEERRGTLPVSEIVESKLQGTEIEDWPNFY
EKLTGKIPVGNLRPSWLVFADGFKPARITVLTKRTIDLLGSLCVVMLSLPVMLLIAVAIRLDSPGPVFFRQERLGRFGRV
FLMFKFRSMLQGEGAALPSPTGGQAGHHGLGPGQEPVRCDRREHLGQIGIRPLLHQEHVDLSRHADPAPHRPDRAFHEGI
RRMEAKTSSVDYVRLLRRVAIQRWRLILAGFLAVVLPTMVIVILSTENLYEASATLFILPETSDAGFLRDFTSSEASSLY
LVLLRSRSLAQAIMEALPNESRDELSRRVIFRDYLLTVMNSIRRYTGGAVVVYSPSEVAIRELQEARMSFVLGKDGTVTI
TAVAFSPRVAMDLANTYVEVLLSKSSSFARQQARGTRDLLENLWSQAKANQTEAEDALRKYQAKNGGTLKLPEEAKVELT
SLANLESQLNDLQINREIAENKLAYLKGDKKKPGGMTLAADPSVQALRDRLAQLETKLAALTEKYTDQHPSVQNAQADIQ
ETQQRLAAALQPQQSPRPGGAQVPLRPVENAQLSKQMAALDVEIVSLQAKEDTLQQRANRLRRSLSAMSGREQEYSGLLR
AVMTQTKLTDMLSDKLTAARITERSQIRSIHVIDLANLPRQPSPRQPLKLILFGLVGGLGFGIGAATLREYMTQIVETEQ
EVIHATGLPVLGSIPIAEHIEPLVKGPREQQPVLFGSGDVFYSLPADACRAIRTGLDCQSLNRPLKTLLITSPGAHEGKS
TVLLNLGRAFLEADRQLLIMDADLRRPALHKALEVPNEVGLADVLREGTVWPEAFRSLGPGLYFMPAGTRRPNPSSLLSS
RHMGTVLQEARDRADIVLIDAPPVLAVADCLPLCRQVDGVILVIRFGSTRRRSLQRAKDQLQKVGANVVGVVINGLSRRE
TRHYYAEYTHYVGIQKHRRRGHKPK
>gnl|bykdb|A0A2V7A9S9 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=668 residues).
MAPEDADMYLNFYALTEKPFNPTPDPKFLYMSPAHREALAQLSYGVQERRGFMLLTGKVGTGKTTLLHALRKRLTSQTAI
SFVFNTTLPFDGILEYILEDLGIAKGLESRAQRLIALQHFLVDRERAGENTVLIFDEAQNLDAATLEQIRLLSNFETPTD
KLLQILLVGQPELRAKLSLPELQQLKQRIGLRCQIPPLAPEEVRQYIRRRLRIAGSHDLGLFSDAAVDRLTEYSGGIPRV
INMVCDHSLVFGYADQKRRIDRPIVNQAIEYLEEGASPSSQPKAVKLNGSRVRLLSRWSFGTLAVALADERAGPCPVSAP
PPAPMSKFFEALEQAQQEKAARRRTVPAAPAEPVAERAPVVTKPPAPAEPVAERAPVFSKPDAPTFPQPVPRRVRRSSLE
PSRGGSNETEEHLQMEEHLVSLLAPTSFEAEQYRTLRHLIEQLHKAAELQVFAVSSPTASDGKTTTAINLAGALAQSHDA
RVLLIDADLRVPTVGTNLGLDERPGPGLADTILNSSLTLDAVVQVRPQLNLSILPAGRLPSAPYEVLKSPRVGELLAEAR
KRYDYIVLDTPPLVSVPDCRVIGRWVDGFLIVVAAHKTPRKLLEEAIRVAEPAKVVGLVFNGDDRHLSRDSYASYAARQF
SDGHGGGWWRGPFGTRDRRHRKHTASDD
>gnl|bykdb|A0A2V7AFT7 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=304 residues).
MSRFFKALEQAEHEQALRRQTAPVEPALAAPVLPARTPFPAGTWPAPRGPVSAARKSAPAFSSDLDEHLVSMLAPNSFEA
EQYRALRHQIEQLHKTTNLAIVAVSSPSVADGKTTTAINLAGALAQAPDARVLLIDADLREGSLARRLGFDVDRGPGLVE
AILDAHLTLDAVAHADRSLNLSVLTGGRLPSAPYEVLKSPRVGELLGEARRRYDYIVLDTPPLVLVPDCRVIGRWVDGFL
IVVTAHQTPRKLLEEALNVTEPAKILGLVFNGDDRHVSRGYSYGGGRGSHTYGRARRRQTAPDD
>gnl|bykdb|A0A2V7AVY2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=745 residues).
MDAKTTGSIDYLRLVRRVVVHRWRIIVAGFLVVVVPTVALVTLSTENLYEASVTLFLLPEKNDPPFLREFTSPEATAVYI
VLLKSRSLAQAIIEALPKESREELTKRVLFRDYLLTATNSLRRLTGGEVVVYSPSELAIRELQEARMNFNIARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLMAQARSSQGEAEDAMRRFQAKAGGRFTLPDESKGELTA
LAQIESQIGDLQVTREIAENKLGYLKGEKVRPISAPASSDPSTQSLQERLTQLEAKLAALSEKYTDQHPSVQTTRAEIQE
TQERLASTLQPRQTPRPGGTATQLKPIEAAQLSKQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMRT
VLTQAKLTDLISDKLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLALGVSAATVREYAVQVVETEQD
VAHATGLPVLGSIPVAERSESASGREVAPVDDLPMLFVAGNDLHSLPADACRAIRTVLDGPSLDKPLKTLLVTSPGAHEG
KSTVLLNLGRAFLETDRHLLMIDADLRRPSLHRALRTPNEVGLADVLRDGTVWPEAFRALAPGMDFMPSGIRPANPSSLI
ASKHMVRVLELARERADVVLIDAPPVLAVADCLPLCRYVDGVILVARFGITRRRSLIRAKAQLGRVGARVVGVVINGLSR
HETRHYYAEYTHYVGIQKRKGKRRQ
>gnl|bykdb|A0A2V7B9E3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=751 residues).
MVEELSGPHVGYLGLLRRIASHWRLSLIVCVGVAAPVAVWALLFLPKSYEAVAAIFIEDPRRGSVSTLRDWMPAGDASYQ
QAVLRSRSLAAAVVDNLPQDSMNELIRHAMHRDYVLAGQNLIRRLLGHEPVVFSPQQRAVRELLTARVRFESLPSGEVEI
RAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATRQFIENLLAQTKANLQEAEESLAKHQRGGTLKLPERSSVEMAQL
AQLESNLADIQASEEIAKRRLAGLKGGKDSAGMPGRAARQALSERLAALEAKLATLEEKYASEHPLVKSTQAEINELKTA
LAAPPSISPGGRSAIRLTLGPADQAAVAKQVADAEVELASLQNREDVLKQRIARLSSRLSALGAEEWETSKVLRRVETHR
SLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFGLGVGVAGVIEYFNQPIETEDDVFDAT
GLPVLGWLPTIAGHQPTTGVEREPLNLVNGSIPDTLPVEGCRSIRTSLESLNGSRKLQSIMLASAGPKEGKSTIVLNLAW
VFWELGRRLILIDADLRRPSLHRGLRCPPQPGLADMLTGNVPWPRAGQGIREGFVFLPAGSTGTAKPGVLLTVAKLRGAL
ELLTSHADLVLFDSAPVLAVADNLILASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVSPRETRRYYGR
YGDYYGSRDGNIEPWWQRCRFWANKRTGVLR
>gnl|bykdb|A0A2V7BA71 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=287 residues).
MSKFFEALERAEQERAVRFQAAPSEPTNARGPAVPETALDPALRSAPELPRGVANGLDEHLVSLLAPTSFEAEQYRALRH
LIEQRGKSTALSVVAVSSPGVADGKTTTAINLAGALAQAPDARVLLIDADLRGAAVAARLGWDARVGPGLADAILDASLT
LETAAHACPHLNLSVLPAGRRPSATYEVLKSPRVGELLAEARKRYDYVILDTPPLVLVPDCRVIEKWVDGFLIVVTAHRT
GRKFLGEALNLAERTKVVGLVFNGDDRHLSRNSYGSYATRLSKRNRK
>gnl|bykdb|A0A2V7BAF4 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=579 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKLPVAAEPPAQPEPEVPVVAKASKPRKESQPAAAPKATPTPAPEVVATAPASTP
RKESQPAAAPKATPTPAPEVVAVAPTITPRNETRPPVAVETPAPVEPELATVEAAVATEVEPEPEPEIATDIQHAIYTEL
YPIFHPDGVEIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIE
PEIHADVEPEIHADVEPEIRMHEEPEIQAEVEDETEAEAAFATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVD
DRLVTLLTPNSFAGEQYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNG
QLGLRGFNPKGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVP
DCRVISSGVDGFLVIVNAHKTATRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHG
NGNASGNGTGYLSGNGITH
>gnl|bykdb|A0A2V7BRT3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=310 residues).
MSTFFEALERAEQERAVRFQAAPGASTSAPDPPVPESAPDPGLRSLPELPRGAANGLEEHLVSLLAPTSFEAEQYRALRH
LIEQLHKSTGLVVVAVSSPTVADGKTTTSINLAGALAQAPDARVLLIDADLRGAALGPRLGLEEGGGPGFVEAILDANLP
LAAVVQARPQLNLSVLPAGRFPSAPYEVLMSPRVGELLAEARRQYDYVILDTPPLVSVPDCRVIEKWVDGLLIVVTAHRT
ARKLVEEALNVTDRAKVVGLVFNGDDRHLSRDSYGSYGSRRSSSRNGGGRRRRVFWSLDRIRRRRTASDD
>gnl|bykdb|A0A2V7C3J3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=745 residues).
MDAKTTGSIDYLRLVRRVVVHRWRIIVAGFLVVVVPTVALVTLSTENLYEASVTLFLLPEKNDPPFLREFTSPEATAVYI
VLLKSRSLAQAIIEALPKESREELTKRVLFRDYLLTATNSLRRLTGGEVVVYSPSELAIRELQEARMNFNIARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLMTQARSSQGEAEEAMRRFQAKAGGRFKLPDESKGELTA
LAQIESQIGDLQVTREIAENKLGYLKGEKVRPISAPASSDPSTQSLQERLTQLETKLAALSEKYTDQHPSVQTTRAEIQE
TQERLASTLQPRQTPRPGGTATQLKPIEAAQLSKQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMRT
VLTQAKLTDLISDKLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLALGVSAATVREYVVQVVETEQD
VAHATGLPVLGSIPVAERSESASGREVAPGDDLPMLFVAGNDLHSLPADACRAIRTALDCQSLDKPLKTLLVTSPGAHEG
KSTVLLNLGRAFLETDRHLLMIDADLRRPSLHRALRTPNEVGLADVLRDGTVWPEAFRALAPGMDFMPSGIRPANPSSLI
ASKHMVRVLELARERANVVLIDAPPVLAVADCLPLCRYVDGVILVARFGITRRRSLIRAKEQLGRVGARVVGVVINGLSR
HETRHYYAEYTHYVGIQKRKGKRRQ
>gnl|bykdb|A0A2V7CEX0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=304 residues).
MSKFHEALERADTEEALGTTASAPRRTVDVSASPAPEAPSVEVPPAAPPHFPRPVFEAPPRATKREVDRADRIEACLVSL
LDPRSFEAEQYRVLRHVVETLRKGANLQVLAVTSPGVGDGKTTIAINLAGALAQAVDARVLLVDIDIRRPAVARQLGLAG
SKRSLVTTLLDASFTLENSVERLAHFNLSVLPAGEPAVAPYEVLKSPRLEALLDEARQCYDYIVLDTPPFLPVPDCRVIA
KCVDGFLTVVKAHRTLRGELAQTLDLMDPAKVVGLVFNGDHARRSSYYDVYTAPPRRRRLWRSP
>gnl|bykdb|A0A2V7CME2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=553 residues).
DAFIAQQMDRMVEATRYATQFLAKQLEEARGKLGESETQLSNFLNANGIIFVTADRNGNPQDIITQQLSIMSEAFLRARS
DRMAKESLLTQASVQDAFTLPAVLQSPLIAQLKTDGAAQEGEYRRLSQTFKPDYPKMLALKEKIEENRRQLRTETDRTLA
SLKVDFEASVRAEKSLEASLTRQSTLARGLAENMAQYNLLRREVDTSRDLYSSLLGRLRETQVSAALLTSNISVVDPAEI
PAGPSRPRKGLNLLIACVAGLAGGIGLAFLFEYLDTNIKDTKEVESVLRVPALGVVPSRAAFERMLARRKALEAGPGAST
PFALVSHSELPSVFAEAFRNLRTSILYSTPERPPKTLMMTSLQPEDGKTSLVTNLAITLSQLGGSPVLLVDADMRRPMVH
RVLSVEQTPGLSTYLTGQADLDQVIVPSGIPNLFVIPAGRIPVNPAELLASARLREAIETLGQRFAYIVFDTGPMFGVSD
AMILAGQLEGTVLVLRHGRASRDAAQRAIRSLIAVRARLLGVILNDVDLQANSYGYYDSYYLRPDDSRLAERV
>gnl|bykdb|A0A2V7CNK3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=746 residues).
METQKQGSVDYLRLLRRVALQRWRVIVVGFLAVVVPVAILVSFSTENLYEASATLFLMPEKNDPPFLREFTTPEATAIYI
VLLRSRSLAQAITEALPKESRDELTKRVLFRDYLLTFMNSIRRFTGGEVVVYSPSEIAIRELQEARMSFNVARDGTVTIT
AVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTRELLENLLAQAKSHQGDAEEAMRRYQQRTSGSLKLPDESRGTVTA
LAQLEGQIADLQVSREIAENKLAYLKGDKPRAGGAFPGSDPATQSLQDRLTQLEAKLSALNEKYTDEHPSVQTTRAEIQE
AQERLASALRPRQAPKPGGAPAPLKPLEAANLVKQMAALQVEGVSLQAREEILEQRANRLRRSLSAMSAREQEYSGFLRP
VLTQTKLADMISDKLTAARISEQSQIRSIHVIDLANLPRQPSPRQPVKLLVFGLLGGLGLGIGAAMLREHMTQVIETEND
VIRATGLPVLGSIPVAEAAESSGKDGAQSELMPVLFVAGNDLHSLPADACRAIRTALDCQSLERPLKTLLVTSPGAHEGK
STVLLNLSRAYLETDRQLLVIDADLRRPSLHRTLRIPNEVGLADMLRAGTVWPEAFRSLAPGMSFVPSGIRPTNPSSLIS
SKHMTHVLELARERADVVLIDAPPVLAVADCLPLCRRVDGVILVVRFGVTRRRSLQRAKDQLERVGARIVGVVINGLSRH
ETRLRYAEYTHYVGLQKRRKKGKRRK
>gnl|bykdb|A0A2V7D2F0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=314 residues).
MGLSLRSRARGARSAGPMSKFVEALEHAERERVLGQRLDGSSLTAPAAAPVAEVSAALEPVRDAELPVGSPLDEHLVSLL
KPTSFEAEQYRALRHLIEHLHRTAELSVVAVSSPVADDGKTTTAINLAGALAQDPQARVLLLDADLRRGALAHRLGLREP
SPRGFVDVILDGKLTLEAVVKRCPPFNLSIVPAGLLPSAPYEVLKASRVGELLAAARHEYDFIVLDTSPLVSVPDCRVLE
KWVDGFLVVVAAHKTPRKLLEEALNVTDPAKIVGLVFNGDERPLAGYSHGYGHSTNGSTAGWKFFGRGRSAARA
>gnl|bykdb|A0A2V7DAK1 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=566 residues).
MSEFFRALEQAGRDRDERLAKQRNNRKPPVAAEPPAQPEPEVPVVAKASTPRKESQPAAAPKATPTPAPEVVATAPVSTP
RKESRPAAAPTPTPTPEPEVVAVAPTITPRHETRAPVAVEIRAPEPEMVATIEAAVATEVEPEPEPEPEIATDIQRAIYT
ELHPIFHPEVEAEIDAEVESEMPVDVESEIHADVEIHAAIAPELHEDIETEIHEEVEPEVYAVIEPEIHADVEPEIYADV
EPEIRMHEEPEIQAEVEDETEAEAACATEGGRAATPMPFAMRAADAPAFTESVPTVKDDDAESVDDRLVTLLTPNSFAGE
QYRTLRHLVEKMHTETGVSVVGVSSPSIGDGKTTTAINLAGALAQARETKVLLIDMDLRRPAVNGQLGLRGFNPKGVVAV
LGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRVISSGVDGFLII
VNAHRTPTRLLSETVSVLGQSKVLGLIFNRDDQPIAEHLYNSYGPDPSGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLS
GNGITH
>gnl|bykdb|A0A2V7E6Z5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=506 residues).
MSEFFRALEQAGRDRQEQLAKQRNERKPAAEPPAQPEPEVPVVAKASKPRKESRPVVAAKPSPRPEPEAAAVVPTSTPRN
EPGPSAAVEPPVPPHVEPAIYVEPEVLVATAVATELEPGIDTEVVPEHHAEVEPEIYTELVPEHHAEVEPEIYTELVPEH
HAEVEPEIYAELVPEHHAEVEPEIYTELEPGIDTEVVPELHAEVEAEEETELETEVATENAVAPTPMPFSMRSSDAPAFT
ESVPTVKDDDAESVNDRLVTLLTPNSFAGEQYRTLRHLVEKMHTDTGVSVVGVSSPSIGDGKTTTAINLAGALAQARDTK
VLLIDMDLRRPALNGQLGLRGFNPKGVVAVLGAGASLDDVIVELPMFNLSIIPSGPRQSAPYELLKSSRLHQMIDEARRR
FDYVIIDTPPVIAVPDCRVISSGVDGFLIIVNAHKTPTRMLGETVSVLGQSKVLGLVFNRDDQPMAEHLYNSYGPDPNAG
WTATMRRRWRRSGHRYGNGHSHENSH
>gnl|bykdb|A0A2V7F4L5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=576 residues).
MYLTFYGLKEKPFNATPDPRFLYLTPGHREALAQLLYSVQESRGFLVLTGEVGTGKTTLLQAFLQRLNGRAAVAYVFDST
LPFDGLLEYVLEELGVPTPERSPAQRLLALQRFMLDRRRAGQNTVLVLDEAQNLDAPTLERIRMLSNYETPTVKLLQILL
VGQPELGCGRTRPRALQSPGSDPDCRLLGRDPAPREHSVRPLPRRRLRRPAATDRRRYCRPGHRGARGCGAASGALARFA
GPGSVGTLALGRGRRRGARRARPGPAMSKFFEALERAEREQALRTPASSPSTTADLSGAQAPPAPSGAVEPAGPPLFERP
VFESPATATELAVDRSDRAEAHLVTLLNPASFEAEQYGVLRHVMETLRKSANLKVVAITSAGVGDGKTTTAINLAGALAQ
SVDARVLLVDIDVRRPAVARQLKLAGSKRSLVDALMDSSLKVEDTVEHLAHFNLSVLRAGGPTLAPYELLKSSRLEALLD
QARQRYDYIVLDTPPFVPVPDCRLIAKCVDGFLIVVAAHRTPRSALAETLDLLEPAKVVGLVFNGDSVRRSSYSGYYHAH
VGSSRGARWRRAWRKP
>gnl|bykdb|A0A2V7FF08 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=290 residues).
MSKFFEALERAEREQATQASSPGTTDGPSASPRIEPPVVQATAPANELAVDGSHRVEALLVSLLDPASFEAEQYRVLRHV
VETLRKGANLQVVAVTSPGIGDGKTTTAINLAGALAQSASARVLLVDMDLRRPAVARRLGLAGSKRALVDALLDSGLTLG
DTVEPLAYFNLSVLPAGKPAVAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRVIAKYVDGFLTVVAAHRTPR
SALAQALDLMDPGKVAGLVFNGDDARRSSYYSAYVGSPRGARWRRPWRKP
>gnl|bykdb|A0A2V7GJE5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=342 residues).
MSKFFKALEQAEHDRAVREQARRPEGKPAAAPPPTPGASREVSSATVAAPAAPPAARPAEPARDPADRRSVGRVWTAEAP
RPKDRAEGPWGEIDEHLVSLLNPTSPDAEQYRALRHAVEQLHRSAGLTALAVSSPTVGDGKTTTAINLAGALAQDPEARI
LLVDADLRRPSVGNRLGLRNSRDRGLVDLVLAPDLTLDDVVRRRPSYNLSVLAAGRAAAAPYEVLKSPRLGNLLDQARQQ
YDFIVLDTPPIVLTQDCRVISKWVDGFLLVVGADRTPAKLVEEALNRMEADKIVGFVFNDDARSLSRYYSYGYTAKRHEE
EGAGWRRAMTRIAGSFRQRHSF
>gnl|bykdb|A0A2V7I866 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=235 residues).
MLDGLIQRLTSKPELLHEYAALRSGLNLGSSSGGCKSVLVTSAQPLDGKTTIVLDLGLTAMLSGRKVIIVDADLRKPRIH
EALELPNTLGLSDILGARTHAREVIQTVKAMGGNPLDDRSVSVITAGLGGAPLTETLGGPTLKDAIGELTRAYDVVLVDS
PPVLAADDALLLAPLVDGVIVVVHTGIVTERDLKLTKARLEGVGGRVLGVVMNRFDPRVHGPGAHPYAARYYERG
© 1998-2019